Histone H2A

Overview
NameHistone H2A
Smed IDSMED30017222
Length (bp)393
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone H2A (SMED30017222) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone H2A (SMED30017222) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone H2A (SMED30017222) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone H2A (SMED30017222) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017222

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 21

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30017222SMESG000074553.1 SMESG000074551.1 dd_Smed_v4_1484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017222SMESG000074553.1 SMESG000074551.1 dd_Smed_v4_1484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017222SMESG000074553.1 SMESG000074551.1 dd_Smed_v4_1484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017222SMESG000074553.1 SMESG000074551.1 dd_Smed_v4_1484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017222SMESG000074553.1 SMESG000074551.1 dd_Smed_v4_1484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017222SMESG000074553.1 SMESG000074551.1 dd_Smed_v4_1484_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017222SMESG000074553.1 Contig36175newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017222SMESG000074553.1 Contig36175uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017222SMESG000074551.1 SMESG000074553.1 Contig22339newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017222SMESG000074551.1 SMESG000074553.1 Contig22339uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017222SMESG000074551.1 SMESG000074553.1 Contig8657newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017222SMESG000074551.1 SMESG000074553.1 Contig8657uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017222SMESG000074553.1 Contig50904newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017222SMESG000074553.1 Contig50904uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30017222SMESG000074553.1 SMESG000074551.1 dd_Smed_v6_1484_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017222SMESG000074553.1 SMESG000074551.1 dd_Smed_v4_1484_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30017222SMESG000074553.1 SMESG000074551.1 dd_Smed_v4_1484_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017222SMESG000074553.1 SMED_02071_V2_1rGPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30017222SMESG000074553.1 SMED_02071_V2_1rGPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30017222SMESG000074553.1 SMESG000074551.1 SMED_02071_V2_1rGPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30017222SMESG000074553.1 SMESG000074551.1 SMED_02071_V2_1rGPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone H2A vs. Ensembl Human
Match: H2AZ1 (H2A.Z variant histone 1 [Source:HGNC Symbol;Acc:HGNC:4741])

HSP 1 Score: 178.718 bits (452), Expect = 1.164e-58
Identity = 97/101 (96.04%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLKSRTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. Ensembl Human
Match: H2AZ2 (H2A.Z variant histone 2 [Source:HGNC Symbol;Acc:HGNC:20664])

HSP 1 Score: 177.948 bits (450), Expect = 2.272e-58
Identity = 96/101 (95.05%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. Ensembl Human
Match: H2AZ1 (H2A.Z variant histone 1 [Source:HGNC Symbol;Acc:HGNC:4741])

HSP 1 Score: 172.17 bits (435), Expect = 4.624e-56
Identity = 96/101 (95.05%), Postives = 99/101 (98.02%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLKSRTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIA GGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIA-GGVIPHIHKSLIGKK 121          
BLAST of Histone H2A vs. Ensembl Human
Match: H2AZ2 (H2A.Z variant histone 2 [Source:HGNC Symbol;Acc:HGNC:20664])

HSP 1 Score: 166.777 bits (421), Expect = 2.617e-54
Identity = 91/95 (95.79%), Postives = 95/95 (100.00%), Query Frame = 1
Query:   82 FPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
            FPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:    2 FPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 96          
BLAST of Histone H2A vs. Ensembl Human
Match: H2AZ2 (H2A.Z variant histone 2 [Source:HGNC Symbol;Acc:HGNC:20664])

HSP 1 Score: 154.836 bits (390), Expect = 2.679e-49
Identity = 83/93 (89.25%), Postives = 90/93 (96.77%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHI 342
             RAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGG+  ++
Sbjct:   22 QRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGMYYYL 114          
BLAST of Histone H2A vs. Ensembl Celegans
Match: htz-1 (Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q27511])

HSP 1 Score: 162.54 bits (410), Expect = 1.814e-52
Identity = 92/107 (85.98%), Postives = 98/107 (91.59%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK--PIIGQ 381
            RAGLQFPVGRIHR LK RTTS GRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHL LAIRGDEELDTLIKATIAGGGVIPHIH+ L+ KK  P+ G+
Sbjct:   25 RAGLQFPVGRIHRFLKQRTTSSGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLHLAIRGDEELDTLIKATIAGGGVIPHIHRYLMNKKGAPVPGK 131          
BLAST of Histone H2A vs. Ensembl Celegans
Match: htz-1 (Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q27511])

HSP 1 Score: 162.54 bits (410), Expect = 1.814e-52
Identity = 92/107 (85.98%), Postives = 98/107 (91.59%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK--PIIGQ 381
            RAGLQFPVGRIHR LK RTTS GRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHL LAIRGDEELDTLIKATIAGGGVIPHIH+ L+ KK  P+ G+
Sbjct:   25 RAGLQFPVGRIHRFLKQRTTSSGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLHLAIRGDEELDTLIKATIAGGGVIPHIHRYLMNKKGAPVPGK 131          
BLAST of Histone H2A vs. Ensembl Celegans
Match: htz-1 (Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q27511])

HSP 1 Score: 162.54 bits (410), Expect = 1.814e-52
Identity = 92/107 (85.98%), Postives = 98/107 (91.59%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK--PIIGQ 381
            RAGLQFPVGRIHR LK RTTS GRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHL LAIRGDEELDTLIKATIAGGGVIPHIH+ L+ KK  P+ G+
Sbjct:   25 RAGLQFPVGRIHRFLKQRTTSSGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLHLAIRGDEELDTLIKATIAGGGVIPHIHRYLMNKKGAPVPGK 131          
BLAST of Histone H2A vs. Ensembl Celegans
Match: his-35 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485])

HSP 1 Score: 108.612 bits (270), Expect = 2.120e-31
Identity = 64/101 (63.37%), Postives = 77/101 (76.24%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKA-TIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGR+HR L+    +  RVGA A VY AA+LEYL AEVLELAGNA++D K  RI+PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK
Sbjct:   22 RAGLQFPVGRLHRILRKGNYAQ-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKK 121          
BLAST of Histone H2A vs. Ensembl Celegans
Match: his-35 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485])

HSP 1 Score: 108.612 bits (270), Expect = 2.120e-31
Identity = 64/101 (63.37%), Postives = 77/101 (76.24%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKA-TIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGR+HR L+    +  RVGA A VY AA+LEYL AEVLELAGNA++D K  RI+PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK
Sbjct:   22 RAGLQFPVGRLHRILRKGNYAQ-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKTRIAPRHLQLAVRNDEELNKLLAGVTIAQGGVLPNIQAVLLPKK 121          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2Av (gene:FBgn0001197 transcript:FBtr0085062)

HSP 1 Score: 180.259 bits (456), Expect = 2.034e-59
Identity = 99/108 (91.67%), Postives = 102/108 (94.44%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKKPIIGQKPM 390
            RAGLQFPVGRIHRHLKSRTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK    Q P 
Sbjct:   23 RAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKEETVQDPQ 130          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2Av (gene:FBgn0001197 transcript:FBtr0334311)

HSP 1 Score: 180.259 bits (456), Expect = 2.034e-59
Identity = 99/108 (91.67%), Postives = 102/108 (94.44%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKKPIIGQKPM 390
            RAGLQFPVGRIHRHLKSRTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK    Q P 
Sbjct:   23 RAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKEETVQDPQ 130          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33850 (gene:FBgn0053850 transcript:FBtr0091854)

HSP 1 Score: 108.997 bits (271), Expect = 1.742e-31
Identity = 65/102 (63.73%), Postives = 77/102 (75.49%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIK-ATIAGGGVIPHIHKSLIGKK 366
            +RAGLQFPVGRIHR L+    +  RVGA A VY AA++EYL AEVLELAGNA++D K  RI PRHLQLAIR DEEL+ L+   TIA GGV+P+I   L+ KK
Sbjct:   19 NRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKK 119          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33847 (gene:FBgn0053847 transcript:FBtr0091851)

HSP 1 Score: 108.997 bits (271), Expect = 1.742e-31
Identity = 65/102 (63.73%), Postives = 77/102 (75.49%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIK-ATIAGGGVIPHIHKSLIGKK 366
            +RAGLQFPVGRIHR L+    +  RVGA A VY AA++EYL AEVLELAGNA++D K  RI PRHLQLAIR DEEL+ L+   TIA GGV+P+I   L+ KK
Sbjct:   19 NRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKK 119          
BLAST of Histone H2A vs. Ensembl Fly
Match: His2A:CG33844 (gene:FBgn0053844 transcript:FBtr0091848)

HSP 1 Score: 108.997 bits (271), Expect = 1.742e-31
Identity = 65/102 (63.73%), Postives = 77/102 (75.49%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIK-ATIAGGGVIPHIHKSLIGKK 366
            +RAGLQFPVGRIHR L+    +  RVGA A VY AA++EYL AEVLELAGNA++D K  RI PRHLQLAIR DEEL+ L+   TIA GGV+P+I   L+ KK
Sbjct:   19 NRAGLQFPVGRIHRLLRKGNYAE-RVGAGAPVYLAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKK 119          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: h2az2a (H2A.Z variant histone 2a [Source:NCBI gene;Acc:252913])

HSP 1 Score: 177.948 bits (450), Expect = 1.445e-58
Identity = 96/101 (95.05%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: h2az2b (H2A.Z variant histone 2b [Source:ZFIN;Acc:ZDB-GENE-050506-24])

HSP 1 Score: 177.563 bits (449), Expect = 2.030e-58
Identity = 96/101 (95.05%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: h2az2b (H2A.Z variant histone 2b [Source:ZFIN;Acc:ZDB-GENE-050506-24])

HSP 1 Score: 177.563 bits (449), Expect = 2.098e-58
Identity = 96/101 (95.05%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: hist1h2a1 (histone cluster 1 H2A family member1 [Source:ZFIN;Acc:ZDB-GENE-121214-150])

HSP 1 Score: 108.612 bits (270), Expect = 3.333e-31
Identity = 65/101 (64.36%), Postives = 77/101 (76.24%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKA-TIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGRIHR L+    +  RVGA A VY AA+LEYLTAE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK
Sbjct:   21 RAGLQFPVGRIHRLLRKGNYAQ-RVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK 120          
BLAST of Histone H2A vs. Ensembl Zebrafish
Match: si:ch1073-153i20.5 (si:ch1073-153i20.5 [Source:ZFIN;Acc:ZDB-GENE-160113-104])

HSP 1 Score: 108.227 bits (269), Expect = 4.590e-31
Identity = 64/101 (63.37%), Postives = 77/101 (76.24%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKA-TIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGR+HR L+    +  RVGA A VY AA+LEYLTAE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK
Sbjct:   21 RAGLQFPVGRVHRLLRKGNYAQ-RVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK 120          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: arrdc2 (arrestin domain containing 2 [Source:Xenbase;Acc:XB-GENE-946088])

HSP 1 Score: 177.948 bits (450), Expect = 2.060e-58
Identity = 96/101 (95.05%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: h2a.zl (H2A.Z variant histone 1 [Source:NCBI gene;Acc:448675])

HSP 1 Score: 173.711 bits (439), Expect = 1.199e-56
Identity = 95/100 (95.00%), Postives = 96/100 (96.00%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGRIHR LK+RTTSHGRVG TAAVY AAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   24 RAGLQFPVGRIHRLLKNRTTSHGRVGGTAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDALIKATIAGGGVIPHIHKSLIGKK 123          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: h2a.zl (H2A.Z variant histone 1 [Source:NCBI gene;Acc:448675])

HSP 1 Score: 173.326 bits (438), Expect = 1.354e-56
Identity = 95/100 (95.00%), Postives = 96/100 (96.00%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGRIHR LK+RTTSHGRVG TAAVY AAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   23 RAGLQFPVGRIHRLLKNRTTSHGRVGGTAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDALIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: arrdc2 (arrestin domain containing 2 [Source:Xenbase;Acc:XB-GENE-946088])

HSP 1 Score: 112.464 bits (280), Expect = 5.268e-33
Identity = 55/58 (94.83%), Postives = 58/58 (100.00%), Query Frame = 1
Query:  193 EVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
            +VLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   26 QVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 83          
BLAST of Histone H2A vs. Ensembl Xenopus
Match: ENSXETT00000010097.1 (H2A.X variant histone [Source:NCBI gene;Acc:100487455])

HSP 1 Score: 111.694 bits (278), Expect = 5.362e-32
Identity = 68/112 (60.71%), Postives = 82/112 (73.21%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLI-KATIAGGGVIPHIHKSLIGKK-----PIIGQK 384
            RAGLQFPVGR+HR L+    +  RVGA A VY AA+LEYLTAE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+ K TIA GGV+P+I   L+ KK     P  G+K
Sbjct:   21 RAGLQFPVGRVHRLLRKGNYAE-RVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKSSSTAPTSGKK 131          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2az1 (H2A.Z variant histone 1 [Source:MGI Symbol;Acc:MGI:1888388])

HSP 1 Score: 178.718 bits (452), Expect = 7.994e-59
Identity = 97/101 (96.04%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLKSRTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2az2 (H2A.Z histone variant 2 [Source:MGI Symbol;Acc:MGI:1924855])

HSP 1 Score: 177.948 bits (450), Expect = 1.560e-58
Identity = 96/101 (95.05%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2az1 (H2A.Z variant histone 1 [Source:MGI Symbol;Acc:MGI:1888388])

HSP 1 Score: 122.479 bits (306), Expect = 6.905e-37
Identity = 75/101 (74.26%), Postives = 77/101 (76.24%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLKSRTTSHGRVGATAAVY+AAILEYLTAE                       LAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAE-----------------------LAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 99          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2az2 (H2A.Z histone variant 2 [Source:MGI Symbol;Acc:MGI:1924855])

HSP 1 Score: 112.849 bits (281), Expect = 3.336e-33
Identity = 55/58 (94.83%), Postives = 58/58 (100.00%), Query Frame = 1
Query:  193 EVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
            +VLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   27 QVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 84          
BLAST of Histone H2A vs. Ensembl Mouse
Match: H2ac1 (H2A clustered histone 1 [Source:MGI Symbol;Acc:MGI:2448285])

HSP 1 Score: 112.079 bits (279), Expect = 2.015e-32
Identity = 65/101 (64.36%), Postives = 79/101 (78.22%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLI-KATIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGR+HR L+    +  R+GA A VY AA+LEYLTAEVLELAGNA++D K  RI+PRHLQLAIR DEEL+ L+ + TIA GGV+P+I   L+ KK
Sbjct:   21 RAGLQFPVGRVHRLLRQGNYAQ-RIGAGAPVYLAAVLEYLTAEVLELAGNAARDNKKTRITPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK 120          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|P08985|H2AV_DROME (Histone H2A.v OS=Drosophila melanogaster OX=7227 GN=His2Av PE=1 SV=2)

HSP 1 Score: 180.259 bits (456), Expect = 2.039e-58
Identity = 99/108 (91.67%), Postives = 102/108 (94.44%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKKPIIGQKPM 390
            RAGLQFPVGRIHRHLKSRTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK    Q P 
Sbjct:   23 RAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKEETVQDPQ 130          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|Q5ZMD6|H2AZ_CHICK (Histone H2A.Z OS=Gallus gallus OX=9031 GN=H2AFZ PE=1 SV=3)

HSP 1 Score: 178.718 bits (452), Expect = 5.294e-58
Identity = 97/101 (96.04%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLKSRTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|Q6YNC8|H2AZ_SHEEP (Histone H2A.Z OS=Ovis aries OX=9940 GN=H2AZ1 PE=2 SV=3)

HSP 1 Score: 178.718 bits (452), Expect = 5.592e-58
Identity = 97/101 (96.04%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLKSRTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|P0C0S7|H2AZ_RAT (Histone H2A.Z OS=Rattus norvegicus OX=10116 GN=H2az1 PE=1 SV=2)

HSP 1 Score: 178.718 bits (452), Expect = 5.592e-58
Identity = 97/101 (96.04%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLKSRTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. UniProt/SwissProt
Match: sp|Q5RC42|H2AZ_PONAB (Histone H2A.Z OS=Pongo abelii OX=9601 GN=H2AZ1 PE=2 SV=3)

HSP 1 Score: 178.718 bits (452), Expect = 5.592e-58
Identity = 97/101 (96.04%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLKSRTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. TrEMBL
Match: T1KGY2 (Histone H2A OS=Tetranychus urticae OX=32264 GN=107364190 PE=3 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 9.376e-58
Identity = 100/107 (93.46%), Postives = 104/107 (97.20%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKKPIIGQKP 387
            RAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK   GQKP
Sbjct:   23 RAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGATGQKP 129          
BLAST of Histone H2A vs. TrEMBL
Match: A0A4S2KZP0 (Histone H2A OS=Opisthorchis felineus OX=147828 GN=CRM22_010373 PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 3.377e-57
Identity = 102/109 (93.58%), Postives = 106/109 (97.25%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKKPIIGQKPM 390
            HRAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK +  QKPM
Sbjct:   22 HRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK-VPPQKPM 129          
BLAST of Histone H2A vs. TrEMBL
Match: A0A564YZP5 (Histone H2A OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS10946 PE=3 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 3.458e-57
Identity = 99/103 (96.12%), Postives = 103/103 (100.00%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKKPI 372
            HRAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKKP+
Sbjct:   21 HRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKKPL 123          
BLAST of Histone H2A vs. TrEMBL
Match: A0A430Q509 (Histone H2A OS=Schistosoma bovis OX=6184 GN=DC041_0011592 PE=3 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 3.764e-56
Identity = 101/109 (92.66%), Postives = 105/109 (96.33%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKKPIIGQKPM 390
            HRAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK I   KP+
Sbjct:   22 HRAGLQFPVGRIHRHLKARTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK-IPPPKPL 129          
BLAST of Histone H2A vs. TrEMBL
Match: Q5DE19 (Histone H2A OS=Schistosoma japonicum OX=6182 GN=EWB00_001681 PE=2 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 3.764e-56
Identity = 101/109 (92.66%), Postives = 105/109 (96.33%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKKPIIGQKPM 390
            HRAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK I   KP+
Sbjct:   22 HRAGLQFPVGRIHRHLKARTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK-IPPPKPL 129          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: H2AZ1 (histone H2A.Z [Source:NCBI gene;Acc:103038819])

HSP 1 Score: 179.104 bits (453), Expect = 5.814e-59
Identity = 97/101 (96.04%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLKSRTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: h2az2a (histone H2A.V [Source:NCBI gene;Acc:103037668])

HSP 1 Score: 177.948 bits (450), Expect = 1.225e-58
Identity = 96/101 (95.05%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: h2az2b (histone H2A.V [Source:NCBI gene;Acc:103039302])

HSP 1 Score: 177.948 bits (450), Expect = 1.593e-58
Identity = 96/101 (95.05%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: h2az2b (histone H2A.V [Source:NCBI gene;Acc:103039302])

HSP 1 Score: 177.563 bits (449), Expect = 1.662e-58
Identity = 96/101 (95.05%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   13 QRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 113          
BLAST of Histone H2A vs. Ensembl Cavefish
Match: h2az2a (histone H2A.V [Source:NCBI gene;Acc:103037668])

HSP 1 Score: 177.948 bits (450), Expect = 1.930e-58
Identity = 96/101 (95.05%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   28 QRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 128          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005338.1 (pep scaffold:Pmarinus_7.0:GL476820:708214:709027:-1 gene:ENSPMAG00000004859.1 transcript:ENSPMAT00000005338.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.457 bits (267), Expect = 2.124e-31
Identity = 63/101 (62.38%), Postives = 77/101 (76.24%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKA-TIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGR+HR L+    +  RVGA A VY AA+LEYL+AE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK
Sbjct:   21 RAGLQFPVGRVHRLLRKGNYAQ-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPKK 120          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011253.1 (pep scaffold:Pmarinus_7.0:GL479154:926813:927238:-1 gene:ENSPMAG00000010226.1 transcript:ENSPMAT00000011253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.457 bits (267), Expect = 2.804e-31
Identity = 64/101 (63.37%), Postives = 77/101 (76.24%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKA-TIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGR+HR L+    +  RVGA A VY AA+LEYL+AE+LELAGNA++D K  RI PRHLQLAIR DEEL+ L+   TIA GGV+P+I   L+ KK
Sbjct:   21 RAGLQFPVGRVHRLLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK 120          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002388.1 (pep scaffold:Pmarinus_7.0:GL476925:193851:194294:1 gene:ENSPMAG00000002177.1 transcript:ENSPMAT00000002388.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.071 bits (266), Expect = 3.076e-31
Identity = 63/101 (62.38%), Postives = 77/101 (76.24%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKA-TIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGR+HR L+    +  RVGA A VY AA+LEYL+AE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK
Sbjct:   21 RAGLQFPVGRVHRLLRKGNYAQ-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPKK 120          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011166.1 (pep scaffold:Pmarinus_7.0:GL476820:1027708:1028088:1 gene:ENSPMAG00000010139.1 transcript:ENSPMAT00000011166.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.916 bits (263), Expect = 7.399e-31
Identity = 63/101 (62.38%), Postives = 76/101 (75.25%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKA-TIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGR+HR L  +     RVGA A VY AA+LEYL+AE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK
Sbjct:   21 RAGLQFPVGRVHRLL-CKGNYAQRVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPKK 120          
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008684.1 (pep scaffold:Pmarinus_7.0:GL488596:2418:2939:-1 gene:ENSPMAG00000007861.1 transcript:ENSPMAT00000008684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 1.680e-30
Identity = 63/101 (62.38%), Postives = 77/101 (76.24%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKA-TIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGRIHR L+    +  RVGA A VY AA+LEYL+AE+LELAGNA++D K  RI PR+LQLA+R DEEL+ L+   TIA GGV+P+I   L+ KK
Sbjct:   21 RAGLQFPVGRIHRLLRKGNYAQ-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRNLQLAVRNDEELNKLMGGVTIAQGGVLPNIQAVLLPKK 120          
BLAST of Histone H2A vs. Ensembl Yeast
Match: HTZ1 (Histone variant H2AZ; exchanged for histone H2A in nucleosomes by the SWR1 complex; involved in transcriptional regulation through prevention of the spread of silent heterochromatin; Htz1p-containing nucleosomes facilitate RNA Pol II passage by affecting correct assembly and modification status of RNA Pol II elongation complexes and by favoring efficient nucleosome remodeling [Source:SGD;Acc:S000005372])

HSP 1 Score: 141.354 bits (355), Expect = 5.707e-45
Identity = 73/97 (75.26%), Postives = 86/97 (88.66%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLI 357
            RAGLQFPVGRI R+LK   T   RVG+ AA+Y  A+LEYLTAEVLELAGNA+KDLKVKRI+PRHLQLAIRGD+ELD+LI+ATIA GGV+PHI+K+L+
Sbjct:   28 RAGLQFPVGRIKRYLKRHATGRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIRATIASGGVLPHINKALL 124          
BLAST of Histone H2A vs. Ensembl Yeast
Match: HTA2 (Histone H2A; core histone protein required for chromatin assembly and chromosome function; one of two nearly identical (see also HTA1) subtypes; DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p [Source:SGD;Acc:S000000099])

HSP 1 Score: 107.071 bits (266), Expect = 1.638e-31
Identity = 60/101 (59.41%), Postives = 77/101 (76.24%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLI-KATIAGGGVIPHIHKSLIGKK 366
            +AGL FPVGR+HR L+ R     R+G+ A VY  A+LEYL AE+LELAGNA++D K  RI PRHLQLAIR D+EL+ L+   TIA GGV+P+IH++L+ KK
Sbjct:   22 KAGLTFPVGRVHRLLR-RGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKK 121          
BLAST of Histone H2A vs. Ensembl Yeast
Match: HTA1 (Histone H2A; core histone protein required for chromatin assembly and chromosome function; one of two nearly identical subtypes (see also HTA2); DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p; N-terminally propionylated in vivo [Source:SGD;Acc:S000002633])

HSP 1 Score: 107.071 bits (266), Expect = 1.638e-31
Identity = 60/101 (59.41%), Postives = 77/101 (76.24%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLI-KATIAGGGVIPHIHKSLIGKK 366
            +AGL FPVGR+HR L+ R     R+G+ A VY  A+LEYL AE+LELAGNA++D K  RI PRHLQLAIR D+EL+ L+   TIA GGV+P+IH++L+ KK
Sbjct:   22 KAGLTFPVGRVHRLLR-RGNYAQRIGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNVTIAQGGVLPNIHQNLLPKK 121          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO46289 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RQH8])

HSP 1 Score: 177.563 bits (449), Expect = 8.270e-59
Identity = 96/100 (96.00%), Postives = 100/100 (100.00%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 RAGLQFPVGRIHRHLKNRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 121          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO26088 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7TCX1])

HSP 1 Score: 112.464 bits (280), Expect = 3.016e-33
Identity = 66/101 (65.35%), Postives = 79/101 (78.22%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKA-TIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGRIHRHL+    +  RVGA A VY AA+LEYL+AE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I  SL+ KK
Sbjct:   20 RAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO27766 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SEB5])

HSP 1 Score: 112.464 bits (280), Expect = 3.364e-33
Identity = 66/101 (65.35%), Postives = 79/101 (78.22%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKA-TIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGRIHRHL+    +  RVGA A VY AA+LEYL+AE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I  SL+ KK
Sbjct:   20 RAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO27764 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SEB5])

HSP 1 Score: 112.464 bits (280), Expect = 3.364e-33
Identity = 66/101 (65.35%), Postives = 79/101 (78.22%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKA-TIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGRIHRHL+    +  RVGA A VY AA+LEYL+AE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I  SL+ KK
Sbjct:   20 RAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119          
BLAST of Histone H2A vs. Ensembl Nematostella
Match: EDO37980 (Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SEB5])

HSP 1 Score: 112.464 bits (280), Expect = 3.364e-33
Identity = 66/101 (65.35%), Postives = 79/101 (78.22%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKA-TIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGRIHRHL+    +  RVGA A VY AA+LEYL+AE+LELAGNA++D K  RI PRHLQLA+R DEEL+ L+   TIA GGV+P+I  SL+ KK
Sbjct:   20 RAGLQFPVGRIHRHLRKGNYAE-RVGAGAPVYLAAVLEYLSAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNRLLHGVTIAQGGVLPNIQASLLPKK 119          
BLAST of Histone H2A vs. Ensembl Medaka
Match: H2AFZ (histone H2A.Z [Source:NCBI gene;Acc:101172846])

HSP 1 Score: 178.718 bits (452), Expect = 8.205e-59
Identity = 97/101 (96.04%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLKSRTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. Ensembl Medaka
Match: h2az2a (histone H2A.V [Source:NCBI gene;Acc:101170644])

HSP 1 Score: 177.948 bits (450), Expect = 1.217e-58
Identity = 96/101 (95.05%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   22 QRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 122          
BLAST of Histone H2A vs. Ensembl Medaka
Match: h2az2a (histone H2A.V [Source:NCBI gene;Acc:101170644])

HSP 1 Score: 177.948 bits (450), Expect = 1.307e-58
Identity = 96/101 (95.05%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   17 QRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 117          
BLAST of Histone H2A vs. Ensembl Medaka
Match: h2az2a (histone H2A.V [Source:NCBI gene;Acc:101170644])

HSP 1 Score: 176.407 bits (446), Expect = 1.767e-55
Identity = 96/101 (95.05%), Postives = 100/101 (99.01%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
             RAGLQFPVGRIHRHLK+RTTSHGRVGATAAVY+AAILEYLTAEVLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:  210 QRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 310          
BLAST of Histone H2A vs. Ensembl Medaka
Match: H2AFZ (histone H2A.Z [Source:NCBI gene;Acc:101172846])

HSP 1 Score: 112.849 bits (281), Expect = 4.069e-33
Identity = 55/58 (94.83%), Postives = 58/58 (100.00%), Query Frame = 1
Query:  193 EVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKK 366
            +VLELAGNASKDLKVKRI+PRHLQLAIRGDEELD+LIKATIAGGGVIPHIHKSLIGKK
Sbjct:   42 QVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKK 99          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000074553.1 (SMESG000074553.1)

HSP 1 Score: 194.512 bits (493), Expect = 3.013e-65
Identity = 109/109 (100.00%), Postives = 109/109 (100.00%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKKPIIGQKPM 390
            HRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYAAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKKPIIGQKPM
Sbjct:   22 HRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYAAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKKPIIGQKPM 130          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000020395.1 (SMESG000020395.1)

HSP 1 Score: 168.318 bits (425), Expect = 7.354e-55
Identity = 90/102 (88.24%), Postives = 96/102 (94.12%), Query Frame = 1
Query:   64 HRAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKATIAGGGVIPHIHKSLIGKKP 369
             R+GLQFPVGRIHR LKS +++ GR+GATAAVY AAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELD LIKATIAGGGVIPHIHKSL+GKKP
Sbjct:   20 QRSGLQFPVGRIHRFLKSNSSNKGRIGATAAVYTAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDVLIKATIAGGGVIPHIHKSLVGKKP 121          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000006040.1 (SMESG000006040.1)

HSP 1 Score: 113.235 bits (282), Expect = 3.293e-33
Identity = 68/101 (67.33%), Postives = 78/101 (77.23%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLI-KATIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGRIHR L+    +  RVGA A VY AA+LEYL AEVLELAGNA++D K  RI PRHLQLAIR DEEL+ L+ K TIA GGV+P+I  SL+ KK
Sbjct:   21 RAGLQFPVGRIHRKLRKGNFAE-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQISLLPKK 120          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000006040.1 (SMESG000006040.1)

HSP 1 Score: 113.235 bits (282), Expect = 4.496e-33
Identity = 68/101 (67.33%), Postives = 78/101 (77.23%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLI-KATIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGRIHR L+    +  RVGA A VY AA+LEYL AEVLELAGNA++D K  RI PRHLQLAIR DEEL+ L+ K TIA GGV+P+I  SL+ KK
Sbjct:   21 RAGLQFPVGRIHRKLRKGNFAE-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQISLLPKK 120          
BLAST of Histone H2A vs. Planmine SMEST
Match: SMESG000067932.1 (SMESG000067932.1)

HSP 1 Score: 110.538 bits (275), Expect = 4.865e-32
Identity = 66/101 (65.35%), Postives = 77/101 (76.24%), Query Frame = 1
Query:   67 RAGLQFPVGRIHRHLKSRTTSHGRVGXXXXXXXXXILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTLIKA-TIAGGGVIPHIHKSLIGKK 366
            RAGLQFPVGRIHR L+    +  RVGA A VY AA+LEYL AEVLELAGNA++D K  RI PRHLQLAIR DEEL+ L+   TI+ GGVIP+I  +L+ KK
Sbjct:   22 RAGLQFPVGRIHRKLRKGNFAE-RVGAGAPVYLAAVLEYLAAEVLELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGGVTISQGGVIPNIQSALLPKK 121          
The following BLAST results are available for this feature:
BLAST of Histone H2A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H2AZ11.164e-5896.04H2A.Z variant histone 1 [Source:HGNC Symbol;Acc:HG... [more]
H2AZ22.272e-5895.05H2A.Z variant histone 2 [Source:HGNC Symbol;Acc:HG... [more]
H2AZ14.624e-5695.05H2A.Z variant histone 1 [Source:HGNC Symbol;Acc:HG... [more]
H2AZ22.617e-5495.79H2A.Z variant histone 2 [Source:HGNC Symbol;Acc:HG... [more]
H2AZ22.679e-4989.25H2A.Z variant histone 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Histone H2A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
htz-11.814e-5285.98Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q2... [more]
htz-11.814e-5285.98Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q2... [more]
htz-11.814e-5285.98Histone H2A.V [Source:UniProtKB/Swiss-Prot;Acc:Q2... [more]
his-352.120e-3163.37Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485][more]
his-352.120e-3163.37Histone H2A [Source:UniProtKB/TrEMBL;Acc:Q27485][more]
back to top
BLAST of Histone H2A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
His2Av2.034e-5991.67gene:FBgn0001197 transcript:FBtr0085062[more]
His2Av2.034e-5991.67gene:FBgn0001197 transcript:FBtr0334311[more]
His2A:CG338501.742e-3163.73gene:FBgn0053850 transcript:FBtr0091854[more]
His2A:CG338471.742e-3163.73gene:FBgn0053847 transcript:FBtr0091851[more]
His2A:CG338441.742e-3163.73gene:FBgn0053844 transcript:FBtr0091848[more]
back to top
BLAST of Histone H2A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
h2az2a1.445e-5895.05H2A.Z variant histone 2a [Source:NCBI gene;Acc:252... [more]
h2az2b2.030e-5895.05H2A.Z variant histone 2b [Source:ZFIN;Acc:ZDB-GENE... [more]
h2az2b2.098e-5895.05H2A.Z variant histone 2b [Source:ZFIN;Acc:ZDB-GENE... [more]
hist1h2a13.333e-3164.36histone cluster 1 H2A family member1 [Source:ZFIN;... [more]
si:ch1073-153i20.54.590e-3163.37si:ch1073-153i20.5 [Source:ZFIN;Acc:ZDB-GENE-16011... [more]
back to top
BLAST of Histone H2A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arrdc22.060e-5895.05arrestin domain containing 2 [Source:Xenbase;Acc:X... [more]
h2a.zl1.199e-5695.00H2A.Z variant histone 1 [Source:NCBI gene;Acc:4486... [more]
h2a.zl1.354e-5695.00H2A.Z variant histone 1 [Source:NCBI gene;Acc:4486... [more]
arrdc25.268e-3394.83arrestin domain containing 2 [Source:Xenbase;Acc:X... [more]
ENSXETT00000010097.15.362e-3260.71H2A.X variant histone [Source:NCBI gene;Acc:100487... [more]
back to top
BLAST of Histone H2A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H2az17.994e-5996.04H2A.Z variant histone 1 [Source:MGI Symbol;Acc:MGI... [more]
H2az21.560e-5895.05H2A.Z histone variant 2 [Source:MGI Symbol;Acc:MGI... [more]
H2az16.905e-3774.26H2A.Z variant histone 1 [Source:MGI Symbol;Acc:MGI... [more]
H2az23.336e-3394.83H2A.Z histone variant 2 [Source:MGI Symbol;Acc:MGI... [more]
H2ac12.015e-3264.36H2A clustered histone 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Histone H2A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P08985|H2AV_DROME2.039e-5891.67Histone H2A.v OS=Drosophila melanogaster OX=7227 G... [more]
sp|Q5ZMD6|H2AZ_CHICK5.294e-5896.04Histone H2A.Z OS=Gallus gallus OX=9031 GN=H2AFZ PE... [more]
sp|Q6YNC8|H2AZ_SHEEP5.592e-5896.04Histone H2A.Z OS=Ovis aries OX=9940 GN=H2AZ1 PE=2 ... [more]
sp|P0C0S7|H2AZ_RAT5.592e-5896.04Histone H2A.Z OS=Rattus norvegicus OX=10116 GN=H2a... [more]
sp|Q5RC42|H2AZ_PONAB5.592e-5896.04Histone H2A.Z OS=Pongo abelii OX=9601 GN=H2AZ1 PE=... [more]
back to top
BLAST of Histone H2A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1KGY29.376e-5893.46Histone H2A OS=Tetranychus urticae OX=32264 GN=107... [more]
A0A4S2KZP03.377e-5793.58Histone H2A OS=Opisthorchis felineus OX=147828 GN=... [more]
A0A564YZP53.458e-5796.12Histone H2A OS=Hymenolepis diminuta OX=6216 GN=WMS... [more]
A0A430Q5093.764e-5692.66Histone H2A OS=Schistosoma bovis OX=6184 GN=DC041_... [more]
Q5DE193.764e-5692.66Histone H2A OS=Schistosoma japonicum OX=6182 GN=EW... [more]
back to top
BLAST of Histone H2A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H2AZ15.814e-5996.04histone H2A.Z [Source:NCBI gene;Acc:103038819][more]
h2az2a1.225e-5895.05histone H2A.V [Source:NCBI gene;Acc:103037668][more]
h2az2b1.593e-5895.05histone H2A.V [Source:NCBI gene;Acc:103039302][more]
h2az2b1.662e-5895.05histone H2A.V [Source:NCBI gene;Acc:103039302][more]
h2az2a1.930e-5895.05histone H2A.V [Source:NCBI gene;Acc:103037668][more]
back to top
BLAST of Histone H2A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005338.12.124e-3162.38pep scaffold:Pmarinus_7.0:GL476820:708214:709027:-... [more]
ENSPMAT00000011253.12.804e-3163.37pep scaffold:Pmarinus_7.0:GL479154:926813:927238:-... [more]
ENSPMAT00000002388.13.076e-3162.38pep scaffold:Pmarinus_7.0:GL476925:193851:194294:1... [more]
ENSPMAT00000011166.17.399e-3162.38pep scaffold:Pmarinus_7.0:GL476820:1027708:1028088... [more]
ENSPMAT00000008684.11.680e-3062.38pep scaffold:Pmarinus_7.0:GL488596:2418:2939:-1 ge... [more]
back to top
BLAST of Histone H2A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
HTZ15.707e-4575.26Histone variant H2AZ; exchanged for histone H2A in... [more]
HTA21.638e-3159.41Histone H2A; core histone protein required for chr... [more]
HTA11.638e-3159.41Histone H2A; core histone protein required for chr... [more]
back to top
BLAST of Histone H2A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO462898.270e-5996.00Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7RQH8][more]
EDO260883.016e-3365.35Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7TCX1][more]
EDO277663.364e-3365.35Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SEB5][more]
EDO277643.364e-3365.35Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SEB5][more]
EDO379803.364e-3365.35Histone H2A [Source:UniProtKB/TrEMBL;Acc:A7SEB5][more]
back to top
BLAST of Histone H2A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H2AFZ8.205e-5996.04histone H2A.Z [Source:NCBI gene;Acc:101172846][more]
h2az2a1.217e-5895.05histone H2A.V [Source:NCBI gene;Acc:101170644][more]
h2az2a1.307e-5895.05histone H2A.V [Source:NCBI gene;Acc:101170644][more]
h2az2a1.767e-5595.05histone H2A.V [Source:NCBI gene;Acc:101170644][more]
H2AFZ4.069e-3394.83histone H2A.Z [Source:NCBI gene;Acc:101172846][more]
back to top
BLAST of Histone H2A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074553.13.013e-65100.00SMESG000074553.1[more]
SMESG000020395.17.354e-5588.24SMESG000020395.1[more]
SMESG000006040.13.293e-3367.33SMESG000006040.1[more]
SMESG000006040.14.496e-3367.33SMESG000006040.1[more]
SMESG000067932.14.865e-3265.35SMESG000067932.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017222 ID=SMED30017222|Name=Histone H2A|organism=Schmidtea mediterranea sexual|type=transcript|length=393bp
ATGGCAAAAGGAAAAGCCGGGAAAGATTCTGGAAAATCTAAATCTAAATC
AATATCCAGGTCGCACCGTGCTGGATTACAATTTCCAGTTGGTCGTATAC
ATAGGCATTTAAAAAGTCGAACTACAAGCCATGGAAGAGTTGGAGCGACA
GCTGCAGTTTATGCTGCAGCTATTTTAGAATATTTAACTGCTGAAGTTTT
AGAATTAGCAGGTAATGCCAGTAAAGATCTTAAAGTAAAACGTATTAGTC
CAAGACATTTACAACTGGCAATTCGAGGTGATGAGGAATTAGATACGCTT
ATAAAAGCAACTATAGCTGGTGGTGGAGTTATACCTCACATCCATAAATC
TCTTATTGGTAAAAAACCAATCATTGGTCAAAAACCTATGTAA
back to top

protein sequence of SMED30017222-orf-1

>SMED30017222-orf-1 ID=SMED30017222-orf-1|Name=SMED30017222-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=131bp
MAKGKAGKDSGKSKSKSISRSHRAGLQFPVGRIHRHLKSRTTSHGRVGAT
AAVYAAAILEYLTAEVLELAGNASKDLKVKRISPRHLQLAIRGDEELDTL
IKATIAGGGVIPHIHKSLIGKKPIIGQKPM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR002119Histone_H2A
IPR032454Histone_H2A_C
IPR007125Histone_H2A/H2B/H3
IPR009072Histone-fold
IPR032458Histone_H2A_CS
Vocabulary: cellular component
TermDefinition
GO:0000786nucleosome
GO:0005634nucleus
GO:0000790nuclear chromatin
GO:0005694chromosome
GO:0005700polytene chromosome
GO:0005701polytene chromosome chromocenter
GO:0005811lipid particle
GO:0035861site of double-strand break
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0046982protein heterodimerization activity
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
GO:0006342chromatin silencing
GO:0006974cellular response to DNA damage stimulus
GO:0007275multicellular organism development
GO:0019233sensory perception of pain
GO:0035019somatic stem cell population maintenance
GO:0036098male germ-line stem cell population maintenance
GO:0071168protein localization to chromatin
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002119Histone H2APRINTSPR00620HISTONEH2Acoord: 60..73
score: 84.63
coord: 101..119
score: 52.63
coord: 15..37
score: 70.93
coord: 45..60
score: 71.49
coord: 74..88
score: 64.51
IPR002119Histone H2ASMARTSM00414h2a4coord: 4..124
e-value: 5.8E-70
score: 248.4
IPR032454Histone H2A, C-terminal domainPFAMPF16211Histone_H2A_Ccoord: 94..121
e-value: 6.4E-12
score: 45.0
IPR007125Histone H2A/H2B/H3PFAMPF00125Histonecoord: 6..93
e-value: 8.3E-19
score: 68.3
IPR009072Histone-foldGENE3DG3DSA:1.10.20.10coord: 3..125
e-value: 1.7E-53
score: 181.8
IPR009072Histone-foldSUPERFAMILYSSF47113Histone-foldcoord: 3..101
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..25
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..15
NoneNo IPR availablePANTHERPTHR23430:SF47HISTONE H2A.Zcoord: 2..121
NoneNo IPR availablePANTHERPTHR23430HISTONE H2Acoord: 2..121
IPR032458Histone H2A conserved sitePROSITEPS00046HISTONE_H2Acoord: 23..29