DIX domain containing 1

Overview
NameDIX domain containing 1
Smed IDSMED30017209
Length (bp)2178
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DIX domain containing 1 (SMED30017209) t-SNE clustered cells

Violin plots show distribution of expression levels for DIX domain containing 1 (SMED30017209) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DIX domain containing 1 (SMED30017209) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DIX domain containing 1 (SMED30017209) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017209

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30017209h1SMcG0001936 SmedASXL_013631SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30017209h1SMcG0001936 dd_Smed_v4_3834_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017209h1SMcG0001936 dd_Smed_v4_3834_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017209h1SMcG0001936 dd_Smed_v4_3834_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30017209h1SMcG0001936 dd_Smed_v4_3834_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017209h1SMcG0001936 dd_Smed_v4_3834_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017209h1SMcG0001936 dd_Smed_v4_3834_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017209h1SMcG0001936 dd_Smed_v4_16275_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DIX domain containing 1 vs. Ensembl Human
Match: DIXDC1 (DIX domain containing 1 [Source:HGNC Symbol;Acc:HGNC:23695])

HSP 1 Score: 68.1662 bits (165), Expect = 2.618e-11
Identity = 44/161 (27.33%), Postives = 84/161 (52.17%), Query Frame = 2
Query: 1544 LDKFDEGIN-LMTLISISSRSQNEKANVAIINPCSKNSKVLSKFDKKISSSALSENFDQQEKLNNPFISDTKSFGNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            +D  ++GI+ LM  + +    + ++  V + +P    ++V S++          E++    KL +   S T S    T TK++YF  +S  P++  IP+ L  +TL D K    + + ++ N RY FK    + G+ K+EI  D D++P  +GKI+ ++++
Sbjct:  326 IDSLEQGISSLMERLHVMETQKKQERKVRVKSP---RTQVGSEY---------RESWPPNSKLPHSQSSPTVS---STCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDFK----AAIDREGNHRYHFKALDPEFGTVKEEIFHDDDAIPGWEGKIVAWVEE 467          
BLAST of DIX domain containing 1 vs. Ensembl Human
Match: DIXDC1 (DIX domain containing 1 [Source:HGNC Symbol;Acc:HGNC:23695])

HSP 1 Score: 68.1662 bits (165), Expect = 4.091e-11
Identity = 44/161 (27.33%), Postives = 84/161 (52.17%), Query Frame = 2
Query: 1544 LDKFDEGIN-LMTLISISSRSQNEKANVAIINPCSKNSKVLSKFDKKISSSALSENFDQQEKLNNPFISDTKSFGNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            +D  ++GI+ LM  + +    + ++  V + +P    ++V S++          E++    KL +   S T S    T TK++YF  +S  P++  IP+ L  +TL D K    + + ++ N RY FK    + G+ K+EI  D D++P  +GKI+ ++++
Sbjct:  537 IDSLEQGISSLMERLHVMETQKKQERKVRVKSP---RTQVGSEY---------RESWPPNSKLPHSQSSPTVS---STCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDFK----AAIDREGNHRYHFKALDPEFGTVKEEIFHDDDAIPGWEGKIVAWVEE 678          
BLAST of DIX domain containing 1 vs. Ensembl Human
Match: DVL2 (dishevelled segment polarity protein 2 [Source:HGNC Symbol;Acc:HGNC:3086])

HSP 1 Score: 58.9214 bits (141), Expect = 1.458e-8
Identity = 30/81 (37.04%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 1775 DTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFI 2017
            +TK+IY L +   PY+  IP P   ITL D K    SVL +    +YFFK+   D G  K+EI  D+  +P  +G+++ ++
Sbjct:   13 ETKVIYHLDEEETPYLVKIPVPAERITLGDFK----SVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWL 89          
BLAST of DIX domain containing 1 vs. Ensembl Human
Match: DVL2 (dishevelled segment polarity protein 2 [Source:HGNC Symbol;Acc:HGNC:3086])

HSP 1 Score: 57.7658 bits (138), Expect = 7.106e-8
Identity = 30/81 (37.04%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 1775 DTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFI 2017
            +TK+IY L +   PY+  IP P   ITL D K    SVL +    +YFFK+   D G  K+EI  D+  +P  +G+++ ++
Sbjct:   13 ETKVIYHLDEEETPYLVKIPVPAERITLGDFK----SVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWL 89          
BLAST of DIX domain containing 1 vs. Ensembl Human
Match: DVL2 (dishevelled segment polarity protein 2 [Source:HGNC Symbol;Acc:HGNC:3086])

HSP 1 Score: 57.7658 bits (138), Expect = 7.255e-8
Identity = 30/81 (37.04%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 1775 DTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFI 2017
            +TK+IY L +   PY+  IP P   ITL D K    SVL +    +YFFK+   D G  K+EI  D+  +P  +G+++ ++
Sbjct:   13 ETKVIYHLDEEETPYLVKIPVPAERITLGDFK----SVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWL 89          
BLAST of DIX domain containing 1 vs. Ensembl Fly
Match: dsh (gene:FBgn0000499 transcript:FBtr0073454)

HSP 1 Score: 57.3806 bits (137), Expect = 3.311e-8
Identity = 28/85 (32.94%), Postives = 48/85 (56.47%), Query Frame = 2
Query: 1763 GNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFI 2017
            G   +TK+IY +     PY+  IP P + +TL D K   N    ++ N++YFFK+  +D G  K+EI  D   +P  +G+++ ++
Sbjct:    6 GGGQETKVIYHIDDETTPYLVKIPIPSAQVTLRDFKLVLNK---QNNNYKYFFKSMDADFGVVKEEIADDSTILPCFNGRVVSWL 87          
BLAST of DIX domain containing 1 vs. Ensembl Zebrafish
Match: dixdc1b (DIX domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-041008-148])

HSP 1 Score: 63.929 bits (154), Expect = 4.075e-10
Identity = 27/82 (32.93%), Postives = 50/82 (60.98%), Query Frame = 2
Query: 1778 TKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            TK++YF  +S  P++  IP+ L  +TL D K    + + ++ N+RY FK    + G+ K+E+ +D   VP  +GKI+ ++++
Sbjct:  520 TKVLYFTDRSLTPFMINIPKRLGEVTLQDFK----TAVDREGNYRYHFKALDPEFGTVKEEVFQDDAVVPGWEGKIVAWVEE 597          
BLAST of DIX domain containing 1 vs. Ensembl Zebrafish
Match: dixdc1b (DIX domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-041008-148])

HSP 1 Score: 63.5438 bits (153), Expect = 6.071e-10
Identity = 27/82 (32.93%), Postives = 50/82 (60.98%), Query Frame = 2
Query: 1778 TKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            TK++YF  +S  P++  IP+ L  +TL D K    + + ++ N+RY FK    + G+ K+E+ +D   VP  +GKI+ ++++
Sbjct:  593 TKVLYFTDRSLTPFMINIPKRLGEVTLQDFK----TAVDREGNYRYHFKALDPEFGTVKEEVFQDDAVVPGWEGKIVAWVEE 670          
BLAST of DIX domain containing 1 vs. Ensembl Zebrafish
Match: dixdc1a (DIX domain containing 1a [Source:NCBI gene;Acc:360137])

HSP 1 Score: 60.4622 bits (145), Expect = 3.795e-9
Identity = 25/82 (30.49%), Postives = 50/82 (60.98%), Query Frame = 2
Query: 1778 TKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            TK++Y+  +S  P++  IP+ L  +TL D K    + + +  +FRY FK+   + G+ K+E+ +D   +P  +GKI+ ++++
Sbjct:  360 TKVLYYTDRSLTPFLVNIPKRLGDVTLQDFK----AAVDRHGSFRYHFKSLDPEFGTVKEEVFQDDAVIPGWEGKIVAWVEE 437          
BLAST of DIX domain containing 1 vs. Ensembl Zebrafish
Match: dvl3b (dishevelled segment polarity protein 3b [Source:ZFIN;Acc:ZDB-GENE-121101-2])

HSP 1 Score: 54.299 bits (129), Expect = 4.284e-7
Identity = 29/82 (35.37%), Postives = 50/82 (60.98%), Query Frame = 2
Query: 1772 TDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFI 2017
             +TK+IY L +   PY+  +P P   +TLAD K    +VL+K  N+++FFK+   D G  K+EI  D+  +P  +G+++ ++
Sbjct:    2 AETKIIYHLDEQETPYLIKLPIPAENVTLADFK----NVLNK-PNYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWL 78          
BLAST of DIX domain containing 1 vs. Ensembl Zebrafish
Match: dvl3a (dishevelled segment polarity protein 3a [Source:ZFIN;Acc:ZDB-GENE-010319-1])

HSP 1 Score: 53.9138 bits (128), Expect = 6.681e-7
Identity = 28/81 (34.57%), Postives = 48/81 (59.26%), Query Frame = 2
Query: 1775 DTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFI 2017
            +TK+IY L     PY+  +P P   +TL D+K   N++  K  N+++FFK+   D G  K+EI  D+  +P  +G++I ++
Sbjct:    3 ETKVIYHLDDQETPYLVKLPIPAERVTLLDLK---NAL--KKPNYKFFFKSMDDDFGVVKEEITDDNAKLPCYNGRVICWL 78          
BLAST of DIX domain containing 1 vs. Ensembl Xenopus
Match: ENSXETT00000001825.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV461245.1:5708:13762:1 gene:ENSXETG00000006251.1 transcript:ENSXETT00000001825.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 5.110e-11
Identity = 29/97 (29.90%), Postives = 54/97 (55.67%), Query Frame = 2
Query: 1736 PFISDTKSFGNK-TDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            P    T   GN  + TK++YF  +S  P++  IP+ L  +TL D +    + + ++ + RY FK    + G+ K+E+  D D +P  +GKI+ ++++
Sbjct:   95 PHSQSTPVMGNSNSSTKVLYFTDRSLTPFMVTIPKRLGEVTLRDFR----AAIGREGSHRYHFKALDPEFGTVKEEVFHDDDIIPGWEGKIVAWVEE 187          
BLAST of DIX domain containing 1 vs. Ensembl Xenopus
Match: dvl3 (dishevelled segment polarity protein 3 [Source:NCBI gene;Acc:100144702])

HSP 1 Score: 55.0694 bits (131), Expect = 3.497e-7
Identity = 28/81 (34.57%), Postives = 49/81 (60.49%), Query Frame = 2
Query: 1775 DTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFI 2017
            +TK+IY L +   PY+  +P P   +TL D K    +VL+K  N+++FFK+   D G  K+EI  D+  +P  +G+++ ++
Sbjct:    3 ETKVIYHLDEQETPYLVKLPVPAEKVTLGDFK----NVLNK-PNYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVCWL 78          
BLAST of DIX domain containing 1 vs. Ensembl Xenopus
Match: dvl3 (dishevelled segment polarity protein 3 [Source:NCBI gene;Acc:100144702])

HSP 1 Score: 55.0694 bits (131), Expect = 3.918e-7
Identity = 28/81 (34.57%), Postives = 49/81 (60.49%), Query Frame = 2
Query: 1775 DTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFI 2017
            +TK+IY L +   PY+  +P P   +TL D K    +VL+K  N+++FFK+   D G  K+EI  D+  +P  +G+++ ++
Sbjct:    3 ETKVIYHLDEQETPYLVKLPVPAEKVTLGDFK----NVLNK-PNYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVCWL 78          
BLAST of DIX domain containing 1 vs. Ensembl Xenopus
Match: dvl3 (dishevelled segment polarity protein 3 [Source:NCBI gene;Acc:100144702])

HSP 1 Score: 55.0694 bits (131), Expect = 3.942e-7
Identity = 28/81 (34.57%), Postives = 49/81 (60.49%), Query Frame = 2
Query: 1775 DTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFI 2017
            +TK+IY L +   PY+  +P P   +TL D K    +VL+K  N+++FFK+   D G  K+EI  D+  +P  +G+++ ++
Sbjct:    3 ETKVIYHLDEQETPYLVKLPVPAEKVTLGDFK----NVLNK-PNYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVCWL 78          
BLAST of DIX domain containing 1 vs. Ensembl Xenopus
Match: dvl3 (dishevelled segment polarity protein 3 [Source:NCBI gene;Acc:100144702])

HSP 1 Score: 55.0694 bits (131), Expect = 3.993e-7
Identity = 28/81 (34.57%), Postives = 49/81 (60.49%), Query Frame = 2
Query: 1775 DTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFI 2017
            +TK+IY L +   PY+  +P P   +TL D K    +VL+K  N+++FFK+   D G  K+EI  D+  +P  +G+++ ++
Sbjct:    3 ETKVIYHLDEQETPYLVKLPVPAEKVTLGDFK----NVLNK-PNYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVCWL 78          
BLAST of DIX domain containing 1 vs. Ensembl Mouse
Match: Dixdc1 (DIX domain containing 1 [Source:MGI Symbol;Acc:MGI:2679721])

HSP 1 Score: 67.0106 bits (162), Expect = 6.714e-11
Identity = 28/84 (33.33%), Postives = 51/84 (60.71%), Query Frame = 2
Query: 1772 TDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            T TK++YF  +S  P++  IP+ L  +TL D K    + + ++ N RY FK    + G+ K+E+  D D++P  +GKI+ ++++
Sbjct:  601 TCTKVLYFTDRSLTPFMVNIPKRLGEVTLKDFK----AAIDREGNHRYHFKALDPEFGTVKEEVFHDDDAIPGWEGKIVAWVEE 680          
BLAST of DIX domain containing 1 vs. Ensembl Mouse
Match: Dixdc1 (DIX domain containing 1 [Source:MGI Symbol;Acc:MGI:2679721])

HSP 1 Score: 66.6254 bits (161), Expect = 7.423e-11
Identity = 28/84 (33.33%), Postives = 51/84 (60.71%), Query Frame = 2
Query: 1772 TDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            T TK++YF  +S  P++  IP+ L  +TL D K    + + ++ N RY FK    + G+ K+E+  D D++P  +GKI+ ++++
Sbjct:  627 TCTKVLYFTDRSLTPFMVNIPKRLGEVTLKDFK----AAIDREGNHRYHFKALDPEFGTVKEEVFHDDDAIPGWEGKIVAWVEE 706          
BLAST of DIX domain containing 1 vs. Ensembl Mouse
Match: Dixdc1 (DIX domain containing 1 [Source:MGI Symbol;Acc:MGI:2679721])

HSP 1 Score: 66.6254 bits (161), Expect = 8.659e-11
Identity = 28/84 (33.33%), Postives = 51/84 (60.71%), Query Frame = 2
Query: 1772 TDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            T TK++YF  +S  P++  IP+ L  +TL D K    + + ++ N RY FK    + G+ K+E+  D D++P  +GKI+ ++++
Sbjct:  626 TCTKVLYFTDRSLTPFMVNIPKRLGEVTLKDFK----AAIDREGNHRYHFKALDPEFGTVKEEVFHDDDAIPGWEGKIVAWVEE 705          
BLAST of DIX domain containing 1 vs. Ensembl Mouse
Match: Dvl2 (dishevelled segment polarity protein 2 [Source:MGI Symbol;Acc:MGI:106613])

HSP 1 Score: 57.7658 bits (138), Expect = 4.417e-8
Identity = 30/81 (37.04%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 1775 DTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFI 2017
            +TK+IY L +   PY+  IP P   ITL D K    SVL +    +YFFK+   D G  K+EI  D+  +P  +G+++ ++
Sbjct:   13 ETKVIYHLDEEETPYLVKIPVPAERITLGDFK----SVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWL 89          
BLAST of DIX domain containing 1 vs. Ensembl Mouse
Match: Dvl2 (dishevelled segment polarity protein 2 [Source:MGI Symbol;Acc:MGI:106613])

HSP 1 Score: 57.7658 bits (138), Expect = 4.417e-8
Identity = 30/81 (37.04%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 1775 DTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFI 2017
            +TK+IY L +   PY+  IP P   ITL D K    SVL +    +YFFK+   D G  K+EI  D+  +P  +G+++ ++
Sbjct:   13 ETKVIYHLDEEETPYLVKIPVPAERITLGDFK----SVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWL 89          
BLAST of DIX domain containing 1 vs. UniProt/SwissProt
Match: sp|Q155Q3|DIXC1_HUMAN (Dixin OS=Homo sapiens OX=9606 GN=DIXDC1 PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 1.965e-10
Identity = 44/161 (27.33%), Postives = 84/161 (52.17%), Query Frame = 2
Query: 1544 LDKFDEGIN-LMTLISISSRSQNEKANVAIINPCSKNSKVLSKFDKKISSSALSENFDQQEKLNNPFISDTKSFGNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            +D  ++GI+ LM  + +    + ++  V + +P    ++V S++          E++    KL +   S T S    T TK++YF  +S  P++  IP+ L  +TL D K    + + ++ N RY FK    + G+ K+EI  D D++P  +GKI+ ++++
Sbjct:  537 IDSLEQGISSLMERLHVMETQKKQERKVRVKSP---RTQVGSEY---------RESWPPNSKLPHSQSSPTVS---STCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDFK----AAIDREGNHRYHFKALDPEFGTVKEEIFHDDDAIPGWEGKIVAWVEE 678          
BLAST of DIX domain containing 1 vs. UniProt/SwissProt
Match: sp|Q80Y83|DIXC1_MOUSE (Dixin OS=Mus musculus OX=10090 GN=Dixdc1 PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 5.193e-10
Identity = 28/84 (33.33%), Postives = 51/84 (60.71%), Query Frame = 2
Query: 1772 TDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            T TK++YF  +S  P++  IP+ L  +TL D K    + + ++ N RY FK    + G+ K+E+  D D++P  +GKI+ ++++
Sbjct:  627 TCTKVLYFTDRSLTPFMVNIPKRLGEVTLKDFK----AAIDREGNHRYHFKALDPEFGTVKEEVFHDDDAIPGWEGKIVAWVEE 706          
BLAST of DIX domain containing 1 vs. UniProt/SwissProt
Match: sp|Q2VUH7|DIXC1_RAT (Dixin OS=Rattus norvegicus OX=10116 GN=Dixdc1 PE=2 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.151e-8
Identity = 27/81 (33.33%), Postives = 48/81 (59.26%), Query Frame = 2
Query: 1772 TDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVF 2014
            T TK++YF  +S  P++  IP+ L  +TL D K    + + ++ + RY FK    + G+ K+E+  D D++P  +GKI+ +
Sbjct:  574 TCTKVLYFTDRSLTPFMVNIPKRLGEVTLKDFK----AAIDREGSHRYHFKALDPEFGTVKEEVFHDDDAIPGWEGKIVAW 650          
BLAST of DIX domain containing 1 vs. UniProt/SwissProt
Match: sp|Q804T6|DIX1A_DANRE (Dixin-A OS=Danio rerio OX=7955 GN=dixdc1a PE=1 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 2.915e-8
Identity = 25/82 (30.49%), Postives = 50/82 (60.98%), Query Frame = 2
Query: 1778 TKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            TK++Y+  +S  P++  IP+ L  +TL D K    + + +  +FRY FK+   + G+ K+E+ +D   +P  +GKI+ ++++
Sbjct:  360 TKVLYYTDRSLTPFLVNIPKRLGDVTLQDFK----AAVDRHGSFRYHFKSLDPEFGTVKEEVFQDDAVIPGWEGKIVAWVEE 437          
BLAST of DIX domain containing 1 vs. UniProt/SwissProt
Match: sp|Q60838|DVL2_MOUSE (Segment polarity protein dishevelled homolog DVL-2 OS=Mus musculus OX=10090 GN=Dvl2 PE=1 SV=2)

HSP 1 Score: 57.7658 bits (138), Expect = 3.090e-7
Identity = 30/81 (37.04%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 1775 DTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFI 2017
            +TK+IY L +   PY+  IP P   ITL D K    SVL +    +YFFK+   D G  K+EI  D+  +P  +G+++ ++
Sbjct:   13 ETKVIYHLDEEETPYLVKIPVPAERITLGDFK----SVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWL 89          
BLAST of DIX domain containing 1 vs. TrEMBL
Match: A0A3B5MUH5 (DIX domain containing 1 OS=Xiphophorus couchianus OX=32473 GN=DIXDC1 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.934e-11
Identity = 33/87 (37.93%), Postives = 54/87 (62.07%), Query Frame = 2
Query: 1763 GNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            G+ + TK++YF GKSP P +  IP+ L  +TL DVKE     + ++ N+RY FK    + G+ K+E+  D   VP  +GKI+ ++++
Sbjct:   98 GSPSSTKILYFTGKSPTPSMINIPKRLGEVTLKDVKE----AVDREGNYRYHFKALDPEFGTVKEEVFLDGAIVPGWEGKIVAWLEE 180          
BLAST of DIX domain containing 1 vs. TrEMBL
Match: A0A0S7FKW8 (DIX1A (Fragment) OS=Poeciliopsis prolifica OX=188132 GN=DIX1A PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.516e-11
Identity = 32/87 (36.78%), Postives = 55/87 (63.22%), Query Frame = 2
Query: 1763 GNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            G+ + TK++YF+GKSP P +  IP+ L  +TL DVK    + + ++ N+RY FK    + G+ K+E+  D   VP  +GKI+ ++++
Sbjct:   71 GSPSSTKILYFIGKSPTPSMINIPKRLGEVTLKDVK----AAVDQEGNYRYHFKALDPEFGTVKEEVFLDGAIVPGWEGKIVAWLEE 153          
BLAST of DIX domain containing 1 vs. TrEMBL
Match: A0A3B4YI27 (DIX domain containing 1 OS=Seriola lalandi dorsalis OX=1841481 GN=DIXDC1 PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 7.489e-11
Identity = 32/87 (36.78%), Postives = 53/87 (60.92%), Query Frame = 2
Query: 1763 GNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            G+   TK++YF GKSP P +  IP+ L  +TL DVK    + + ++ N+RY FK    + G+ K+E+  D   VP  +GKI+ ++++
Sbjct:  227 GSSASTKILYFTGKSPTPSMINIPKRLGEVTLKDVK----AAVDREGNYRYHFKALDPEFGTVKEEVFLDGAIVPGWEGKIVAWVEE 309          
BLAST of DIX domain containing 1 vs. TrEMBL
Match: A0A3B5QSP0 (DIX domain containing 1 OS=Xiphophorus maculatus OX=8083 GN=DIXDC1 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 8.737e-11
Identity = 33/87 (37.93%), Postives = 54/87 (62.07%), Query Frame = 2
Query: 1763 GNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            G+ + TK++YF GKSP P +  IP+ L  +TL DVKE     + ++ N+RY FK    + G+ K+E+  D   VP  +GKI+ ++++
Sbjct:  341 GSPSSTKILYFTGKSPTPSMINIPKRLGEVTLKDVKE----AVDREGNYRYHFKALDPEFGTVKEEVFLDGAIVPGWEGKIVAWLEE 423          
BLAST of DIX domain containing 1 vs. TrEMBL
Match: A0A3B5MUH1 (DIX domain containing 1 OS=Xiphophorus couchianus OX=32473 GN=DIXDC1 PE=4 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 9.499e-11
Identity = 35/95 (36.84%), Postives = 57/95 (60.00%), Query Frame = 2
Query: 1739 FISDTKSFGNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            F  +  S G+ + TK++YF GKSP P +  IP+ L  +TL DVKE     + ++ N+RY FK    + G+ K+E+  D   VP  +GKI+ ++++
Sbjct:  216 FRKNLYSNGSPSSTKILYFTGKSPTPSMINIPKRLGEVTLKDVKE----AVDREGNYRYHFKALDPEFGTVKEEVFLDGAIVPGWEGKIVAWLEE 306          
BLAST of DIX domain containing 1 vs. Ensembl Cavefish
Match: dixdc1a (DIX domain containing 1a [Source:NCBI gene;Acc:360137])

HSP 1 Score: 64.6994 bits (156), Expect = 1.454e-10
Identity = 30/98 (30.61%), Postives = 57/98 (58.16%), Query Frame = 2
Query: 1730 NNPFISDTKSFGNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            ++P +S + S      TK++YF  +S  P++  IP+ L  +TL D K    + + +  NFRY FK+   + G+ K+E+ +D   +P  +GKI+ ++++
Sbjct:  309 SSPVLSTSAS------TKVLYFTDRSLTPFLINIPKRLGEVTLQDFK----AAVDRHGNFRYHFKSLDPEFGTVKEEVFQDEAIIPGWEGKIVAWVEE 396          
BLAST of DIX domain containing 1 vs. Ensembl Cavefish
Match: dixdc1b (dixin-A [Source:NCBI gene;Acc:103030903])

HSP 1 Score: 62.3882 bits (150), Expect = 1.066e-9
Identity = 27/82 (32.93%), Postives = 49/82 (59.76%), Query Frame = 2
Query: 1778 TKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            TK++YF  +S  P++  IP+ L  +TL D K      + ++ +FRY FK    + G+ K+E+ +D   VP  +GKI+ ++++
Sbjct:  389 TKVLYFTDRSLTPFMINIPKRLGEVTLRDFK----VAIDREGSFRYHFKALDPEFGTVKEEVFQDDAVVPGWEGKIVAWVEE 466          
BLAST of DIX domain containing 1 vs. Ensembl Cavefish
Match: dixdc1b (dixin-A [Source:NCBI gene;Acc:103030903])

HSP 1 Score: 62.003 bits (149), Expect = 1.776e-9
Identity = 27/82 (32.93%), Postives = 49/82 (59.76%), Query Frame = 2
Query: 1778 TKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            TK++YF  +S  P++  IP+ L  +TL D K      + ++ +FRY FK    + G+ K+E+ +D   VP  +GKI+ ++++
Sbjct:  611 TKVLYFTDRSLTPFMINIPKRLGEVTLRDFK----VAIDREGSFRYHFKALDPEFGTVKEEVFQDDAVVPGWEGKIVAWVEE 688          
BLAST of DIX domain containing 1 vs. Ensembl Cavefish
Match: dixdc1b (dixin-A [Source:NCBI gene;Acc:103030903])

HSP 1 Score: 62.003 bits (149), Expect = 1.777e-9
Identity = 27/82 (32.93%), Postives = 49/82 (59.76%), Query Frame = 2
Query: 1778 TKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            TK++YF  +S  P++  IP+ L  +TL D K      + ++ +FRY FK    + G+ K+E+ +D   VP  +GKI+ ++++
Sbjct:  601 TKVLYFTDRSLTPFMINIPKRLGEVTLRDFK----VAIDREGSFRYHFKALDPEFGTVKEEVFQDDAVVPGWEGKIVAWVEE 678          
BLAST of DIX domain containing 1 vs. Ensembl Cavefish
Match: dixdc1b (dixin-A [Source:NCBI gene;Acc:103030903])

HSP 1 Score: 61.2326 bits (147), Expect = 2.558e-9
Identity = 27/82 (32.93%), Postives = 49/82 (59.76%), Query Frame = 2
Query: 1778 TKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            TK++YF  +S  P++  IP+ L  +TL D K      + ++ +FRY FK    + G+ K+E+ +D   VP  +GKI+ ++++
Sbjct:  556 TKVLYFTDRSLTPFMINIPKRLGEVTLRDFK----VAIDREGSFRYHFKALDPEFGTVKEEVFQDDAVVPGWEGKIVAWVEE 633          
BLAST of DIX domain containing 1 vs. Ensembl Medaka
Match: DIXDC1 (dixin-like [Source:NCBI gene;Acc:101159969])

HSP 1 Score: 72.0182 bits (175), Expect = 1.024e-12
Identity = 34/95 (35.79%), Postives = 57/95 (60.00%), Query Frame = 2
Query: 1751 TKSF----GNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            TK+F    G+ + TK++YF GKS  P +  IP+ L  +TL DVK    + + ++ N+RY FK    + G+ K+E+  D   VP  +GKI+ ++++
Sbjct:  398 TKTFKSHNGSTSSTKILYFTGKSMTPSMINIPKRLGEVTLRDVK----AAVDREGNYRYHFKALDPEFGTVKEEVFNDAALVPGWEGKIVAWLEE 488          
BLAST of DIX domain containing 1 vs. Ensembl Medaka
Match: DIXDC1 (dixin-like [Source:NCBI gene;Acc:101159969])

HSP 1 Score: 71.633 bits (174), Expect = 1.648e-12
Identity = 34/95 (35.79%), Postives = 57/95 (60.00%), Query Frame = 2
Query: 1751 TKSF----GNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            TK+F    G+ + TK++YF GKS  P +  IP+ L  +TL DVK    + + ++ N+RY FK    + G+ K+E+  D   VP  +GKI+ ++++
Sbjct:  554 TKTFKSHNGSTSSTKILYFTGKSMTPSMINIPKRLGEVTLRDVK----AAVDREGNYRYHFKALDPEFGTVKEEVFNDAALVPGWEGKIVAWLEE 644          
BLAST of DIX domain containing 1 vs. Ensembl Medaka
Match: dixdc1a (dixin-A-like [Source:NCBI gene;Acc:101166321])

HSP 1 Score: 65.855 bits (159), Expect = 6.652e-11
Identity = 28/82 (34.15%), Postives = 49/82 (59.76%), Query Frame = 2
Query: 1778 TKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            TK++YF  +S  P++  IP+ L  +TL D K    + + +  NFRY FK    + G+ K+E+ +D   VP  +GKI+ ++++
Sbjct:  330 TKVLYFTDRSLTPFLINIPKRLGEVTLRDFK----AAVDRQGNFRYHFKALDPEFGTVKEEVFQDSAVVPGWEGKIVAWVEE 407          
BLAST of DIX domain containing 1 vs. Ensembl Medaka
Match: dixdc1a (dixin-A-like [Source:NCBI gene;Acc:101166321])

HSP 1 Score: 65.0846 bits (157), Expect = 1.170e-10
Identity = 28/82 (34.15%), Postives = 49/82 (59.76%), Query Frame = 2
Query: 1778 TKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            TK++YF  +S  P++  IP+ L  +TL D K    + + +  NFRY FK    + G+ K+E+ +D   VP  +GKI+ ++++
Sbjct:  375 TKVLYFTDRSLTPFLINIPKRLGEVTLRDFK----AAVDRQGNFRYHFKALDPEFGTVKEEVFQDSAVVPGWEGKIVAWVEE 452          
BLAST of DIX domain containing 1 vs. Ensembl Medaka
Match: dixdc1a (dixin-A-like [Source:NCBI gene;Acc:101166321])

HSP 1 Score: 65.0846 bits (157), Expect = 1.170e-10
Identity = 28/82 (34.15%), Postives = 49/82 (59.76%), Query Frame = 2
Query: 1778 TKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            TK++YF  +S  P++  IP+ L  +TL D K    + + +  NFRY FK    + G+ K+E+ +D   VP  +GKI+ ++++
Sbjct:  375 TKVLYFTDRSLTPFLINIPKRLGEVTLRDFK----AAVDRQGNFRYHFKALDPEFGTVKEEVFQDSAVVPGWEGKIVAWVEE 452          
BLAST of DIX domain containing 1 vs. Planmine SMEST
Match: SMESG000033276.1 (SMESG000033276.1)

HSP 1 Score: 778.474 bits (2009), Expect = 0.000e+0
Identity = 405/406 (99.75%), Postives = 405/406 (99.75%), Query Frame = 2
Query:  806 MGPSQSHQHELASSDDGLSLFVPCHESTSSLASTDQRYDDVLTRNYQKHKNFKACRKLSKLRKSFSECFRSKFQQLKEETDIEQKPDSELISAQRPNSEMSNTVATESRDRRLSDSNDGVCQSFPKDIQEIHHQLNELKRLLSKPEIVNESIDKRDESCQTNKIDMIADHLLRQRDILIANQQDQLNNLRINLENXXXXXXXXXXXXXXXXXQQSRRSTDIDSKVLDQFILLLKSVRSERKLDNCDLDKFDEGINLMTLISISSRSQNEKANVAIINPCSKNSKVLSKFDKKISSSALSENFDQQEKLNNPFISDTKSFGNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            MGPSQSHQHELASSDDGLSLFVPCHESTSSLASTDQRYDDVLTRNYQKHKNFKACRKLSKLRKSFSECFRSKFQQLKEETDIEQKPDSELISAQRPNSEMSNTVATESRDRRLSDSNDGVCQSFPKDIQEIHHQLNELKRLLSKPEIVNESIDKRDESCQTNKIDMIADHLLRQRDILIANQQDQLNNLRINLENKVKVSESLLKELSILKSQQSRRSTDIDSKVLDQFILLLKSVRSERKLDNCDLDKFDEGINLMT ISISSRSQNEKANVAIINPCSKNSKVLSKFDKKISSSALSENFDQQEKLNNPFISDTKSFGNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ
Sbjct:    1 MGPSQSHQHELASSDDGLSLFVPCHESTSSLASTDQRYDDVLTRNYQKHKNFKACRKLSKLRKSFSECFRSKFQQLKEETDIEQKPDSELISAQRPNSEMSNTVATESRDRRLSDSNDGVCQSFPKDIQEIHHQLNELKRLLSKPEIVNESIDKRDESCQTNKIDMIADHLLRQRDILIANQQDQLNNLRINLENKVKVSESLLKELSILKSQQSRRSTDIDSKVLDQFILLLKSVRSERKLDNCDLDKFDEGINLMTSISISSRSQNEKANVAIINPCSKNSKVLSKFDKKISSSALSENFDQQEKLNNPFISDTKSFGNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 406          
BLAST of DIX domain containing 1 vs. Planmine SMEST
Match: SMESG000003898.1 (SMESG000003898.1)

HSP 1 Score: 770 bits (1987), Expect = 0.000e+0
Identity = 400/406 (98.52%), Postives = 403/406 (99.26%), Query Frame = 2
Query:  806 MGPSQSHQHELASSDDGLSLFVPCHESTSSLASTDQRYDDVLTRNYQKHKNFKACRKLSKLRKSFSECFRSKFQQLKEETDIEQKPDSELISAQRPNSEMSNTVATESRDRRLSDSNDGVCQSFPKDIQEIHHQLNELKRLLSKPEIVNESIDKRDESCQTNKIDMIADHLLRQRDILIANQQDQLNNLRINLENXXXXXXXXXXXXXXXXXQQSRRSTDIDSKVLDQFILLLKSVRSERKLDNCDLDKFDEGINLMTLISISSRSQNEKANVAIINPCSKNSKVLSKFDKKISSSALSENFDQQEKLNNPFISDTKSFGNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            MGPSQSHQHELASSDDGLSLFVPCHESTSSLASTDQRYDDVLTRNYQKHKNFKACRKLSKLRKSFSECFRSKFQQLKEETDIEQKPDSELISAQRPNSEMSNTVATESRDRRLSDSNDGVCQSFPKDIQEIHHQLNELKRLLSKPEIVNESIDKRDESCQTNK DMI+DHLLRQRDILIANQQDQLNNLRINLENKVKVSESLLKELSILKSQQSRRSTDIDSKVLDQFILLL+SVRSERKLDNCDLDKFDEGINLMT ISISSRSQNEKANVAIINPCSKNSKVLSKFDKKISSSALSENFDQQEKLNNPFISD+KSFGNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFI Q
Sbjct:    1 MGPSQSHQHELASSDDGLSLFVPCHESTSSLASTDQRYDDVLTRNYQKHKNFKACRKLSKLRKSFSECFRSKFQQLKEETDIEQKPDSELISAQRPNSEMSNTVATESRDRRLSDSNDGVCQSFPKDIQEIHHQLNELKRLLSKPEIVNESIDKRDESCQTNKTDMISDHLLRQRDILIANQQDQLNNLRINLENKVKVSESLLKELSILKSQQSRRSTDIDSKVLDQFILLLQSVRSERKLDNCDLDKFDEGINLMTSISISSRSQNEKANVAIINPCSKNSKVLSKFDKKISSSALSENFDQQEKLNNPFISDSKSFGNKTDTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFILQ 406          
BLAST of DIX domain containing 1 vs. Planmine SMEST
Match: SMESG000025925.1 (SMESG000025925.1)

HSP 1 Score: 55.0694 bits (131), Expect = 2.001e-7
Identity = 31/80 (38.75%), Postives = 46/80 (57.50%), Query Frame = 2
Query: 1790 YFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFK-TCSS-DMGSSKQEIIRDHDSVPIVDGKIIVFIQQ 2023
            Y++G  P+PY + IP     ITL   K    S+++K   FRYFFK  C   D G   +EIIRD   +P+ +GK++  I++
Sbjct:  702 YYIGNDPVPYRTQIPDS-QYITLGQFK----SLVAKKGPFRYFFKRYCDEFDCGVVHEEIIRDDAILPLWEGKVVAKIEK 776          
BLAST of DIX domain containing 1 vs. Planmine SMEST
Match: SMESG000049876.1 (SMESG000049876.1)

HSP 1 Score: 51.6026 bits (122), Expect = 2.433e-6
Identity = 25/81 (30.86%), Postives = 43/81 (53.09%), Query Frame = 2
Query: 1775 DTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFI 2017
            +T++IY++     PY+     P   ITL D K   N       N+++FFK+   D G  K+EI  D   +P V+G+++ ++
Sbjct:    3 ETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNR-----PNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWL 78          
BLAST of DIX domain containing 1 vs. Planmine SMEST
Match: SMESG000049876.1 (SMESG000049876.1)

HSP 1 Score: 51.2174 bits (121), Expect = 2.676e-6
Identity = 25/81 (30.86%), Postives = 43/81 (53.09%), Query Frame = 2
Query: 1775 DTKLIYFLGKSPIPYVSLIPQPLSAITLADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKIIVFI 2017
            +T++IY++     PY+     P   ITL D K   N       N+++FFK+   D G  K+EI  D   +P V+G+++ ++
Sbjct:    3 ETRIIYYVDDEETPYLIKFHSPPEQITLGDFKNALNR-----PNYKFFFKSLDDDFGVVKEEITDDDAKLPYVNGRVVSWL 78          
The following BLAST results are available for this feature:
BLAST of DIX domain containing 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DIXDC12.618e-1127.33DIX domain containing 1 [Source:HGNC Symbol;Acc:HG... [more]
DIXDC14.091e-1127.33DIX domain containing 1 [Source:HGNC Symbol;Acc:HG... [more]
DVL21.458e-837.04dishevelled segment polarity protein 2 [Source:HGN... [more]
DVL27.106e-837.04dishevelled segment polarity protein 2 [Source:HGN... [more]
DVL27.255e-837.04dishevelled segment polarity protein 2 [Source:HGN... [more]
back to top
BLAST of DIX domain containing 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DIX domain containing 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dsh3.311e-832.94gene:FBgn0000499 transcript:FBtr0073454[more]
back to top
BLAST of DIX domain containing 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dixdc1b4.075e-1032.93DIX domain containing 1b [Source:ZFIN;Acc:ZDB-GENE... [more]
dixdc1b6.071e-1032.93DIX domain containing 1b [Source:ZFIN;Acc:ZDB-GENE... [more]
dixdc1a3.795e-930.49DIX domain containing 1a [Source:NCBI gene;Acc:360... [more]
dvl3b4.284e-735.37dishevelled segment polarity protein 3b [Source:ZF... [more]
dvl3a6.681e-734.57dishevelled segment polarity protein 3a [Source:ZF... [more]
back to top
BLAST of DIX domain containing 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000001825.15.110e-1129.90pep primary_assembly:Xenopus_tropicalis_v9.1:KV461... [more]
dvl33.497e-734.57dishevelled segment polarity protein 3 [Source:NCB... [more]
dvl33.918e-734.57dishevelled segment polarity protein 3 [Source:NCB... [more]
dvl33.942e-734.57dishevelled segment polarity protein 3 [Source:NCB... [more]
dvl33.993e-734.57dishevelled segment polarity protein 3 [Source:NCB... [more]
back to top
BLAST of DIX domain containing 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dixdc16.714e-1133.33DIX domain containing 1 [Source:MGI Symbol;Acc:MGI... [more]
Dixdc17.423e-1133.33DIX domain containing 1 [Source:MGI Symbol;Acc:MGI... [more]
Dixdc18.659e-1133.33DIX domain containing 1 [Source:MGI Symbol;Acc:MGI... [more]
Dvl24.417e-837.04dishevelled segment polarity protein 2 [Source:MGI... [more]
Dvl24.417e-837.04dishevelled segment polarity protein 2 [Source:MGI... [more]
back to top
BLAST of DIX domain containing 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q155Q3|DIXC1_HUMAN1.965e-1027.33Dixin OS=Homo sapiens OX=9606 GN=DIXDC1 PE=1 SV=2[more]
sp|Q80Y83|DIXC1_MOUSE5.193e-1033.33Dixin OS=Mus musculus OX=10090 GN=Dixdc1 PE=1 SV=1[more]
sp|Q2VUH7|DIXC1_RAT1.151e-833.33Dixin OS=Rattus norvegicus OX=10116 GN=Dixdc1 PE=2... [more]
sp|Q804T6|DIX1A_DANRE2.915e-830.49Dixin-A OS=Danio rerio OX=7955 GN=dixdc1a PE=1 SV=... [more]
sp|Q60838|DVL2_MOUSE3.090e-737.04Segment polarity protein dishevelled homolog DVL-2... [more]
back to top
BLAST of DIX domain containing 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B5MUH51.934e-1137.93DIX domain containing 1 OS=Xiphophorus couchianus ... [more]
A0A0S7FKW84.516e-1136.78DIX1A (Fragment) OS=Poeciliopsis prolifica OX=1881... [more]
A0A3B4YI277.489e-1136.78DIX domain containing 1 OS=Seriola lalandi dorsali... [more]
A0A3B5QSP08.737e-1137.93DIX domain containing 1 OS=Xiphophorus maculatus O... [more]
A0A3B5MUH19.499e-1136.84DIX domain containing 1 OS=Xiphophorus couchianus ... [more]
back to top
BLAST of DIX domain containing 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dixdc1a1.454e-1030.61DIX domain containing 1a [Source:NCBI gene;Acc:360... [more]
dixdc1b1.066e-932.93dixin-A [Source:NCBI gene;Acc:103030903][more]
dixdc1b1.776e-932.93dixin-A [Source:NCBI gene;Acc:103030903][more]
dixdc1b1.777e-932.93dixin-A [Source:NCBI gene;Acc:103030903][more]
dixdc1b2.558e-932.93dixin-A [Source:NCBI gene;Acc:103030903][more]
back to top
BLAST of DIX domain containing 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DIX domain containing 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DIX domain containing 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DIX domain containing 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DIXDC11.024e-1235.79dixin-like [Source:NCBI gene;Acc:101159969][more]
DIXDC11.648e-1235.79dixin-like [Source:NCBI gene;Acc:101159969][more]
dixdc1a6.652e-1134.15dixin-A-like [Source:NCBI gene;Acc:101166321][more]
dixdc1a1.170e-1034.15dixin-A-like [Source:NCBI gene;Acc:101166321][more]
dixdc1a1.170e-1034.15dixin-A-like [Source:NCBI gene;Acc:101166321][more]
back to top
BLAST of DIX domain containing 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033276.10.000e+099.75SMESG000033276.1[more]
SMESG000003898.10.000e+098.52SMESG000003898.1[more]
SMESG000025925.12.001e-738.75SMESG000025925.1[more]
SMESG000049876.12.433e-630.86SMESG000049876.1[more]
SMESG000049876.12.676e-630.86SMESG000049876.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017209 ID=SMED30017209|Name=DIX domain containing 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2178bp
CAACAATTCTTAATATTCCAAGAAAAATTGAAATCATTAACATTGCTTAA
GAAGGATTCACTATCCAAAATAAGCGCGTTCATTGGACCGTCGTACTGCG
CAAATAATTCAATTCACGCCATGAATCAACGCAATTCAGAACTCTGGATT
AGTCTATATTACATCAGTGCTTCATTATGATTTTTAACCGTGAAATGAAT
GATTTCCGTATATCTTTATATTACGGTCCCTTTGTAGTCACCTTGGCGTT
ATGATGGACAACTTTGGCCGAATTCCACAAATTCTTTATTCTGGTCAGGA
AATTATAATTTTTAACTTTTAACAGTCTTAGGACAGGTTGCTTGTCCATA
AAAATGGCAGTCTTAACTAATTCCATTGGGCAAGATGAATCCACATTACA
TGAAATATCCACCTTATGCGCTTCCATGTCATTCCTTTAAATATTATAAT
TACATTATGCAAAATAGTCAGTGATTCATATACAACTAGCAAAATTTTGC
CACATGCAGCAATATGGACAAATTAGAAATTAGATAATTCTATGATTTCC
ATAGTTGTAACTGATCGATTAGAATACTTTATTCGTTGTCGTTAAATTAG
GGCAGGAATTTAACACGGCTTCGCACACACACACACTCAGACTAACATTC
AACAAGATCCAATTGTGTGAATCGAGCCGGTGTGTCTCGCTACATTCTTA
CATGATTGGTGTGTTCTGCTGGCATTCTATCCTATATCTGTATAAGTTAT
AAACCGATCAGAAATTATTGATTTTTTTCCATTTGTACTCAAATCCGGTA
AAAGAATGGGTCCAAGCCAATCACATCAGCATGAATTAGCATCTTCTGAT
GACGGTTTAAGCTTGTTTGTTCCCTGTCACGAATCGACGTCTTCCCTAGC
TAGTACTGATCAGAGATATGATGATGTTCTCACACGAAATTATCAAAAGC
ACAAGAATTTTAAAGCATGTCGCAAACTTTCAAAACTACGAAAATCGTTT
TCTGAATGTTTTCGTTCTAAATTTCAACAATTAAAAGAAGAAACTGATAT
TGAACAAAAACCAGATAGCGAATTGATTTCTGCACAACGTCCAAATTCAG
AGATGTCAAATACTGTTGCTACTGAAAGTAGGGATCGTCGACTAAGCGAT
TCAAACGATGGAGTTTGCCAGAGCTTTCCCAAAGACATTCAAGAAATCCA
TCATCAATTGAATGAACTGAAAAGACTACTGTCCAAACCAGAGATTGTCA
ATGAATCTATTGACAAAAGAGATGAGTCTTGTCAAACGAATAAAATAGAC
ATGATTGCGGATCATCTACTGCGTCAGAGGGATATTCTAATAGCAAATCA
ACAAGATCAATTAAACAACCTCAGAATAAATCTAGAAAATAAAGTTAAAG
TTTCAGAATCTCTTTTAAAAGAACTATCAATTTTGAAATCACAACAATCT
CGACGTTCCACTGATATTGACTCGAAAGTGCTCGATCAATTTATACTATT
ATTAAAATCAGTCCGATCAGAACGCAAACTTGATAATTGTGATTTGGATA
AATTTGATGAAGGAATTAATCTGATGACATTAATATCAATCTCATCTCGA
TCTCAAAATGAAAAAGCAAATGTTGCCATAATAAATCCATGTTCAAAAAA
TAGCAAAGTGCTTTCAAAATTTGATAAAAAAATTTCATCTTCAGCTCTAT
CAGAAAATTTTGATCAACAAGAAAAGCTAAATAATCCTTTCATTTCTGAT
ACAAAATCTTTTGGAAACAAAACTGATACCAAATTAATTTATTTTCTAGG
CAAATCCCCTATTCCATATGTATCATTGATTCCGCAACCATTGAGCGCAA
TTACACTAGCTGATGTCAAAGAATACACGAATTCAGTATTATCCAAGGAC
ACTAATTTTCGATATTTCTTTAAAACGTGTAGTTCCGACATGGGCTCCTC
AAAACAAGAAATCATTCGTGATCATGATTCAGTCCCGATAGTCGATGGTA
AGATCATAGTATTTATTCAACAATGATTACTGGTCAGGTGACATTATTAT
GATGGAGGCGAATTATAATTTTTATGTGATGGAACATTTAATTTTTTTAA
TTTTATTGCTTTGGTTACTTTCAATATCGATTTAATTTTGTACCATGTTT
CATAAATGATTTTTAATTTTCTAAAAAA
back to top

protein sequence of SMED30017209-orf-1

>SMED30017209-orf-1 ID=SMED30017209-orf-1|Name=SMED30017209-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=407bp
MGPSQSHQHELASSDDGLSLFVPCHESTSSLASTDQRYDDVLTRNYQKHK
NFKACRKLSKLRKSFSECFRSKFQQLKEETDIEQKPDSELISAQRPNSEM
SNTVATESRDRRLSDSNDGVCQSFPKDIQEIHHQLNELKRLLSKPEIVNE
SIDKRDESCQTNKIDMIADHLLRQRDILIANQQDQLNNLRINLENKVKVS
ESLLKELSILKSQQSRRSTDIDSKVLDQFILLLKSVRSERKLDNCDLDKF
DEGINLMTLISISSRSQNEKANVAIINPCSKNSKVLSKFDKKISSSALSE
NFDQQEKLNNPFISDTKSFGNKTDTKLIYFLGKSPIPYVSLIPQPLSAIT
LADVKEYTNSVLSKDTNFRYFFKTCSSDMGSSKQEIIRDHDSVPIVDGKI
IVFIQQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR038207DIX_dom_sf
IPR015506Dsh/Dvl-rel
IPR001158DIX
IPR029071Ubiquitin-like_domsf
Vocabulary: biological process
TermDefinition
GO:0016055Wnt signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 179..199
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 78..117
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 90..104
NoneNo IPR availablePANTHERPTHR10878:SF22DIXINcoord: 150..401
IPR001158DIX domainSMARTSM00021dax_2coord: 322..405
e-value: 7.8E-11
score: 52.0
IPR001158DIX domainPFAMPF00778DIXcoord: 324..405
e-value: 1.4E-18
score: 66.5
IPR001158DIX domainPROSITEPS50841DIXcoord: 322..406
score: 18.123
IPR038207DIX domain superfamilyGENE3DG3DSA:3.10.20.380coord: 318..406
e-value: 1.3E-20
score: 74.9
IPR015506Dishevelled-related proteinPANTHERPTHR10878SEGMENT POLARITY PROTEIN DISHEVELLEDcoord: 150..401
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 325..405