Band 4.1 protein 2

Overview
NameBand 4.1 protein 2
Smed IDSMED30017206
Length (bp)3508
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Band 4.1 protein 2 (SMED30017206) t-SNE clustered cells

Violin plots show distribution of expression levels for Band 4.1 protein 2 (SMED30017206) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Band 4.1 protein 2 (SMED30017206) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Band 4.1 protein 2 (SMED30017206) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017206

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30017206SMESG000062476.1 Contig46148newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017206SMESG000062476.1 Contig46148uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017206SMESG000062476.1 Contig38871newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017206SMESG000062476.1 Contig38871uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30017206SMESG000062476.1 dd_Smed_v4_2032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30017206SMESG000062476.1 dd_Smed_v4_2032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017206SMESG000062476.1 dd_Smed_v4_2032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30017206SMESG000062476.1 dd_Smed_v4_2032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017206SMESG000062476.1 dd_Smed_v4_2032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017206SMESG000062476.1 dd_Smed_v4_2032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017206SMESG000062476.1 dd_Smed_v4_2032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017206SMESG000062476.1 dd_Smed_v4_2032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30017206SMESG000062476.1 dd_Smed_v4_2032_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017206SMESG000068171.1 SMESG000065040.1 SMESG000062476.1 SMESG000058080.1 Contig19599newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017206SMESG000068171.1 SMESG000065040.1 SMESG000062476.1 SMESG000058080.1 Contig19599uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30017206SMESG000062476.1 dd_Smed_v6_2032_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30017206SMESG000062476.1 dd_Smed_v6_2032_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30017206SMESG000062476.1 dd_Smed_v6_2032_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017206SMESG000062476.1 dd_Smed_v6_2032_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30017206SMESG000062476.1 dd_Smed_v6_2032_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30017206SMESG000062476.1 dd_Smed_v6_2032_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017206SMESG000062476.1 dd_Smed_v4_2032_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017206SMESG000062476.1 SMED_11431_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30017206SMESG000062476.1 SMED_11431_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Band 4.1 protein 2 vs. Ensembl Human
Match: EPB41L2 (erythrocyte membrane protein band 4.1 like 2 [Source:HGNC Symbol;Acc:HGNC:3379])

HSP 1 Score: 259.61 bits (662), Expect = 1.975e-73
Identity = 150/388 (38.66%), Postives = 228/388 (58.76%), Query Frame = 1
Query:  232 GNFSKSQSHTTLSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQRKEKETPLSPSGI 1395
            G  +K ++    +N    +K + +   V K +  +Q C VT+LDGTE + D++  + GQ LFD++C+ L+L E+ YFG+ + +   +   WL   K+I  QL    W+F F VKFYPP      ED+T+YF CLQ+RQDI  G LP SF    LLG++ +Q+E GD+DP  H  I+ L +  FAP   QT EL  +++ELHK     +P +AD  FL NA +L MYGVD+H  K+ +  ++ +GV  +G+LIY+ R+RI R +WPKI+K++YK  +F++ +R  E+ + E  + FK  +H+ AKRLWK CVEHHTF+R+V  E P K + +   G+ K+ Y                 + ++ RP P   R  ++R  +    +P G+
Sbjct:  187 GGAAKRETKEVQTNE---LKAEKASQKVTKKTKTVQ-CKVTLLDGTEYSCDLEKHAKGQVLFDKVCEHLNLLEKDYFGLLFQESPEQ-KNWLDPAKEIKRQLRNLPWLFTFNVKFYPPDPSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPEEHGSID-LSEFQFAP--TQTKELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVEHHTFYRLVSPEQPPKAKFL-TLGS-KFRYSGRTQAQTRQA------STLIDRPAPHFERTSSKRVSRSLDGAPIGV 558          
BLAST of Band 4.1 protein 2 vs. Ensembl Human
Match: EPB41L2 (erythrocyte membrane protein band 4.1 like 2 [Source:HGNC Symbol;Acc:HGNC:3379])

HSP 1 Score: 259.61 bits (662), Expect = 1.975e-73
Identity = 150/388 (38.66%), Postives = 228/388 (58.76%), Query Frame = 1
Query:  232 GNFSKSQSHTTLSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQRKEKETPLSPSGI 1395
            G  +K ++    +N    +K + +   V K +  +Q C VT+LDGTE + D++  + GQ LFD++C+ L+L E+ YFG+ + +   +   WL   K+I  QL    W+F F VKFYPP      ED+T+YF CLQ+RQDI  G LP SF    LLG++ +Q+E GD+DP  H  I+ L +  FAP   QT EL  +++ELHK     +P +AD  FL NA +L MYGVD+H  K+ +  ++ +GV  +G+LIY+ R+RI R +WPKI+K++YK  +F++ +R  E+ + E  + FK  +H+ AKRLWK CVEHHTF+R+V  E P K + +   G+ K+ Y                 + ++ RP P   R  ++R  +    +P G+
Sbjct:  187 GGAAKRETKEVQTNE---LKAEKASQKVTKKTKTVQ-CKVTLLDGTEYSCDLEKHAKGQVLFDKVCEHLNLLEKDYFGLLFQESPEQ-KNWLDPAKEIKRQLRNLPWLFTFNVKFYPPDPSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPEEHGSID-LSEFQFAP--TQTKELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVEHHTFYRLVSPEQPPKAKFL-TLGS-KFRYSGRTQAQTRQA------STLIDRPAPHFERTSSKRVSRSLDGAPIGV 558          
BLAST of Band 4.1 protein 2 vs. Ensembl Human
Match: EPB41L2 (erythrocyte membrane protein band 4.1 like 2 [Source:HGNC Symbol;Acc:HGNC:3379])

HSP 1 Score: 259.996 bits (663), Expect = 2.665e-73
Identity = 150/388 (38.66%), Postives = 228/388 (58.76%), Query Frame = 1
Query:  232 GNFSKSQSHTTLSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQRKEKETPLSPSGI 1395
            G  +K ++    +N    +K + +   V K +  +Q C VT+LDGTE + D++  + GQ LFD++C+ L+L E+ YFG+ + +   +   WL   K+I  QL    W+F F VKFYPP      ED+T+YF CLQ+RQDI  G LP SF    LLG++ +Q+E GD+DP  H  I+ L +  FAP   QT EL  +++ELHK     +P +AD  FL NA +L MYGVD+H  K+ +  ++ +GV  +G+LIY+ R+RI R +WPKI+K++YK  +F++ +R  E+ + E  + FK  +H+ AKRLWK CVEHHTF+R+V  E P K + +   G+ K+ Y                 + ++ RP P   R  ++R  +    +P G+
Sbjct:  187 GGAAKRETKEVQTNE---LKAEKASQKVTKKTKTVQ-CKVTLLDGTEYSCDLEKHAKGQVLFDKVCEHLNLLEKDYFGLLFQESPEQ-KNWLDPAKEIKRQLRNLPWLFTFNVKFYPPDPSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPEEHGSID-LSEFQFAP--TQTKELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVEHHTFYRLVSPEQPPKAKFL-TLGS-KFRYSGRTQAQTRQA------STLIDRPAPHFERTSSKRVSRSLDGAPIGV 558          
BLAST of Band 4.1 protein 2 vs. Ensembl Human
Match: EPB41L2 (erythrocyte membrane protein band 4.1 like 2 [Source:HGNC Symbol;Acc:HGNC:3379])

HSP 1 Score: 260.381 bits (664), Expect = 4.899e-73
Identity = 150/388 (38.66%), Postives = 228/388 (58.76%), Query Frame = 1
Query:  232 GNFSKSQSHTTLSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQRKEKETPLSPSGI 1395
            G  +K ++    +N    +K + +   V K +  +Q C VT+LDGTE + D++  + GQ LFD++C+ L+L E+ YFG+ + +   +   WL   K+I  QL    W+F F VKFYPP      ED+T+YF CLQ+RQDI  G LP SF    LLG++ +Q+E GD+DP  H  I+ L +  FAP   QT EL  +++ELHK     +P +AD  FL NA +L MYGVD+H  K+ +  ++ +GV  +G+LIY+ R+RI R +WPKI+K++YK  +F++ +R  E+ + E  + FK  +H+ AKRLWK CVEHHTF+R+V  E P K + +   G+ K+ Y                 + ++ RP P   R  ++R  +    +P G+
Sbjct:  187 GGAAKRETKEVQTNE---LKAEKASQKVTKKTKTVQ-CKVTLLDGTEYSCDLEKHAKGQVLFDKVCEHLNLLEKDYFGLLFQESPEQ-KNWLDPAKEIKRQLRNLPWLFTFNVKFYPPDPSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPEEHGSID-LSEFQFAP--TQTKELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVEHHTFYRLVSPEQPPKAKFL-TLGS-KFRYSGRTQAQTRQA------STLIDRPAPHFERTSSKRVSRSLDGAPIGV 558          
BLAST of Band 4.1 protein 2 vs. Ensembl Human
Match: EPB41L2 (erythrocyte membrane protein band 4.1 like 2 [Source:HGNC Symbol;Acc:HGNC:3379])

HSP 1 Score: 260.381 bits (664), Expect = 4.899e-73
Identity = 150/388 (38.66%), Postives = 228/388 (58.76%), Query Frame = 1
Query:  232 GNFSKSQSHTTLSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQRKEKETPLSPSGI 1395
            G  +K ++    +N    +K + +   V K +  +Q C VT+LDGTE + D++  + GQ LFD++C+ L+L E+ YFG+ + +   +   WL   K+I  QL    W+F F VKFYPP      ED+T+YF CLQ+RQDI  G LP SF    LLG++ +Q+E GD+DP  H  I+ L +  FAP   QT EL  +++ELHK     +P +AD  FL NA +L MYGVD+H  K+ +  ++ +GV  +G+LIY+ R+RI R +WPKI+K++YK  +F++ +R  E+ + E  + FK  +H+ AKRLWK CVEHHTF+R+V  E P K + +   G+ K+ Y                 + ++ RP P   R  ++R  +    +P G+
Sbjct:  187 GGAAKRETKEVQTNE---LKAEKASQKVTKKTKTVQ-CKVTLLDGTEYSCDLEKHAKGQVLFDKVCEHLNLLEKDYFGLLFQESPEQ-KNWLDPAKEIKRQLRNLPWLFTFNVKFYPPDPSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPEEHGSID-LSEFQFAP--TQTKELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVEHHTFYRLVSPEQPPKAKFL-TLGS-KFRYSGRTQAQTRQA------STLIDRPAPHFERTSSKRVSRSLDGAPIGV 558          
BLAST of Band 4.1 protein 2 vs. Ensembl Celegans
Match: frm-1 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EFD6])

HSP 1 Score: 178.718 bits (452), Expect = 1.343e-46
Identity = 104/323 (32.20%), Postives = 169/323 (52.32%), Query Frame = 1
Query:  292 RKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIE-YLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHK-VKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLY 1254
            +K+   S      KMQ   V + DG ++ ++++  S G+ LF ++   L + ER+YF + + DK      WL  DK I+ Q+    W F F+VKFYP       +D  +Y+  LQ+R+D++ G LP + +   LLG+   Q E GD         E ++      P A    E   +I +LH+++  QTP EA+  FL +   L +YG+ + K + ++  + + VG+  +GI IY+   +    SW  I+K+ Y+   F + L+A  + K E+ L FK  +H  AKR WK  VEHHTFFR++  E+         FG++++ Y
Sbjct:   10 QKHPTTSQQPRDSKMQLAKVLLPDGVQKEFEVNKNSEGEALFRQVTRDLSIEEREYFSLCFYDKDEGTRHWLYNDKNIAKQIKGLPWEFSFEVKFYPTTPTTIVDDHARYYVFLQLRRDLLTGRLPATADTHSLLGSFVAQIEFGDAPAEMTDAYEQFIVASKLVPSAQANPETYKKIVDLHREMRGQTPSEAENQFLDHCKHLALYGIHLFKAISDKDKKPVDVGIGAAGINIYQDEQKTHSFSWQNIIKIGYRRTYFSIKLKAGTVEKNEKTLYFKLPNHVAAKRTWKCAVEHHTFFRLIQPEDKTHKSFF-NFGSQRFRY 331          
BLAST of Band 4.1 protein 2 vs. Ensembl Celegans
Match: frm-1 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EFD6])

HSP 1 Score: 178.718 bits (452), Expect = 1.343e-46
Identity = 104/323 (32.20%), Postives = 169/323 (52.32%), Query Frame = 1
Query:  292 RKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIE-YLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHK-VKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLY 1254
            +K+   S      KMQ   V + DG ++ ++++  S G+ LF ++   L + ER+YF + + DK      WL  DK I+ Q+    W F F+VKFYP       +D  +Y+  LQ+R+D++ G LP + +   LLG+   Q E GD         E ++      P A    E   +I +LH+++  QTP EA+  FL +   L +YG+ + K + ++  + + VG+  +GI IY+   +    SW  I+K+ Y+   F + L+A  + K E+ L FK  +H  AKR WK  VEHHTFFR++  E+         FG++++ Y
Sbjct:   10 QKHPTTSQQPRDSKMQLAKVLLPDGVQKEFEVNKNSEGEALFRQVTRDLSIEEREYFSLCFYDKDEGTRHWLYNDKNIAKQIKGLPWEFSFEVKFYPTTPTTIVDDHARYYVFLQLRRDLLTGRLPATADTHSLLGSFVAQIEFGDAPAEMTDAYEQFIVASKLVPSAQANPETYKKIVDLHREMRGQTPSEAENQFLDHCKHLALYGIHLFKAISDKDKKPVDVGIGAAGINIYQDEQKTHSFSWQNIIKIGYRRTYFSIKLKAGTVEKNEKTLYFKLPNHVAAKRTWKCAVEHHTFFRLIQPEDKTHKSFF-NFGSQRFRY 331          
BLAST of Band 4.1 protein 2 vs. Ensembl Celegans
Match: frm-1 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EFD6])

HSP 1 Score: 173.326 bits (438), Expect = 3.167e-43
Identity = 104/323 (32.20%), Postives = 169/323 (52.32%), Query Frame = 1
Query:  292 RKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIE-YLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHK-VKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLY 1254
            +K+   S      KMQ   V + DG ++ ++++  S G+ LF ++   L + ER+YF + + DK      WL  DK I+ Q+    W F F+VKFYP       +D  +Y+  LQ+R+D++ G LP + +   LLG+   Q E GD         E ++      P A    E   +I +LH+++  QTP EA+  FL +   L +YG+ + K + ++  + + VG+  +GI IY+   +    SW  I+K+ Y+   F + L+A  + K E+ L FK  +H  AKR WK  VEHHTFFR++  E+         FG++++ Y
Sbjct:   10 QKHPTTSQQPRDSKMQLAKVLLPDGVQKEFEVNKNSEGEALFRQVTRDLSIEEREYFSLCFYDKDEGTRHWLYNDKNIAKQIKGLPWEFSFEVKFYPTTPTTIVDDHARYYVFLQLRRDLLTGRLPATADTHSLLGSFVAQIEFGDAPAEMTDAYEQFIVASKLVPSAQANPETYKKIVDLHREMRGQTPSEAENQFLDHCKHLALYGIHLFKAISDKDKKPVDVGIGAAGINIYQDEQKTHSFSWQNIIKIGYRRTYFSIKLKAGTVEKNEKTLYFKLPNHVAAKRTWKCAVEHHTFFRLIQPEDKTHKSFF-NFGSQRFRY 331          
BLAST of Band 4.1 protein 2 vs. Ensembl Celegans
Match: frm-1 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EFD6])

HSP 1 Score: 173.326 bits (438), Expect = 3.168e-43
Identity = 104/323 (32.20%), Postives = 169/323 (52.32%), Query Frame = 1
Query:  292 RKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIE-YLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHK-VKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLY 1254
            +K+   S      KMQ   V + DG ++ ++++  S G+ LF ++   L + ER+YF + + DK      WL  DK I+ Q+    W F F+VKFYP       +D  +Y+  LQ+R+D++ G LP + +   LLG+   Q E GD         E ++      P A    E   +I +LH+++  QTP EA+  FL +   L +YG+ + K + ++  + + VG+  +GI IY+   +    SW  I+K+ Y+   F + L+A  + K E+ L FK  +H  AKR WK  VEHHTFFR++  E+         FG++++ Y
Sbjct:   21 QKHPTTSQQPRDSKMQLAKVLLPDGVQKEFEVNKNSEGEALFRQVTRDLSIEEREYFSLCFYDKDEGTRHWLYNDKNIAKQIKGLPWEFSFEVKFYPTTPTTIVDDHARYYVFLQLRRDLLTGRLPATADTHSLLGSFVAQIEFGDAPAEMTDAYEQFIVASKLVPSAQANPETYKKIVDLHREMRGQTPSEAENQFLDHCKHLALYGIHLFKAISDKDKKPVDVGIGAAGINIYQDEQKTHSFSWQNIIKIGYRRTYFSIKLKAGTVEKNEKTLYFKLPNHVAAKRTWKCAVEHHTFFRLIQPEDKTHKSFF-NFGSQRFRY 342          
BLAST of Band 4.1 protein 2 vs. Ensembl Celegans
Match: frm-1 (FERM domain (Protein4.1-ezrin-radixin-moesin) family [Source:UniProtKB/TrEMBL;Acc:G5EFD6])

HSP 1 Score: 173.326 bits (438), Expect = 3.183e-43
Identity = 104/323 (32.20%), Postives = 169/323 (52.32%), Query Frame = 1
Query:  292 RKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIE-YLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHK-VKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLY 1254
            +K+   S      KMQ   V + DG ++ ++++  S G+ LF ++   L + ER+YF + + DK      WL  DK I+ Q+    W F F+VKFYP       +D  +Y+  LQ+R+D++ G LP + +   LLG+   Q E GD         E ++      P A    E   +I +LH+++  QTP EA+  FL +   L +YG+ + K + ++  + + VG+  +GI IY+   +    SW  I+K+ Y+   F + L+A  + K E+ L FK  +H  AKR WK  VEHHTFFR++  E+         FG++++ Y
Sbjct:   10 QKHPTTSQQPRDSKMQLAKVLLPDGVQKEFEVNKNSEGEALFRQVTRDLSIEEREYFSLCFYDKDEGTRHWLYNDKNIAKQIKGLPWEFSFEVKFYPTTPTTIVDDHARYYVFLQLRRDLLTGRLPATADTHSLLGSFVAQIEFGDAPAEMTDAYEQFIVASKLVPSAQANPETYKKIVDLHREMRGQTPSEAENQFLDHCKHLALYGIHLFKAISDKDKKPVDVGIGAAGINIYQDEQKTHSFSWQNIIKIGYRRTYFSIKLKAGTVEKNEKTLYFKLPNHVAAKRTWKCAVEHHTFFRLIQPEDKTHKSFF-NFGSQRFRY 331          
BLAST of Band 4.1 protein 2 vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0301279)

HSP 1 Score: 238.424 bits (607), Expect = 4.119e-66
Identity = 128/304 (42.11%), Postives = 185/304 (60.86%), Query Frame = 1
Query:  328 GKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGT 1239
            GK     VT+LDG+  +  ID  + G+ + + IC  L+L E+ YFG+ Y   T     WL ++K +S     + W   F VKFYPP     +ED+T+Y  CLQVR DI+EG LP +F    LLG++ VQSE GD+D        YL+    AP   QT EL  ++ +LHK    Q+P EA+  +L NA KL MYGVD+H  K+ +  ++ +GV  SG+L+YR ++RI R +WPKI+K++YK   F++ +R  E  + E  + FK  +H+ AK+LWK+CVEHHTFFR++  E   K ++ P FG+
Sbjct:   29 GKPALARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTYETPT-DPRTWLDLEKPVSKFFRTDTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRAYLKDFKIAPN--QTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFGS 329          
BLAST of Band 4.1 protein 2 vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0086506)

HSP 1 Score: 238.424 bits (607), Expect = 4.510e-66
Identity = 128/304 (42.11%), Postives = 185/304 (60.86%), Query Frame = 1
Query:  328 GKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGT 1239
            GK     VT+LDG+  +  ID  + G+ + + IC  L+L E+ YFG+ Y   T     WL ++K +S     + W   F VKFYPP     +ED+T+Y  CLQVR DI+EG LP +F    LLG++ VQSE GD+D        YL+    AP   QT EL  ++ +LHK    Q+P EA+  +L NA KL MYGVD+H  K+ +  ++ +GV  SG+L+YR ++RI R +WPKI+K++YK   F++ +R  E  + E  + FK  +H+ AK+LWK+CVEHHTFFR++  E   K ++ P FG+
Sbjct:   29 GKPALARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTYETPT-DPRTWLDLEKPVSKFFRTDTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRAYLKDFKIAPN--QTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFGS 329          
BLAST of Band 4.1 protein 2 vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0086508)

HSP 1 Score: 238.424 bits (607), Expect = 5.262e-65
Identity = 128/304 (42.11%), Postives = 185/304 (60.86%), Query Frame = 1
Query:  328 GKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGT 1239
            GK     VT+LDG+  +  ID  + G+ + + IC  L+L E+ YFG+ Y   T     WL ++K +S     + W   F VKFYPP     +ED+T+Y  CLQVR DI+EG LP +F    LLG++ VQSE GD+D        YL+    AP   QT EL  ++ +LHK    Q+P EA+  +L NA KL MYGVD+H  K+ +  ++ +GV  SG+L+YR ++RI R +WPKI+K++YK   F++ +R  E  + E  + FK  +H+ AK+LWK+CVEHHTFFR++  E   K ++ P FG+
Sbjct:   29 GKPALARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTYETPT-DPRTWLDLEKPVSKFFRTDTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRAYLKDFKIAPN--QTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFGS 329          
BLAST of Band 4.1 protein 2 vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0086509)

HSP 1 Score: 240.35 bits (612), Expect = 3.612e-64
Identity = 128/304 (42.11%), Postives = 185/304 (60.86%), Query Frame = 1
Query:  328 GKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGT 1239
            GK     VT+LDG+  +  ID  + G+ + + IC  L+L E+ YFG+ Y   T     WL ++K +S     + W   F VKFYPP     +ED+T+Y  CLQVR DI+EG LP +F    LLG++ VQSE GD+D        YL+    AP   QT EL  ++ +LHK    Q+P EA+  +L NA KL MYGVD+H  K+ +  ++ +GV  SG+L+YR ++RI R +WPKI+K++YK   F++ +R  E  + E  + FK  +H+ AK+LWK+CVEHHTFFR++  E   K ++ P FG+
Sbjct:   29 GKPALARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTYETPT-DPRTWLDLEKPVSKFFRTDTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRAYLKDFKIAPN--QTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFGS 329          
BLAST of Band 4.1 protein 2 vs. Ensembl Fly
Match: cora (gene:FBgn0010434 transcript:FBtr0340469)

HSP 1 Score: 240.35 bits (612), Expect = 3.639e-64
Identity = 128/304 (42.11%), Postives = 185/304 (60.86%), Query Frame = 1
Query:  328 GKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGT 1239
            GK     VT+LDG+  +  ID  + G+ + + IC  L+L E+ YFG+ Y   T     WL ++K +S     + W   F VKFYPP     +ED+T+Y  CLQVR DI+EG LP +F    LLG++ VQSE GD+D        YL+    AP   QT EL  ++ +LHK    Q+P EA+  +L NA KL MYGVD+H  K+ +  ++ +GV  SG+L+YR ++RI R +WPKI+K++YK   F++ +R  E  + E  + FK  +H+ AK+LWK+CVEHHTFFR++  E   K ++ P FG+
Sbjct:   29 GKPALARVTLLDGSLLDVSIDRKAIGRDVINSICAGLNLIEKDYFGLTYETPT-DPRTWLDLEKPVSKFFRTDTWPLTFAVKFYPPEPSQLKEDITRYHLCLQVRNDILEGRLPCTFVTHALLGSYLVQSEMGDYDAEEMPTRAYLKDFKIAPN--QTAELEDKVMDLHKTHKGQSPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGLLVYRDKLRINRFAWPKILKISYKRHHFYIKIRPGEFEQYESTIGFKLANHRAAKKLWKSCVEHHTFFRLMTPEPVSKSKMFPVFGS 329          
BLAST of Band 4.1 protein 2 vs. Ensembl Zebrafish
Match: EPB41L2 (si:ch73-18b11.1 [Source:ZFIN;Acc:ZDB-GENE-070912-332])

HSP 1 Score: 253.447 bits (646), Expect = 1.090e-70
Identity = 140/343 (40.82%), Postives = 208/343 (60.64%), Query Frame = 1
Query:  331 KMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            KM  C+VT+LDG++ + +++  + GQ+LF  +C+ L+L E+ YF + + D   +   WL   K+I  Q+  +QW F F VKFYPP      EDLT+Y  CLQ+RQDI  G LP SF    LLG++A+Q+E GD DP+ H+ ++Y+    FAP   QT EL  ++ ELHK     TP +AD  FL NA KL MYGVD+H  K+ +  ++ +GV  +G+LIY+ R+RI R +WPKI+K++YK  +F++ +R  E  + E  + FK  +H+ AKR+WK CVEHHTFFR+   E P K + +   G+ K+ Y                 + ++ RP P  +R  ++R
Sbjct:    2 KMVVCHVTLLDGSQFSCEVEKRAKGQYLFFEVCEHLNLVEKDYFALSFKDNAEQ-RCWLDPTKEIKRQIRNSQWQFAFSVKFYPPDPSQLTEDLTRYLLCLQLRQDIASGRLPCSFVTHALLGSYALQAELGDQDPDEHR-LDYISDFQFAPN--QTKELEEKVMELHKSHRGMTPAQADAQFLENAKKLSMYGVDLHHAKDSEGVDIMLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKIRPGEAEQFESTVGFKLPNHRAAKRVWKVCVEHHTFFRLTSPEQPTKSKFL-TLGS-KFRYSGRTQAQARQA------STLIDRPTPYFQRTSSKR 332          
BLAST of Band 4.1 protein 2 vs. Ensembl Zebrafish
Match: si:dkey-178k16.1 (si:dkey-178k16.1 [Source:ZFIN;Acc:ZDB-GENE-090312-61])

HSP 1 Score: 243.047 bits (619), Expect = 2.771e-69
Identity = 157/426 (36.85%), Postives = 234/426 (54.93%), Query Frame = 1
Query:  331 KMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR----------------KEKETPLSPSGIAPCANNDEIFS--LEESLDNAIERPELLEEYWQMSIDDSTPEMGIDPLGLDVAGN 1554
            K  P  V +LDG+     ++    GQ L D +C+ L+L E+ YFG+ ++D   +   WL   K+I  Q+    W F F VKFYPP      ED+T+Y+ CLQ+R+DI+ G LP SF    LLG++A+Q+E GD+DP  H G +Y+ +  FAP   QT EL  R+ ELH+     +P EA+  FL NA KL MYGVD+H  K+ +  ++ +GV  SG+LIYR R+RI R +WPKI+K++YK  +F++ +R  E  + E  + FK  +H+ +KRLWK C+EHHTFFR+V  E P K  L+ G    K+ Y                 + ++ RP P+  R  ++R                 ++ +  + S   P    DE+    LE SLD  +++    EE  ++   DSTP   ++ L  + AG+
Sbjct:   52 KTVPVKVLLLDGSAYESGVEKLCKGQVLLDMVCEHLNLLEKDYFGLSFSDTECQ-KNWLDPSKEIKKQIRVGPWHFSFAVKFYPPDPSQLIEDITRYYLCLQLREDILSGRLPCSFVTHALLGSYAIQAELGDYDPEEH-GPDYINEFRFAPN--QTRELEERVMELHRTYRGMSPAEAEINFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCASGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRASKRLWKVCIEHHTFFRLVSPEPPPKGFLVIG---SKFRYSGRTQAQSRQA------SALIDRPAPQFERSISRRYLLSRSIDGESALGDTMDRLSQHTSSEPVPSLPRDELDQDYLEPSLDQDLDQDHEQEEEQRLE-SDSTPSKTVE-LKREEAGS 462          
BLAST of Band 4.1 protein 2 vs. Ensembl Zebrafish
Match: epb41l3b (erythrocyte membrane protein band 4.1-like 3b [Source:ZFIN;Acc:ZDB-GENE-021106-1])

HSP 1 Score: 246.128 bits (627), Expect = 1.178e-67
Identity = 143/353 (40.51%), Postives = 203/353 (57.51%), Query Frame = 1
Query:  343 CNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVK--------------NQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            C +T+LDGT+    ++  +  Q LFD++CD L+L E++YFGI Y+D T     WL   K+I  Q+  + W F F VKFYPP      ED+T+YF CLQ+R D+V G LP SF+   +LG++ +QSE GD D +  Q    L  + FAP   Q+ EL  ++ ELH+     TP EAD  FL NA KL MYGVD+H+ K              + +  E+ +GV  SG+L+YR ++RI R +WPKI+K++YK  +F++ +R  E+ + E  + FK  +HK AKRLWK CVEHHTFFR+V  E P K  L  G    K+ Y           ++Q      + R  P  +R  ++R
Sbjct:   68 CKITLLDGTDYTCTVEKRARSQVLFDKVCDHLNLLEKEYFGITYSD-TESKKNWLDASKEIKKQISTSPWSFAFNVKFYPPDPAQLSEDITRYFLCLQLRDDVVSGRLPCSFSTHAVLGSYTLQSELGDCD-SELQNSSALSDLRFAPN--QSKELQDKVLELHRAYRGMTPAEADMLFLENAKKLSMYGVDLHRAKLLTRLEWLAVLQEEDSEGVEIMLGVCSSGLLVYRDKLRINRFAWPKILKISYKRNNFYIKVRPGELEQFESTIGFKLPNHKAAKRLWKVCVEHHTFFRLVSPEAPPKRFLTLG---SKFRYSGRTQAQSRRASSQ------IARAAPHFQRTTSRR 407          
BLAST of Band 4.1 protein 2 vs. Ensembl Zebrafish
Match: si:dkey-178k16.1 (si:dkey-178k16.1 [Source:ZFIN;Acc:ZDB-GENE-090312-61])

HSP 1 Score: 243.817 bits (621), Expect = 9.517e-67
Identity = 141/347 (40.63%), Postives = 203/347 (58.50%), Query Frame = 1
Query:  331 KMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLE----FKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            K  P  V +LDG+     ++    GQ L D +C+ L+L E+ YFG+ ++D   +   WL   K+I  Q+    W F F VKFYPP      ED+T+Y+ CLQ+R+DI+ G LP SF    LLG++A+Q+E GD+DP  H G +Y+ +  FAP   QT EL  R+ ELH+     +P EA+  FL NA KL MYGVD+H  K+ +  ++ +GV  SG+LIYR R+RI R +WPKI+K++YK  +F++ +R  E+ K   Q E    FK  +H+ +KRLWK C+EHHTFFR+V  E P K  L+ G    K+ Y                 + ++ RP P+  R  ++R
Sbjct:   52 KTVPVKVLLLDGSAYESGVEKLCKGQVLLDMVCEHLNLLEKDYFGLSFSDTECQ-KNWLDPSKEIKKQIRVGPWHFSFAVKFYPPDPSQLIEDITRYYLCLQLREDILSGRLPCSFVTHALLGSYAIQAELGDYDPEEH-GPDYINEFRFAPN--QTRELEERVMELHRTYRGMSPAEAEINFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCASGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEVEKKYEQFESTIGFKLPNHRASKRLWKVCIEHHTFFRLVSPEPPPKGFLVIG---SKFRYSGRTQAQSRQA------SALIDRPAPQFERSISRR 385          
BLAST of Band 4.1 protein 2 vs. Ensembl Zebrafish
Match: si:dkey-178k16.1 (si:dkey-178k16.1 [Source:ZFIN;Acc:ZDB-GENE-090312-61])

HSP 1 Score: 243.432 bits (620), Expect = 1.010e-66
Identity = 139/343 (40.52%), Postives = 202/343 (58.89%), Query Frame = 1
Query:  331 KMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            K  P  V +LDG+     ++    GQ L D +C+ L+L E+ YFG+ ++D   +   WL   K+I  Q+    W F F VKFYPP      ED+T+Y+ CLQ+R+DI+ G LP SF    LLG++A+Q+E GD+DP  H G +Y+ +  FAP   QT EL  R+ ELH+     +P EA+  FL NA KL MYGVD+H  K+ +  ++ +GV  SG+LIYR R+RI R +WPKI+K++YK  +F++ +R  E  + E  + FK  +H+ +KRLWK C+EHHTFFR+V  E P K  L+ G    K+ Y                 + ++ RP P+  R  ++R
Sbjct:   52 KTVPVKVLLLDGSAYESGVEKLCKGQVLLDMVCEHLNLLEKDYFGLSFSDTECQ-KNWLDPSKEIKKQIRVGPWHFSFAVKFYPPDPSQLIEDITRYYLCLQLREDILSGRLPCSFVTHALLGSYAIQAELGDYDPEEH-GPDYINEFRFAPN--QTRELEERVMELHRTYRGMSPAEAEINFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCASGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRASKRLWKVCIEHHTFFRLVSPEPPPKGFLVIG---SKFRYSGRTQAQSRQA------SALIDRPAPQFERSISRR 381          
BLAST of Band 4.1 protein 2 vs. Ensembl Xenopus
Match: dcx (doublecortin [Source:Xenbase;Acc:XB-GENE-992092])

HSP 1 Score: 250.751 bits (639), Expect = 2.536e-69
Identity = 148/352 (42.05%), Postives = 206/352 (58.52%), Query Frame = 1
Query:  304 LNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            L S  +P  K     V +LDG+E + +++  S GQ LFD++C+ L+L E+ YFG+ Y D   +   WL   K+I  Q     W F F VKFYPP      ED+T+Y+ CLQ+R DIV G LP SF    LLG+++VQSE GD+DP  + G +Y+ +  FAP   QT EL  ++ ELHK     TP EA+  FL NA KL MYGVD+H  K+ +  E+ +GV  SG+LIYR R+RI R +WPK++K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK CVEHHTFFR++  E P K  L  G    K+ Y                 + ++ RP P   R  ++R
Sbjct:  101 LKSARRP--KNMQAKVMLLDGSEYSCEVEKRSKGQILFDKVCEHLNLLEKDYFGLVYRDSENQ-KNWLDPAKEIKKQTRNGAWHFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVCGRLPCSFVTLALLGSYSVQSELGDYDPEEY-GSDYVTEFRFAPN--QTKELEDKVVELHKSYRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLMPEAPPKKFLTLG---SKFRYSGRTQAQTRRA------SALIDRPAPYFERSSSKR 437          
BLAST of Band 4.1 protein 2 vs. Ensembl Xenopus
Match: dcx (doublecortin [Source:Xenbase;Acc:XB-GENE-992092])

HSP 1 Score: 250.751 bits (639), Expect = 3.421e-69
Identity = 148/352 (42.05%), Postives = 206/352 (58.52%), Query Frame = 1
Query:  304 LNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            L S  +P  K     V +LDG+E + +++  S GQ LFD++C+ L+L E+ YFG+ Y D   +   WL   K+I  Q     W F F VKFYPP      ED+T+Y+ CLQ+R DIV G LP SF    LLG+++VQSE GD+DP  + G +Y+ +  FAP   QT EL  ++ ELHK     TP EA+  FL NA KL MYGVD+H  K+ +  E+ +GV  SG+LIYR R+RI R +WPK++K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK CVEHHTFFR++  E P K  L  G    K+ Y                 + ++ RP P   R  ++R
Sbjct:  101 LKSARRP--KNMQAKVMLLDGSEYSCEVEKRSKGQILFDKVCEHLNLLEKDYFGLVYRDSENQ-KNWLDPAKEIKKQTRNGAWHFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVCGRLPCSFVTLALLGSYSVQSELGDYDPEEY-GSDYVTEFRFAPN--QTKELEDKVVELHKSYRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLMPEAPPKKFLTLG---SKFRYSGRTQAQTRRA------SALIDRPAPYFERSSSKR 437          
BLAST of Band 4.1 protein 2 vs. Ensembl Xenopus
Match: dcx (doublecortin [Source:Xenbase;Acc:XB-GENE-992092])

HSP 1 Score: 250.751 bits (639), Expect = 4.968e-69
Identity = 148/352 (42.05%), Postives = 206/352 (58.52%), Query Frame = 1
Query:  304 LNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            L S  +P  K     V +LDG+E + +++  S GQ LFD++C+ L+L E+ YFG+ Y D   +   WL   K+I  Q     W F F VKFYPP      ED+T+Y+ CLQ+R DIV G LP SF    LLG+++VQSE GD+DP  + G +Y+ +  FAP   QT EL  ++ ELHK     TP EA+  FL NA KL MYGVD+H  K+ +  E+ +GV  SG+LIYR R+RI R +WPK++K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK CVEHHTFFR++  E P K  L  G    K+ Y                 + ++ RP P   R  ++R
Sbjct:  101 LKSARRP--KNMQAKVMLLDGSEYSCEVEKRSKGQILFDKVCEHLNLLEKDYFGLVYRDSENQ-KNWLDPAKEIKKQTRNGAWHFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVCGRLPCSFVTLALLGSYSVQSELGDYDPEEY-GSDYVTEFRFAPN--QTKELEDKVVELHKSYRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLMPEAPPKKFLTLG---SKFRYSGRTQAQTRRA------SALIDRPAPYFERSSSKR 437          
BLAST of Band 4.1 protein 2 vs. Ensembl Xenopus
Match: dcx (doublecortin [Source:Xenbase;Acc:XB-GENE-992092])

HSP 1 Score: 251.136 bits (640), Expect = 5.740e-69
Identity = 148/352 (42.05%), Postives = 206/352 (58.52%), Query Frame = 1
Query:  304 LNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            L S  +P  K     V +LDG+E + +++  S GQ LFD++C+ L+L E+ YFG+ Y D   +   WL   K+I  Q     W F F VKFYPP      ED+T+Y+ CLQ+R DIV G LP SF    LLG+++VQSE GD+DP  + G +Y+ +  FAP   QT EL  ++ ELHK     TP EA+  FL NA KL MYGVD+H  K+ +  E+ +GV  SG+LIYR R+RI R +WPK++K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK CVEHHTFFR++  E P K  L  G    K+ Y                 + ++ RP P   R  ++R
Sbjct:  101 LKSARRP--KNMQAKVMLLDGSEYSCEVEKRSKGQILFDKVCEHLNLLEKDYFGLVYRDSENQ-KNWLDPAKEIKKQTRNGAWHFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVCGRLPCSFVTLALLGSYSVQSELGDYDPEEY-GSDYVTEFRFAPN--QTKELEDKVVELHKSYRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLMPEAPPKKFLTLG---SKFRYSGRTQAQTRRA------SALIDRPAPYFERSSSKR 437          
BLAST of Band 4.1 protein 2 vs. Ensembl Xenopus
Match: dcx (doublecortin [Source:Xenbase;Acc:XB-GENE-992092])

HSP 1 Score: 251.136 bits (640), Expect = 3.457e-68
Identity = 149/352 (42.33%), Postives = 207/352 (58.81%), Query Frame = 1
Query:  304 LNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            L S  +P   MQ   V +LDG+E + +++  S GQ LFD++C+ L+L E+ YFG+ Y D   +   WL   K+I  Q     W F F VKFYPP      ED+T+Y+ CLQ+R DIV G LP SF    LLG+++VQSE GD+DP  + G +Y+ +  FAP   QT EL  ++ ELHK     TP EA+  FL NA KL MYGVD+H  K+ +  E+ +GV  SG+LIYR R+RI R +WPK++K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK CVEHHTFFR++  E P K  L  G    K+ Y                 + ++ RP P   R  ++R
Sbjct:  101 LKSARRPKN-MQ-AKVMLLDGSEYSCEVEKRSKGQILFDKVCEHLNLLEKDYFGLVYRDSENQ-KNWLDPAKEIKKQTRNGAWHFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVCGRLPCSFVTLALLGSYSVQSELGDYDPEEY-GSDYVTEFRFAPN--QTKELEDKVVELHKSYRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLMPEAPPKKFLTLG---SKFRYSGRTQAQTRRA------SALIDRPAPYFERSSSKR 437          
BLAST of Band 4.1 protein 2 vs. Ensembl Mouse
Match: Epb41l2 (erythrocyte membrane protein band 4.1 like 2 [Source:MGI Symbol;Acc:MGI:103009])

HSP 1 Score: 249.98 bits (637), Expect = 8.068e-72
Identity = 140/337 (41.54%), Postives = 203/337 (60.24%), Query Frame = 1
Query:  214 SALRNSGNFSKSQSHTTLSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLI 1224
            +A R +     S+    ++++  T K K  L              VT+LDGTE + D++  + GQ LFDR+C+ L+L E+ YFG+ + D   +   WL   K+I  QL    W+F F VKFYPP      ED+T+YF CLQ+RQDI  G LP SF    LLG++ +Q+E GD+DP  +  I+ L    FAP    T EL  ++SELHK     +P +AD  FL NA +L MYGVD+H  K+ +  ++ +GV  +G+LIY+ R+RI R +WPKI+K++YK  +F++ +R  E+ + E  + FK  +H+ AKRLWK CVEHHTF+R+V  E P K + +
Sbjct:  182 AAKRETKEVQTSELKAEVASQKATKKTKTVL------------AKVTLLDGTEYSCDLEKRAKGQVLFDRVCEHLNLLEKDYFGLLFQDHPEQ-KNWLDPAKEIKRQLKNLPWLFTFNVKFYPPDPSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAEHGDYDPEEYDSID-LGDFQFAP--AHTKELEEKVSELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVEHHTFYRLVSPEQPPKTKFL 502          
BLAST of Band 4.1 protein 2 vs. Ensembl Mouse
Match: Epb41l2 (erythrocyte membrane protein band 4.1 like 2 [Source:MGI Symbol;Acc:MGI:103009])

HSP 1 Score: 249.98 bits (637), Expect = 8.068e-72
Identity = 140/337 (41.54%), Postives = 203/337 (60.24%), Query Frame = 1
Query:  214 SALRNSGNFSKSQSHTTLSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLI 1224
            +A R +     S+    ++++  T K K  L              VT+LDGTE + D++  + GQ LFDR+C+ L+L E+ YFG+ + D   +   WL   K+I  QL    W+F F VKFYPP      ED+T+YF CLQ+RQDI  G LP SF    LLG++ +Q+E GD+DP  +  I+ L    FAP    T EL  ++SELHK     +P +AD  FL NA +L MYGVD+H  K+ +  ++ +GV  +G+LIY+ R+RI R +WPKI+K++YK  +F++ +R  E+ + E  + FK  +H+ AKRLWK CVEHHTF+R+V  E P K + +
Sbjct:  182 AAKRETKEVQTSELKAEVASQKATKKTKTVL------------AKVTLLDGTEYSCDLEKRAKGQVLFDRVCEHLNLLEKDYFGLLFQDHPEQ-KNWLDPAKEIKRQLKNLPWLFTFNVKFYPPDPSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAEHGDYDPEEYDSID-LGDFQFAP--AHTKELEEKVSELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVEHHTFYRLVSPEQPPKTKFL 502          
BLAST of Band 4.1 protein 2 vs. Ensembl Mouse
Match: Epb41l3 (erythrocyte membrane protein band 4.1 like 3 [Source:MGI Symbol;Acc:MGI:103008])

HSP 1 Score: 257.684 bits (657), Expect = 8.293e-72
Identity = 155/374 (41.44%), Postives = 214/374 (57.22%), Query Frame = 1
Query:  304 LNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQRKEKETPLSPSGIAPCANNDEIF 1425
            L  V +P  K   C VT+LDG+E   D+D  S GQ LFD++C+ L+L E+ YFG+ Y D   +   WL   K+I  Q+    W F F VKFYPP      ED+T+Y+ CLQ+R DIV G LP SF    LLG++ VQSE GD+DP+   G +Y+ +  FAP    T EL  ++ ELHK     TP EA+  FL NA KL MYGVD+H  K+ +  E+ +GV  SG+LIYR R+RI R +WPK++K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK CVEHHTFFR++  E P K  L  G    K+ Y                 + ++ RP P   R  ++R      L  + +   + N EI+
Sbjct:  109 LKIVKRP--KSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQ-KNWLDPAKEIKKQIRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPDEC-GNDYISEFRFAPN--HTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLG---SKFRYSGRTQAQTRRA------SALIDRPAPYFERSSSKRYTMSRSLDGASV---SENHEIY 464          
BLAST of Band 4.1 protein 2 vs. Ensembl Mouse
Match: Epb41l3 (erythrocyte membrane protein band 4.1 like 3 [Source:MGI Symbol;Acc:MGI:103008])

HSP 1 Score: 257.684 bits (657), Expect = 1.081e-71
Identity = 151/352 (42.90%), Postives = 206/352 (58.52%), Query Frame = 1
Query:  304 LNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            L  V +P  K   C VT+LDG+E   D+D  S GQ LFD++C+ L+L E+ YFG+ Y D   +   WL   K+I  Q+    W F F VKFYPP      ED+T+Y+ CLQ+R DIV G LP SF    LLG++ VQSE GD+DP+   G +Y+ +  FAP    T EL  ++ ELHK     TP EA+  FL NA KL MYGVD+H  K+ +  E+ +GV  SG+LIYR R+RI R +WPK++K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK CVEHHTFFR++  E P K  L  G    K+ Y                 + ++ RP P   R  ++R
Sbjct:  105 LKIVKRP--KSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQ-KNWLDPAKEIKKQIRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPDEC-GNDYISEFRFAPN--HTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLG---SKFRYSGRTQAQTRRA------SALIDRPAPYFERSSSKR 441          
BLAST of Band 4.1 protein 2 vs. Ensembl Mouse
Match: Epb41l3 (erythrocyte membrane protein band 4.1 like 3 [Source:MGI Symbol;Acc:MGI:103008])

HSP 1 Score: 257.684 bits (657), Expect = 2.572e-71
Identity = 151/352 (42.90%), Postives = 206/352 (58.52%), Query Frame = 1
Query:  304 LNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            L  V +P  K   C VT+LDG+E   D+D  S GQ LFD++C+ L+L E+ YFG+ Y D   +   WL   K+I  Q+    W F F VKFYPP      ED+T+Y+ CLQ+R DIV G LP SF    LLG++ VQSE GD+DP+   G +Y+ +  FAP    T EL  ++ ELHK     TP EA+  FL NA KL MYGVD+H  K+ +  E+ +GV  SG+LIYR R+RI R +WPK++K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK CVEHHTFFR++  E P K  L  G    K+ Y                 + ++ RP P   R  ++R
Sbjct:  109 LKIVKRP--KSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQ-KNWLDPAKEIKKQIRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPDEC-GNDYISEFRFAPN--HTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLG---SKFRYSGRTQAQTRRA------SALIDRPAPYFERSSSKR 445          
BLAST of Band 4.1 protein 2 vs. UniProt/SwissProt
Match: sp|O43491|E41L2_HUMAN (Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1)

HSP 1 Score: 259.996 bits (663), Expect = 1.233e-70
Identity = 150/388 (38.66%), Postives = 228/388 (58.76%), Query Frame = 1
Query:  232 GNFSKSQSHTTLSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQRKEKETPLSPSGI 1395
            G  +K ++    +N    +K + +   V K +  +Q C VT+LDGTE + D++  + GQ LFD++C+ L+L E+ YFG+ + +   +   WL   K+I  QL    W+F F VKFYPP      ED+T+YF CLQ+RQDI  G LP SF    LLG++ +Q+E GD+DP  H  I+ L +  FAP   QT EL  +++ELHK     +P +AD  FL NA +L MYGVD+H  K+ +  ++ +GV  +G+LIY+ R+RI R +WPKI+K++YK  +F++ +R  E+ + E  + FK  +H+ AKRLWK CVEHHTF+R+V  E P K + +   G+ K+ Y                 + ++ RP P   R  ++R  +    +P G+
Sbjct:  187 GGAAKRETKEVQTNE---LKAEKASQKVTKKTKTVQ-CKVTLLDGTEYSCDLEKHAKGQVLFDKVCEHLNLLEKDYFGLLFQESPEQ-KNWLDPAKEIKRQLRNLPWLFTFNVKFYPPDPSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPEEHGSID-LSEFQFAP--TQTKELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVEHHTFYRLVSPEQPPKAKFL-TLGS-KFRYSGRTQAQTRQA------STLIDRPAPHFERTSSKRVSRSLDGAPIGV 558          
BLAST of Band 4.1 protein 2 vs. UniProt/SwissProt
Match: sp|Q9WV92|E41L3_MOUSE (Band 4.1-like protein 3 OS=Mus musculus OX=10090 GN=Epb41l3 PE=1 SV=1)

HSP 1 Score: 257.684 bits (657), Expect = 3.113e-70
Identity = 151/352 (42.90%), Postives = 206/352 (58.52%), Query Frame = 1
Query:  304 LNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            L  V +P  K   C VT+LDG+E   D+D  S GQ LFD++C+ L+L E+ YFG+ Y D   +   WL   K+I  Q+    W F F VKFYPP      ED+T+Y+ CLQ+R DIV G LP SF    LLG++ VQSE GD+DP+   G +Y+ +  FAP    T EL  ++ ELHK     TP EA+  FL NA KL MYGVD+H  K+ +  E+ +GV  SG+LIYR R+RI R +WPK++K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK CVEHHTFFR++  E P K  L  G    K+ Y                 + ++ RP P   R  ++R
Sbjct:  109 LKIVKRP--KSMQCKVTLLDGSEYGCDVDKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQ-KNWLDPAKEIKKQIRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPDEC-GNDYISEFRFAPN--HTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLG---SKFRYSGRTQAQTRRA------SALIDRPAPYFERSSSKR 445          
BLAST of Band 4.1 protein 2 vs. UniProt/SwissProt
Match: sp|O70318|E41L2_MOUSE (Band 4.1-like protein 2 OS=Mus musculus OX=10090 GN=Epb41l2 PE=1 SV=2)

HSP 1 Score: 254.988 bits (650), Expect = 5.238e-69
Identity = 150/394 (38.07%), Postives = 224/394 (56.85%), Query Frame = 1
Query:  214 SALRNSGNFSKSQSHTTLSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQRKEKETPLSPSGI 1395
            +A R +     S+    ++++  T K K  L              VT+LDGTE + D++  + GQ LFDR+C+ L+L E+ YFG+ + D   +   WL   K+I  QL    W+F F VKFYPP      ED+T+YF CLQ+RQDI  G LP SF    LLG++ +Q+E GD+DP  +  I+ L    FAP    T EL  ++SELHK     +P +AD  FL NA +L MYGVD+H  K+ +  ++ +GV  +G+LIY+ R+RI R +WPKI+K++YK  +F++ +R  E+ + E  + FK  +H+ AKRLWK CVEHHTF+R+V  E P K + +   G+ K+ Y                 + ++ RP P+  R  ++R  +    +P G+
Sbjct:  182 AAKRETKEVQTSELKAEVASQKATKKTKTVL------------AKVTLLDGTEYSCDLEKRAKGQVLFDRVCEHLNLLEKDYFGLLFQDHPEQ-KNWLDPAKEIKRQLKNLPWLFTFNVKFYPPDPSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAEHGDYDPEEYDSID-LGDFQFAP--AHTKELEEKVSELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVEHHTFYRLVSPEQPPKTKFL-TLGS-KFRYSGRTQAQTREA------STLIDRPAPQFERASSKRVSRSLDGAPIGV 551          
BLAST of Band 4.1 protein 2 vs. UniProt/SwissProt
Match: sp|Q9Y2J2|E41L3_HUMAN (Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=2)

HSP 1 Score: 254.603 bits (649), Expect = 1.811e-68
Identity = 149/349 (42.69%), Postives = 204/349 (58.45%), Query Frame = 1
Query:  313 VYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            V KP  K   C V +LDG+E   D++  S GQ LFD++C+ L+L E+ YFG+ Y D   +   WL   K+I  Q+    W F F VKFYPP      ED+T+Y+ CLQ+R DIV G LP SF    LLG++ VQSE GD+DP+   G +Y+ +  FAP    T EL  ++ ELHK     TP EA+  FL NA KL MYGVD+H  K+ +  E+ +GV  SG+LIYR R+RI R +WPK++K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK CVEHHTFFR++  E P K  L  G    K+ Y                 + ++ RP P   R  ++R
Sbjct:  104 VKKP--KSMQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQ-KNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSELGDYDPDEC-GSDYISEFRFAPN--HTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLG---SKFRYSGRTQAQTRRA------SALIDRPAPYFERSSSKR 437          
BLAST of Band 4.1 protein 2 vs. UniProt/SwissProt
Match: sp|Q9Z2H5|E41L1_MOUSE (Band 4.1-like protein 1 OS=Mus musculus OX=10090 GN=Epb41l1 PE=1 SV=2)

HSP 1 Score: 248.44 bits (633), Expect = 2.315e-67
Identity = 150/365 (41.10%), Postives = 210/365 (57.53%), Query Frame = 1
Query:  265 LSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            LS R    K + S   + K   K   C VT+LD +E   +++    GQ LFD +C+ L+L E+ YFG+ + D   +   WL   K+I  Q+  + W F F VKFYPP      ED+T+Y+ CLQ+R DI+ G LP SF    LLG++AVQ+E GD+D   H G  Y+ ++ FAP   QT EL  RI ELHK     TP EA+  FL NA KL MYGVD+H  K+ +  ++ +GV  +G+LIYR R+RI R +WPKI+K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK C+EHHTFFR+V  E P K  L+ G    K+ Y                 + ++ RP P   R  ++R
Sbjct:   74 LSERTTPSKAQKSPQKIAK-KFKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTFCDADSQ-KNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVG-NYVSELRFAPN--QTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSAKRLWKVCIEHHTFFRLVSPEPPPKGFLVMG---SKFRYSGRTQAQTRQA------SALIDRPAPFFERSSSKR 424          
BLAST of Band 4.1 protein 2 vs. TrEMBL
Match: A0A5K4F8W6 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 736.873 bits (1901), Expect = 0.000e+0
Identity = 415/954 (43.50%), Postives = 580/954 (60.80%), Query Frame = 1
Query:  130 ELDNGQIEEIHVIPKSEYYASLR----MGSTTSALRNSGNFSKSQSHTTLSNRYGTIK-------------RKNSLNSV--YKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXX-------QSAPNIILGRPQPK-----VRRMQ--TQRKEKETPLSPSGIAPCAN------------------------------------NDEIFSLEESLDNA---IERPELLEEYWQMSIDDSTPEMGIDPLGLDVAGNKGSGWQGSRANKGVKGPGKYYYEGKVVEDGLIRLGWATNDASLDLGSDKEGFGYGDSQAGDKN-GGFKRNCNKENG--YGQPIKEGDLIGCFLDFDNGNIQWSKNGATFEPAFKIPDELKDEAFFPASSIKDGRVIFNFGDE-PLSFLPKRDWLPVSQANENNVVPNKNIGWKMNPFDATTGTDVSGNGYTLQSKLNGEWNGCRANKGVFDCGKYYYEVIPLED-GLARVGWATXXXXXXXXXXXXXXXYGADNDGFGLKGNQGKKMNSGEIENYGDPFMKGDVIGCFLDLDNKYVKWSKNGQVYKEGYVLPDDLVE---LRAFYPTASLINNTLDFNFGNKPFEFYPGSEWNPLCYAAHGNTEKTKKRDPSLYSKPFTDREEDVLEIR-RQAREKFKRND-QLEEE 2745
            +L +G IE    +PK EYY SLR     G         G+ S   +   ++   G +              R +S  SV  +KPSGK+  C V MLDGT   + +D A++GQ LFD +C  L L E ++FGI Y D T   WFWL +D+KI+ Q+GKN+W F+FQVKFYP  +D  +ED+T+Y+ CLQVRQDIV G LP SF  + +L ++ VQSEAGD DP+ H GI+Y++  PFAP  LQT E+L RI ELHK    +TPEEADR FL NA KL +YGVD+HKVK  Q +++++GVY+ GIL+YR RIR++R SWP+I+ L+++ ++F +  R  + +  +R + FKC S  LAKRL+  CV+HH FFR+  +   +KP L P F TRKY YP +       +         Q++ ++   RP P      V  M      + +  P   SG   C N                                    ND   S    ++N    I R     E+W+++  D TP +GID  GLDVA  +G+GWQG RANKGVK PG YYYE   +E+GLIR+GW+TNDA L+LG+D  GFGYG    G     G  R  ++  G  YG  + +GD+IGC LD D G+I WS NG  F+ AF IPD+L+ EAF PA+S+KD R++FNFG+E PL F P   ++PV+Q+ +++ V N+N GW+MN +DAT   DV+ +G  +QS  N  W GCR+N G+   G++Y+EV P+E  GL RVGW+TDDG+L +G+D  GFGYGADN+GFGL G QGK+++  EIENYG+ F +GDVIGCFLD     +KWS+NG  + + Y +P +L++   L A YPT SL+N+T++ NFG+KPF++YPG +W P+C A    T++++++ P    K ++  +  +LE    Q  +  +R++ Q+E E
Sbjct:   36 QLQDGTIEITDRLPKKEYYMSLRRFNGAGPNFGIAHRLGSISSGSAAGLVNGSSGLLGGNSPSPCPGGGTLRGSSHPSVIDFKPSGKLVDCTVVMLDGTTREFRLDKAAYGQQLFDAVCTHLGLLEVEFFGITYYDST-NNWFWLQIDQKIAKQIGKNEWQFEFQVKFYPCDIDSIKEDITRYYLCLQVRQDIVSGQLPCSFVTYCILASYIVQSEAGDHDPSQHIGIKYIQDHPFAPHMLQTPEMLGRIVELHKLHRGKTPEEADRLFLNNARKLALYGVDLHKVKTSQGQDITLGVYYGGILLYRNRIRLMRISWPRIISLSHRGRNFIIARRPGD-DSLDRNMTFKCISPILAKRLYNVCVDHHNFFRLRGSSRQKKPSLFPSFATRKYHYPGTTMNLSSIDATVGVGEHNQTSRSLSKFRPMPAHPSETVNHMNGAVASQYQYQPAMVSGDPACMNPAYFCSQSIINGLPIPTAQGVQRYYQSSSNDVTGLMNDHYSSKNNHINNMTVMITRIPFEPEHWRITGADCTPGLGIDARGLDVASTRGAGWQGCRANKGVKAPGAYYYEAVCLEEGLIRVGWSTNDADLELGADNYGFGYGSDAVGSAGINGTGRVIHRNIGYDYGIMVHQGDVIGCLLDLDKGSISWSCNGKIFQRAFTIPDQLRGEAFLPAASLKDSRILFNFGEERPLEFPPDGPFIPVAQSADDSQVSNRNPGWRMNQYDATNALDVAPDGSQVQSHFNQGWQGCRSNHGIRGLGRFYFEVTPIESTGLWRVGWSTDDGNLIVGTDQYGFGYGADNEGFGLNGQQGKRIHCDEIENYGEAFSEGDVIGCFLDTIEHTIKWSRNGLEFGDAYQIPSELLDSKKLTALYPTVSLLNSTVELNFGDKPFKYYPGPDWTPVCCAPPECTKRSRRKGPERKVKGWSYIDPTILEPSIGQTMQSIERSEPQIETE 987          
BLAST of Band 4.1 protein 2 vs. TrEMBL
Match: A0A430QPK3 (Erythrocyte membrane protein band 4.1 OS=Schistosoma bovis OX=6184 GN=DC041_0005627 PE=4 SV=1)

HSP 1 Score: 732.25 bits (1889), Expect = 0.000e+0
Identity = 416/932 (44.64%), Postives = 567/932 (60.84%), Query Frame = 1
Query:  130 ELDNGQIEEIHVIPKSEYYASLRMGSTTSALRNSGNFSK-----SQSHTTLSN--------------RYGTIKRKNSLNSV--YKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILG--------RPQPKVRRMQTQRKE-------------KETPLSPSGIAPCANNDEIFSLEESLDNAIERPEL--LEEYWQMSIDDST----------------------------PE------------MGIDPLGLDVAGNKGSGWQGSRANKGVKGPGKYYYEGKVVEDGLIRLGWATNDASLDLGSDKEGFGYGDSQAGDKN-GGFKRNCNKENG--YGQPIKEGDLIGCFLDFDNGNIQWSKNGATFEPAFKIPDELKDEAFFPASSIKDGRVIFNFGDE-PLSFLPKRDWLPVSQANENNVVPNKNIGWKMNPFDATTGTDVSGNGYTLQSKLNGEWNGCRANKGVFDCGKYYYEVIPLED-GLARVGWATXXXXXXXXXXXXXXXYGADNDGFGLKGNQGKKMNSGEIENYGDPFMKGDVIGCFLDLDNKYVKWSKNGQVYKEGYVLPDDLVE---LRAFYPTASLINNTLDFNFGNKPFEFYPGSEWNPLCYAAHGNTEKTKKRDPSL 2649
            +L +G IE    +PK EYY SLR  ++T    NSG   +     S S   L+N                G+  R +S  SV  +KPSGK+  C V MLDGT   + +D A++GQ LFD +C  L L E ++FGI Y D T   WFWL  D+KI+ Q+GKN+W F+FQVKFYP  +D  +ED+T+Y+ CLQVRQDIV G LP SF  + +LG++ VQSEAGD DP  H GI+Y++  PFAP  LQT E+L RI ELHK    +TPEEADR FL NA KL +YGVD+HKVK  Q +++++GVY+ GIL+YR RIR++R SWP+I+ L+++ ++F +  R  + +  +R + FKC S  LAKRL+  CV+HH FFR+  +  P+KP L P F TRKY Y            N S+ +  +G        RP  K R M     E             +  P   SG   C   D  +   +++ N +  P    ++ Y+Q S +D T                            PE            +GID  GLDVA  +G+GWQG RANKGVK PG YYYE   +E+GLIR+GW+TNDA+L+LG+D  GFGYG    G     G  R  ++  G  YG  + +GD+IGC LD D G+I WS NG  F+ AF IPD+L+ EAF PA+S+KD R++FNFG+E PL F P   ++PV+Q+ +++ V N+N GW+MN +DAT   DV+ +G  +QS  N  W GCR+N G+   G++Y+EV P+E  GL RVGW+TDDG+L +G+D  GFGYGADN+GFGL G QGK+++  EIENYG+ F K DVIGCFLD     +KWSKNG  + + Y +P +L+    L A YPT SL+N+TL+ NFG+KPF++YPG +W P+C A    T++++++ P +
Sbjct:   36 QLQDGTIEITDRLPKKEYYMSLRRFNSTGP--NSGTAHRLGSISSGSAAGLANGSSGLLGGNSPSPRPCGSTLRGSSHPSVVDFKPSGKIVDCTVVMLDGTTREFRLDKAAYGQQLFDAVCTHLGLLEVEFFGITYYDST-NNWFWLQTDQKIAKQIGKNEWQFEFQVKFYPCDIDSIKEDITRYYLCLQVRQDIVSGQLPCSFVTYCILGSYIVQSEAGDHDPTQHIGIKYIQDHPFAPHMLQTPEMLGRIVELHKLHRGKTPEEADRLFLNNARKLALYGVDLHKVKTSQGQDITLGVYYGGILLYRNRIRLMRISWPRIISLSHRGRNFIIARRPGD-DSLDRNMTFKCISPTLAKRLYNVCVDHHNFFRLRGSSRPKKPSLFPSFATRKYHY-------PGTTVNSSSIDATVGVGGHNQTSRPLSKFRPMPAHPSETVDHMNGAVASQYQYQPAMVSGDPACM--DPTYFCNQNVINGLPIPNAQGVQRYYQPSSNDVTGLMNGHHPNSNNNHINNMPTMITRISFEPEHWRITGADCTAGLGIDARGLDVASTRGAGWQGCRANKGVKAPGAYYYEAACLEEGLIRVGWSTNDANLELGADNYGFGYGSDAVGSAGMNGTGRVMHRNTGHDYGIMVHQGDVIGCLLDLDKGSISWSCNGKIFQRAFTIPDQLRGEAFLPAASLKDSRILFNFGEEQPLEFPPDGSFIPVAQSADDSQVSNRNPGWRMNQYDATNALDVAPDGSQVQSHFNQGWQGCRSNHGIRGLGRFYFEVTPIESTGLWRVGWSTDDGNLIVGTDQYGFGYGADNEGFGLNGQQGKRIHCDEIENYGEAFSKDDVIGCFLDTIEHTIKWSKNGLEFGDAYRIPSELLHSKNLTALYPTVSLLNSTLELNFGDKPFKYYPGPDWTPVCCAPPECTKRSRRKGPEV 954          
BLAST of Band 4.1 protein 2 vs. TrEMBL
Match: A0A095A0Q9 (Band 4.1-like protein 3 OS=Schistosoma haematobium OX=6185 GN=MS3_08806 PE=4 SV=1)

HSP 1 Score: 731.865 bits (1888), Expect = 0.000e+0
Identity = 418/938 (44.56%), Postives = 570/938 (60.77%), Query Frame = 1
Query:   91 SNNLTLDKKVQRRELDNGQIEEIHVIPKSEYYASLRMGSTTSALRNSGNFSK-----SQSHTTLSNRY--------------GTIKRKNSLNSV--YKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSA-PNIILGRPQPKVRRMQTQRKE-------------KETPLSPSGIAPCANNDEIFSLEESLDNAIERPEL--LEEYWQMSIDDST----------------------------PE------------MGIDPLGLDVAGNKGSGWQGSRANKGVKGPGKYYYEGKVVEDGLIRLGWATNDASLDLGSDKEGFGYGDSQAGDKN-GGFKRNCNKENG--YGQPIKEGDLIGCFLDFDNGNIQWSKNGATFEPAFKIPDELKDEAFFPASSIKDGRVIFNFGDE-PLSFLPKRDWLPVSQANENNVVPNKNIGWKMNPFDATTGTDVSGNGYTLQSKLNGEWNGCRANKGVFDCGKYYYEVIPLED-GLARVGWATXXXXXXXXXXXXXXXYGADNDGFGLKGNQGKKMNSGEIENYGDPFMKGDVIGCFLDLDNKYVKWSKNGQVYKEGYVLPDDLVE---LRAFYPTASLINNTLDFNFGNKPFEFYPGSEWNPLCYAAHGNTEKTKKRDPSL 2649
            S NL   +     +L +G IE    +PK EYY SLR  ++T    NSG   +     S S   L+N                G+  R +S  SV  +KPSGK+  C V MLDGT   + +D A++GQ LFD +C  L L E ++FGI Y D T   WFWL  D+KI+ Q+GKN+W F+FQVKFYP  +D  +ED+T+Y+ CLQVRQDIV G LP SF  + +LG++ VQSEAGD DP  H GI+Y++  PFAP  LQT E+L RI ELHK    +TPEEADR FL NA KL +YGVD+HKVK  Q +++++GVY+ GIL+YR RIR++R SWP+I+ L+++ ++F +  R  + +  +R + FKC S  LAKRL+  CV+HH FFR+  +  P+KP L P F TRKY YP +   S   +       +    RP  K R M     E             +  P   SG   C   D  +   +++ N +  P    ++ Y+Q S +D T                            PE            +GID  GLDVA  +G+GWQG RANKGVK PG YYYE   +E+GLIR+GW+TNDA+L+LG+D  GFGYG    G     G  R  ++  G  YG  + +GD+IGC LD D G+I WS NG  F+ AF IPD+L+ EAF PA+S+KD R++FNFG+E PL F P   ++PV+Q+ +++ V N+N GW+MN +DAT   DV+ +G  +QS  N  W GCR+N G+   G++Y+EV P+E  GL RVGW+TDDG+L +G+D  GFGYGADN+GFGL G QGK+++  EIENYG+ F K DVIGCFLD     +KWSKNG  + + Y +P +L+    L A YPT SL+N+TL+ NFG+KPF++YPG +W P+C A    T++++++ P +
Sbjct:   19 STNLLHLEGHSWSQLQDGTIEITDRLPKKEYYMSLRRFNSTGP--NSGTAHRLGSISSGSAAGLANGSSGLLGGNSPSPRPGGSTLRGSSHPSVVDFKPSGKIVDCTVVMLDGTTREFRLDKAAYGQQLFDAVCTHLGLLEVEFFGITYYDST-NNWFWLQTDQKIAKQIGKNEWQFEFQVKFYPCDIDSIKEDITRYYLCLQVRQDIVSGQLPCSFVTYCILGSYIVQSEAGDHDPTQHIGIKYIQDHPFAPHMLQTPEMLGRIVELHKLHRGKTPEEADRLFLNNARKLALYGVDLHKVKTSQGQDITLGVYYGGILLYRNRIRLMRISWPRIISLSHRGRNFIIARRPGD-DSLDRNMTFKCISPTLAKRLYNVCVDHHNFFRLRGSSRPKKPSLFPSFATRKYHYPGTTVNSSSIDATVGVGGHNQTSRPLSKFRPMPAHPSETVDHMNGAVASQYQYQPAMVSGDPACM--DPTYFCNQNVINGLPIPNAHGVQRYYQPSSNDVTGLMNGHHPNSNNNHINNMPTMITRISFVPEHWRITGADCTAGLGIDARGLDVASTRGAGWQGCRANKGVKAPGAYYYEAACLEEGLIRVGWSTNDANLELGADNYGFGYGSDAVGSAGMNGTGRVMHRNTGHDYGIMVHQGDVIGCLLDLDKGSISWSCNGKIFQRAFTIPDQLRGEAFLPAASLKDSRILFNFGEEQPLEFPPDGSFIPVAQSADDSQVSNRNPGWRMNQYDATNALDVAPDGSQVQSHFNQGWQGCRSNHGIRGLGRFYFEVTPIESTGLWRVGWSTDDGNLIVGTDQYGFGYGADNEGFGLNGQQGKRIHCDEIENYGEAFSKDDVIGCFLDTIEHTIKWSKNGLEFGDAYRIPSELLHSKNLTALYPTVSLLNSTLELNFGDKPFKYYPGPDWTPVCCAPPECTKRSRRKGPEV 950          
BLAST of Band 4.1 protein 2 vs. TrEMBL
Match: A0A3Q0KRX1 (Putative 4.1 G protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 717.613 bits (1851), Expect = 0.000e+0
Identity = 405/929 (43.60%), Postives = 564/929 (60.71%), Query Frame = 1
Query:  199 MGSTTSALRNSGNFSKSQSHTTLSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILG-----RPQPKVRRMQTQRKE-----------------------KETPLSPSGIAPCANNDEIFSLEESLDNAIERP--ELLEEYWQMSIDDST----------------------------PE------------MGIDPLGLDVAGNKGSGWQGSRANKGVKGPGKYYYEGKVVEDGLIRLGWATNDASLDLGSDKEGFGYGDSQAGDKN-GGFKRNCNKENG--YGQPIKEGDLIGCFLDFDNGNIQWSKNGATFEPAFKIPDELKDEAFFPASSIKDGRVIFNFGDE-PLSFLPKRDWLPVSQANENNVVPNKNIGWKMNPFDATTGTDVSGNGYTLQSKLNGEWNGCRANKGVFDCGKYYYEVIPLED-GLARVGWATXXXXXXXXXXXXXXXYGADNDGFGLKGNQGKKMNSGEIENYGDPFMKGDVIGCFLDLDNKYVKWSKNGQVYKEGYVLPDDLVE---LRAFYPTASLINNTLDFNFGNKPFEFYPGSEWNPLCYAAHGNTEKTKKRDPSLYSKPFTDREEDVLEIR-RQAREKFKRND-QLEEE 2745
            +G  +S+ R  G   +  SH ++ +              +KPSGK+  C V MLDGT   + +D A++GQ L D +C  L L E ++FGI Y D T   WFWL  D++I+ Q+GKN+W F+FQVKFYP  +D  +ED+T+Y+ CLQVRQDIV G LP SF  + +LG++ VQSEAGD DP+ H GI+Y++  PFAP  LQT E+L RI ELHK    +TPEEADR FL NA KL +YGVD+HKVK  Q +++++GVY+ GIL+YR RIR++R SWP+I+ L+++ ++F +  R  + +  +R + FKC S  LAKRL+  CV+HH FFR+  +  P+KP L P F TRKY YP +   S        AP  + G     RP  K R M     E                       +  P    G   C   D  +   +++ N +  P  E ++ Y+Q S +D T                            PE            +GID  GLDVA  +G+GWQG RANKGVK PG YYYE   +E+GLIR+GW+TNDA+L+LG+D  GFGYG    G     G  R  ++ +G  YG  + +GD+IGC LD D G+I WS NG  F  AF IPD+L+ EAF PA+S+KD R++FNFG+E PL F P   ++PV+Q+ +++ V N+N GW+MN +DAT   DV+ +G  +QS  N  W GCR+N G+   G++Y+EV P+E  GL RVGW+TDDG+L +G+D  GFGYGADN+GFGL G QGK+++  EIENYG+ F K DVIGCFLD     +KWSKNG  + + Y +P +L+    L A YPT SL+N+T++ NFG+KPF++YPG +W P+C A    T++++++ P    K ++  +  +LE   RQ  +  +R++ Q+E E
Sbjct:   38 LGGNSSSPRPGGGTLRGSSHPSIVD--------------FKPSGKIVDCTVVMLDGTTREFRLDKAAYGQQLLDAVCTHLGLLEVEFFGITYYDST-NNWFWLQTDQRIAKQIGKNEWQFEFQVKFYPCDIDSIKEDITRYYLCLQVRQDIVSGQLPCSFVTYCILGSYIVQSEAGDHDPSQHIGIKYIQDHPFAPHMLQTPEMLGRIVELHKLHRGKTPEEADRLFLNNARKLALYGVDLHKVKTSQGQDITLGVYYGGILLYRNRIRLMRISWPRIISLSHRGRNFIIARRPGD-DSLDRNMTFKCISPTLAKRLYNVCVDHHNFFRLRGSSRPKKPSLFPSFATRKYHYPGTTMNSSSI----DAPVGVDGHNQTSRPLSKFRPMPAHPSETGWFTFANRSEMDHMNGAVASQYQYQPAMVIGDPACM--DPTYFCNQNVINGLPIPNAEGVQRYYQPSNNDVTGLINGHHHNSNNNHINNMPTMITRISFEPEHWRITGADCTAGLGIDARGLDVASTRGAGWQGCRANKGVKAPGAYYYEAACLEEGLIRVGWSTNDANLELGADNYGFGYGSDAVGSAGINGTGRVMHRNSGHDYGIMVHQGDVIGCLLDLDKGSISWSCNGKIFRRAFTIPDQLRGEAFLPAASLKDSRILFNFGEEQPLEFPPDGPFIPVAQSADDSQVSNRNPGWRMNQYDATNALDVAPDGSQVQSHFNQGWQGCRSNHGIRGLGRFYFEVTPIESTGLWRVGWSTDDGNLIIGTDQYGFGYGADNEGFGLNGQQGKRIHCDEIENYGEAFSKDDVIGCFLDTIEHTIKWSKNGLEFGDAYQIPSELLHSKNLTALYPTVSLLNSTVELNFGDKPFKYYPGPDWTPVCCAPPECTKRSRRKGPERKVKGWSYIDPTILEPSIRQTMQSIERSEPQIETE 944          
BLAST of Band 4.1 protein 2 vs. TrEMBL
Match: A0A564Y785 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS3492 PE=4 SV=1)

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 389/915 (42.51%), Postives = 538/915 (58.80%), Query Frame = 1
Query:  136 DNGQIEEIHVIPKSEYYASLRMGSTTSALRN-------------SGNFSKSQSH--TTLSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKY--NDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILG---RPQPKVRRMQTQRKE----KETP-----LSPSGIAPCANNDEIFSL-----------EESLDNA---------------IERPELLEEYWQMSIDDSTPEMGIDPLGLDVAGNKGSGWQGSRANKGVKGPGKYYYEGKVVEDGLIRLGWATNDASLD-LGSDKEGFGYG---DSQAGDKNGGFKRNCNKENGYGQPIKEGDLIGCFLDFDNGNIQWSKNGATFEPAFKIPDELKDEAFFPASSIKDGRVIFNFG---DEPLSFLPKR-----DWLPVSQANENNVVPNKNIGWKMNPFDATTGTDVSGNGYTLQSKLNGEWNGCRANKGVFDCGKYYYEVIPLE-DGLARVGWATXXXXXXXXXXXXXXXYGADNDGFGLKGNQGKKMNSGEIENYGDPFMKGDVIGCFLDLDNKYVKWSKNGQVYKEGYVLPDDL----------VELR-AFYPTASLINNTLDFNFGNKPFEFYPGSEWNPLCYAAHGNTEKTKKRDP 2643
            + G IE    +PK EYY +LR   T    +              SG  +   S   +    R  T+ R N+  S +KPSGK   C V MLDG ++ + ID A++GQ LFD +C  LDL E  YFGIKY   D T+    WL MDKK++ Q+GKN W+F+FQVKF+P ++D   EDLT+YF CLQVRQ+++ G LP SF  +V+LG++ VQS+AGDFDP  HQGI Y+R  PFAP  LQ+ E+L RI+E H+    Q+PE ADR FL NA +L +YGV MHKV +    E  +GVY+ G+L+Y  RIR+ R SWP+I+KL+Y+ + F + +R+ + +++ER   F+C + + AK+LW  CVEHH+FFR+ D E  RKP ++PGF +RK+ Y      S L +     P I      RPQP +RRMQ QR++    ++ P      S    AP   +D                E ++D A                 RP    E W++S  D +  +GID  GLD+A    SGWQG RANKGVK PG YY+E  V+EDG + +GWATN+A+L  LG D + F  G   D Q+G       +  +   G    +  G +IGC LD D G   WS NG       +IP+ L +E FFPA+S+KD R++ NFG     PL + P        + P+++  E+  V N N GW++NP+DAT G +V  +G  LQ+     W GCRAN+GV   G++YYE   +E +GLAR+GW T+DG+L +G+D  GFGYG+D DGFGL   QGK+M++ EI+NYG+ F +GDVIGCFLDL  + ++W+KNG  + + Y LPD+           V LR AF+PT +L N+T++ NFG+  F ++PG +W PL Y A  N + T +  P
Sbjct:   59 NGGTIEVPDSVPKREYYTTLRRFGTMGPRQGSISGGSLLGGGVASGPVTAVGSPYPSATMGRTATLGRSNTSASNFKPSGKSVDCAVIMLDGLQQMFSIDKAAYGQQLFDAVCSNLDLLETDYFGIKYLAPDNTM---CWLKMDKKVAKQVGKN-WLFEFQVKFFPYNIDSIAEDLTRYFLCLQVRQNLLSGQLPCSFTSYVILGSYVVQSDAGDFDPQRHQGIAYIRDHPFAPNHLQSTEMLYRIAETHRLHHGQSPEMADRNFLTNAKRLALYGVHMHKVLSSSGVEHGLGVYYGGLLLYLSRIRLQRFSWPRIIKLSYRKRHFIMIVRSLDEDQSERTYAFRCATPQRAKQLWTLCVEHHSFFRLRDYERSRKPSVLPGFSSRKFTYNHPGMGSSLGDLTTCTPEIAPPPNQRPQPAIRRMQPQRRQPSSNEQAPAYGADASQYQYAPQIASDASLGAAGYSPERWGGGESAVDMAGGQYRHGPSGAGLEYQPRPVFKPESWRISTADRSRCLGIDDRGLDIAAQHDSGWQGCRANKGVKAPGCYYFEATVLEDGPVAVGWATNEATLSPLGCDDQAFVLGNVIDGQSGATLSFKGKESDFSEGNRIVVTRGTVIGCRLDLDRGVATWSCNGIECPQILRIPENLINEPFFPAASMKDSRLLLNFGGSNSPPLRYPPSSIAGSVGFQPLAEITEDAQVANSNCGWRLNPYDATAGVEVQPDGMALQAHWGSGWQGCRANRGVKGEGRFYYEARVIESNGLARIGWTTEDGNLLVGTDAFGFGYGSDADGFGLSCQQGKRMHNNEIDNYGESFGEGDVIGCFLDLIQRTIRWAKNGHPFGDAYRLPDNFATTLASNGSPVTLRVAFFPTVALNNSTVELNFGDSQFSYFPGPDWTPLSYVAPENLQITSRPGP 969          
BLAST of Band 4.1 protein 2 vs. Ensembl Cavefish
Match: epb41l3a (protein 4.1 [Source:NCBI gene;Acc:103040375])

HSP 1 Score: 246.514 bits (628), Expect = 3.651e-68
Identity = 144/349 (41.26%), Postives = 203/349 (58.17%), Query Frame = 1
Query:  313 VYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            V K    MQ C VT+LDG++    ++    GQ L D++C+ L+L ER YFGI + D   +   WL   K +  Q+    W F F VKFYPP      ED+T+Y+ CLQ+R D++ G LP SF    +LG++ VQSE GDFDP+ + G +Y+ +  FAP   QT EL  ++ +LHK     TP +A+  FL N  KL MYGVD+H  K+ +  E+ +GV  SG+LIYR R+RI R +WPK++K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK CVEHHTFFR+V  E P K  L  G    K+ Y           ++Q      + RP P   R  ++R
Sbjct:   87 VPKKPKNMQ-CKVTLLDGSDYTCVVEKRDKGQVLLDKVCEHLNLLERDYFGITFRDAENQ-KNWLDPSKDMKKQIRGVAWNFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDVLSGRLPCSFATHTVLGSYTVQSELGDFDPDEY-GTDYVSEFRFAPH--QTKELEEKVMDLHKNYKGMTPADAEMHFLENVKKLSMYGVDLHHAKDSEGVEIMLGVCSSGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPETPPKKFLTLG---SKFRYSGRTQVQTRRASSQ------IVRPAPYFERSTSKR 421          
BLAST of Band 4.1 protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000039790.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:7632957:7740250:1 gene:ENSAMXG00000003001.2 transcript:ENSAMXT00000039790.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.817 bits (621), Expect = 6.906e-68
Identity = 143/355 (40.28%), Postives = 206/355 (58.03%), Query Frame = 1
Query:  301 SLNSVYKPS--GKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            S  S  KPS   K  P  VT++D ++   +I+    GQ L D +C+ L+L E+ YFG+ + D   +   WL   K+I  Q+  + W F F VKFYPP      ED+T+Y+ CLQ+R D++ G LP SF    LLG++ VQ+E GD+D + H G +Y+  + FAP   QT EL  R+ ELH+     TP EA+  FL NA KL MYGVD+H  K+ +  ++ +GV  +G+LIYR R+RI R +WPKI+K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK C+EHHTFFR+V  E P K  L+ G    K+ Y                 + ++ RP P   R  ++R
Sbjct:   62 SPKSPNKPSKRSKTAPFKVTLMDSSDYEANIEKHCKGQALVDLVCEHLNLLEKDYFGLTFRDSDTQ-KNWLDPSKEIKKQMRTSPWHFAFAVKFYPPDPSQLMEDITRYYLCLQLRDDMLSGRLPCSFVTHALLGSYTVQAELGDYDQDEH-GSDYISDLRFAPN--QTRELEERVMELHRTYRGMTPAEAEMNFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRAAKRLWKVCIEHHTFFRLVSPEPPPKGFLVMG---SKFRYSGRTQAQTRQA------SALIDRPAPHFERSTSKR 403          
BLAST of Band 4.1 protein 2 vs. Ensembl Cavefish
Match: si:dkey-178k16.1 (band 4.1-like protein 1 [Source:NCBI gene;Acc:103040989])

HSP 1 Score: 246.514 bits (628), Expect = 9.697e-68
Identity = 143/347 (41.21%), Postives = 205/347 (59.08%), Query Frame = 1
Query:  331 KMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLE----FKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            K  P  V++LDG++    ++ A  GQ L D +C+ L+L E+ YFG+ + D T     WL   K+I  Q+    W F F VKFYPP      ED+T+Y+ CLQ+R+D++ G LP SF    LLG++AVQ+E GD+DP  H G +Y+ +  FAP   QT EL  R+ ELH+     +P EA+  FL NA KL MYGVD+H  K+ +  ++ +GV  SG+LIYR R+RI R +WPKI+K++YK  +F++ +R  E+ K   Q E    FK  +H+ +KRLWK C+EHHTFFR+V  E P K  L+ G    K+ Y                 + ++ RP P+  R  ++R
Sbjct:   59 KTVPVKVSLLDGSDYEVGVEKACKGQTLLDMVCEHLNLLEKDYFGLLFYD-TDSQKNWLDPSKEIKKQIRVGSWQFSFSVKFYPPDPSQLIEDITRYYLCLQLREDMLSGRLPCSFVTHALLGSYAVQAELGDYDPEEH-GPDYVSEFRFAPS--QTRELEERVMELHRTYRGMSPAEAEVNFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCASGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEVEKKYEQFESTIGFKLPNHRASKRLWKVCIEHHTFFRLVSPEPPPKGFLVIG---SKFRYSGRTQAQTRQA------SALIDRPAPQFERSISRR 392          
BLAST of Band 4.1 protein 2 vs. Ensembl Cavefish
Match: si:dkey-178k16.1 (band 4.1-like protein 1 [Source:NCBI gene;Acc:103040989])

HSP 1 Score: 246.514 bits (628), Expect = 1.092e-67
Identity = 143/347 (41.21%), Postives = 205/347 (59.08%), Query Frame = 1
Query:  331 KMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLE----FKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            K  P  V++LDG++    ++ A  GQ L D +C+ L+L E+ YFG+ + D T     WL   K+I  Q+    W F F VKFYPP      ED+T+Y+ CLQ+R+D++ G LP SF    LLG++AVQ+E GD+DP  H G +Y+ +  FAP   QT EL  R+ ELH+     +P EA+  FL NA KL MYGVD+H  K+ +  ++ +GV  SG+LIYR R+RI R +WPKI+K++YK  +F++ +R  E+ K   Q E    FK  +H+ +KRLWK C+EHHTFFR+V  E P K  L+ G    K+ Y                 + ++ RP P+  R  ++R
Sbjct:   59 KTVPVKVSLLDGSDYEVGVEKACKGQTLLDMVCEHLNLLEKDYFGLLFYD-TDSQKNWLDPSKEIKKQIRVGSWQFSFSVKFYPPDPSQLIEDITRYYLCLQLREDMLSGRLPCSFVTHALLGSYAVQAELGDYDPEEH-GPDYVSEFRFAPS--QTRELEERVMELHRTYRGMSPAEAEVNFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCASGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEVEKKYEQFESTIGFKLPNHRASKRLWKVCIEHHTFFRLVSPEPPPKGFLVIG---SKFRYSGRTQAQTRQA------SALIDRPAPQFERSISRR 392          
BLAST of Band 4.1 protein 2 vs. Ensembl Cavefish
Match: epb41l3a (protein 4.1 [Source:NCBI gene;Acc:103040375])

HSP 1 Score: 248.054 bits (632), Expect = 1.725e-67
Identity = 144/349 (41.26%), Postives = 203/349 (58.17%), Query Frame = 1
Query:  313 VYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            V K    MQ C VT+LDG++    ++    GQ L D++C+ L+L ER YFGI + D   +   WL   K +  Q+    W F F VKFYPP      ED+T+Y+ CLQ+R D++ G LP SF    +LG++ VQSE GDFDP+ + G +Y+ +  FAP   QT EL  ++ +LHK     TP +A+  FL N  KL MYGVD+H  K+ +  E+ +GV  SG+LIYR R+RI R +WPK++K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK CVEHHTFFR+V  E P K  L  G    K+ Y           ++Q      + RP P   R  ++R
Sbjct:   87 VPKKPKNMQ-CKVTLLDGSDYTCVVEKRDKGQVLLDKVCEHLNLLERDYFGITFRDAENQ-KNWLDPSKDMKKQIRGVAWNFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDVLSGRLPCSFATHTVLGSYTVQSELGDFDPDEY-GTDYVSEFRFAPH--QTKELEEKVMDLHKNYKGMTPADAEMHFLENVKKLSMYGVDLHHAKDSEGVEIMLGVCSSGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPETPPKKFLTLG---SKFRYSGRTQVQTRRASSQ------IVRPAPYFERSTSKR 421          
BLAST of Band 4.1 protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001599.1 (pep scaffold:Pmarinus_7.0:GL478896:2253:11647:-1 gene:ENSPMAG00000001443.1 transcript:ENSPMAT00000001599.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 173.326 bits (438), Expect = 2.394e-49
Identity = 89/198 (44.95%), Postives = 122/198 (61.62%), Query Frame = 1
Query:  340 PCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVK 933
            PC+V++LDG+    D+D  + GQ LFD +C+ L+L E+ YFG+ Y D T +   WL  +K+I  Q+    W F F  KFYPP      ED+T+Y+ CLQ+R+D+  G LP SF    +LG++A+Q+E GD +P+ H G  Y  +  FAP   QT EL  ++ ELHK     TP EAD  FL NA KL MYGVD+H  +
Sbjct:   27 PCSVSLLDGSVFPCDVDKQAKGQVLFDLVCEHLNLLEKDYFGLNYRDNTEQK-NWLDPNKEIKRQVRAGAWTFIFNTKFYPPDPAQLTEDITRYYICLQLREDVASGRLPCSFVTHAVLGSYALQAELGDHEPDEH-GPGYASEFRFAPN--QTPELEDKVVELHKTHRNMTPAEADLHFLENAKKLSMYGVDLHHAR 220          
BLAST of Band 4.1 protein 2 vs. Ensembl Sea Lamprey
Match: EPB41L2 (erythrocyte membrane protein band 4.1 like 2 [Source:HGNC Symbol;Acc:HGNC:3379])

HSP 1 Score: 181.415 bits (459), Expect = 2.867e-48
Identity = 117/332 (35.24%), Postives = 178/332 (53.61%), Query Frame = 1
Query:  403 GQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADR--------AFLWNAMKLGMYGVDM----HKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQRK 1362
            G  LF R+C+ L+L ER YF + Y D + +   WL   K+I  QL  + W+  F VKFYPP      ED+++Y+ CLQ+R+D+  G LP    +  LLG++A+Q+E GD+D   H G  Y  +   AP   QT EL  R++ELH      +P +A          AF  +    G +  +         + +  ++ +GV  +G+L+YR  +RI R +WPKI+K++Y+  +FF+ +R  E  K E  + FK  SH+ AKRLWK CVEHHTFFRM   E  R+ + +   G+R + Y           + +      +GRP P   R+ ++R+
Sbjct:   11 GHELFHRVCEHLNLLERDYFSLTYKDASDQK-NWLDPIKEIKKQLMHSPWLVSFNVKFYPPDPSHLLEDISRYYLCLQLREDVARGRLPCLPVVHALLGSYALQAELGDYDAAEH-GAGYADRFQLAPN--QTHELQDRMAELHAAHRCVSPRKASSRSGEDSRDAFRVSLEPTGAFAHNAAFSPQCHPDSEGVDIKLGVCANGLLVYRDHLRINRFAWPKILKISYRRSNFFIKVRPGEFEKCESNVGFKLPSHRAAKRLWKTCVEHHTFFRMAVPEPTRRARFM-SLGSR-FRYSGRTQAQTRQASAR------IGRPGPPFVRVSSRRQ 330          
BLAST of Band 4.1 protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001312.1 (pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 gene:ENSPMAG00000001156.1 transcript:ENSPMAT00000001312.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 179.104 bits (453), Expect = 3.937e-46
Identity = 106/290 (36.55%), Postives = 162/290 (55.86%), Query Frame = 1
Query:  343 CNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQ-WVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQ-VGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENP 1206
            C++ +LD T      + +  G+ L D +   LDL E  YFG+++ D +     WL   K +  Q+ ++  ++F+F+VKF+       +E+ T+Y + LQ+R DI+E  LP   N   LL ++ VQSE GD+    H    YL  + F P+  Q  +    +++LHKQ VGM TP +A+  +L  A  +  YGV++H  ++Q N E+ VGV   G+ +Y   +RI    W KIVK+ +K K FF+ LR  +    E  + F  G+++  K LWKACVEHHTFFRM    +P
Sbjct:   31 CHINLLDNTAITLRANKSEAGKALLDAVFAHLDLAETDYFGLQFADDSTETPRWLDPTKPLRKQIKRSSPYIFNFRVKFFVTDPSKLQEEYTRYHYFLQLRNDILEARLPCPHNTAALLASYIVQSELGDYSETEHLP-GYLSDLRFLPR--QGLDFEKEVAKLHKQHVGM-TPADAEFNYLNVAKNVEFYGVELHYARDQSNVEIMVGVTAGGVNVYNNGVRISNFPWIKIVKIFFKLKHFFVQLRKEQNETRENIIGFNLGNYRACKTLWKACVEHHTFFRMARPASP 316          
BLAST of Band 4.1 protein 2 vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 144.436 bits (363), Expect = 1.585e-37
Identity = 95/267 (35.58%), Postives = 142/267 (53.18%), Query Frame = 1
Query:  397 SFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQ-WVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRA--TEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRM 1188
            + GQ LFD++   LD+ E  YFG+++ D + ++  WL   K I  Q+     + F  +VKFY    ++  E+LT+Y F LQ++QDI+ G L   F   V L  +++Q+E GD DP  H     + +  F P   Q++E+   I E  K    QTP +A+  +L  A  L MYGVDMH VK +   E S+G+  +G+L++ G  +I    WPKI +L +K     L +     +  + E    F+    K  K LWK  VEHH FFR+
Sbjct:    3 AVGQDLFDQVMYHLDILEVDYFGLQFMD-SAQVSHWLDHTKNIRKQVKIGPPYCFHMRVKFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFETAVQLATYSLQAELGDCDPVEHNPA-LVSEFRFIPS--QSEEMEEAILEKWKDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGVLVFEGENKIGLFFWPKITRLDFKRTKLTLVVVEDDDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRL 265          
BLAST of Band 4.1 protein 2 vs. Ensembl Sea Lamprey
Match: epb41l5 (erythrocyte membrane protein band 4.1 like 5 [Source:ZFIN;Acc:ZDB-GENE-030616-450])

HSP 1 Score: 144.05 bits (362), Expect = 2.274e-37
Identity = 95/267 (35.58%), Postives = 142/267 (53.18%), Query Frame = 1
Query:  397 SFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQ-WVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRA--TEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRM 1188
            + GQ LFD++   LD+ E  YFG+++ D + ++  WL   K I  Q+     + F  +VKFY    ++  E+LT+Y F LQ++QDI+ G L   F   V L  +++Q+E GD DP  H     + +  F P   Q++E+   I E  K    QTP +A+  +L  A  L MYGVDMH VK +   E S+G+  +G+L++ G  +I    WPKI +L +K     L +     +  + E    F+    K  K LWK  VEHH FFR+
Sbjct:    3 AVGQDLFDQVMYHLDILEVDYFGLQFMD-SAQVSHWLDHTKNIRKQVKIGPPYCFHMRVKFYSSEPNNLHEELTRYLFVLQLKQDILSGKLECPFETAVQLATYSLQAELGDCDPVEHNP-ALVSEFRFIPS--QSEEMEEAILEKWKDCRGQTPAQAELNYLNKAKWLEMYGVDMHSVKGRDGNEYSLGLTPTGVLVFEGENKIGLFFWPKITRLDFKRTKLTLVVVEDDDQAKEQEHTFVFRLDHPKACKHLWKCAVEHHAFFRL 265          
BLAST of Band 4.1 protein 2 vs. Ensembl Nematostella
Match: EDO36130 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJJ3])

HSP 1 Score: 197.978 bits (502), Expect = 1.919e-56
Identity = 113/268 (42.16%), Postives = 165/268 (61.57%), Query Frame = 1
Query:  403 GQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENP 1206
            G  L   + + L+L+E++YFG+ Y+ K  +  +WL   K+I  QL  N   F+  VKFY P+    + D+T+Y   LQVR DI+   LP SF    LLG++ VQSE GD+DP+ H+G  YL  + F+P   Q+ EL+ RI ELHK+    TPEEAD  +L  A KL MYGVD H  ++   +E+ VGV ++G+L+++  +R  +  WPK+V L+YK + F +  R  E+ +    + FK  + K AKRL+K+CVEHHTFFR+   + P
Sbjct:    7 GIDLMVAVAEHLNLDEKEYFGLLYDHKGEK--YWLDPQKEIKKQLKGNLPHFELAVKFYEPYPSKLKHDMTRYMMVLQVRDDIICERLPCSFGAQALLGSYVVQSEFGDYDPHEHKG-NYLAGLVFSPN--QSHELVERIKELHKEHRGLTPEEADTQYLEAARKLTMYGVDAHPARDGNGDEVLVGVSYAGVLVFKDDLRQNKFPWPKVVYLSYKGRDFSVKSRPGELEELTTTMTFKLPTEKAAKRLYKSCVEHHTFFRLSFPDPP 269          
BLAST of Band 4.1 protein 2 vs. Ensembl Nematostella
Match: EDO30224 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1E3])

HSP 1 Score: 194.512 bits (493), Expect = 5.164e-54
Identity = 111/293 (37.88%), Postives = 174/293 (59.39%), Query Frame = 1
Query:  328 GKMQPCNVTM-LDGTEENYD--IDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELH-KQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQ--LEFKCGSHKLAKRLWKACVEHHTFFRM 1188
            G+ +  N T+ + G + +Y+  ID  + G HLFD++CD + L E++YFG++Y D+    + WL  D+ I  Q+GK    F F VKFYP +     ED+T+Y F LQ+R+D+++G +  S  I  LL ++ +Q+E GD  P  H+ + YL  + F PK  Q  EL  +I   H K VGM TP +A+  +L N  KL +YG DM++    + + +++ +   G+ +++   ++ R  WPKI+ + +K K F L LRA   +   +   + FKCGS + AKR+WK CVEHH FFR+
Sbjct:    2 GRKKSFNCTVQVAGLDSDYECPIDKTTKGDHLFDQVCDHIGLAEKEYFGLRYIDEKDGQFNWLEGDRSIKRQMGKAPLHFYFAVKFYPENPTTLREDITRYQFVLQLREDLLKGRIQCSNPIHALLASYVMQAELGDLHPEEHE-VAYLSDLKFFPK--QPPELRQKIEAFHRKHVGM-TPSDAEFQYLDNVRKLPLYGRDMYQAWGDEGQAVTIAISAWGVEVFQNNRQMHRFVWPKIISIGFKSKKFSLTLRAPSEDDYYKSTTIYFKCGSQRAAKRVWKVCVEHHAFFRL 290          
BLAST of Band 4.1 protein 2 vs. Ensembl Nematostella
Match: EDO34391 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPH7])

HSP 1 Score: 152.91 bits (385), Expect = 3.576e-41
Identity = 96/283 (33.92%), Postives = 159/283 (56.18%), Query Frame = 1
Query:  349 VTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLG--KNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLE--FKCGSHKLAKRLWKACVEHHTFFR 1185
            +++LD TE   +    + GQ +FD +C  LDL E+ YFG++Y D + +   WL + K +  Q+   K  +   F+VKFY        E++T+Y   LQ+++DI+ G L  S+N    LGA+ VQ+E GD+DP + +   Y+ +    PK  Q+++L  +I+++H+ +  Q P  A++ FL     L MYGVD H  K+Q N +L +G+  +GI I R   ++    W +I+K +Y+ K F++     +++K +R+    F+       K LWK  VEHH F+R
Sbjct:   18 ISLLDDTELTCEFRRDAKGQTVFDTVCKALDLVEKDYFGLRYVDDS-KQRHWLDLSKSVIKQMKSLKPPFKLFFRVKFYALDPGLIHEEITRYQCFLQIKRDILHGRLLCSYNELAELGAYIVQAELGDYDPEDQED-NYVSEFRIVPK--QSEKLENKIADIHRSLSGQVPSVAEKNFLDKVKSLDMYGVDPHPCKDQDNVQLYLGLTPTGIAIIRDGKKVSGFEWAQIIKCSYEGKVFYV-----QVHKDDRKANYGFRLPDPLACKHLWKCAVEHHAFYR 291          
BLAST of Band 4.1 protein 2 vs. Ensembl Nematostella
Match: EDO44823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUW8])

HSP 1 Score: 162.54 bits (410), Expect = 9.374e-41
Identity = 113/351 (32.19%), Postives = 177/351 (50.43%), Query Frame = 1
Query:  343 CNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWF------WLAMDKKISDQL-GKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQRKEKET 1374
            C V +LD +E   D+D  + G  L + +   LD+ E+ YFG++Y   +           WL  DK I  Q  G   ++F F V+F+        EDLT+Y+F LQ+++DI+ G LP  ++    L ++ +Q+E GD+DP  H    Y+ +  F P   QTD+   R +E HK    QTP +A+  FL  A  L +YGVD+H  K+    +L +GV   G+ +Y  + +I    W KIVK+ +K K FF+ +R       +  + F+  +++  K LWK CVE+H+F+R    +   K  L  G    KY Y        +  +   A      RP+PK+ R  ++R  K +
Sbjct:   37 CVVELLDDSEFIIDVDKNAKGTVLLNEVFRHLDIQEKHYFGLQYVSDSPDNMVGGAKEQWLQDDKIIRKQKKGTPPYIFYFCVRFFVSDPSKLVEDLTRYYFYLQIKRDILTGRLPCLYDTAAELSSYILQAELGDYDPKLHLD-GYVSEFRFIPD--QTDDFEERAAEFHKHHIGQTPADAEFNFLEVAKTLDLYGVDLHCAKDHDGTDLFLGVSALGLTVYHNKCKINFFPWSKIVKVCFKRKRFFIQIRPDWNEWTDNIIGFQMLTYRSCKNLWKVCVEYHSFYRTHYPKATEKRVLRMG---SKYRYKGKTEYQAIEESRTHA------RPEPKIVRTLSRRYSKRS 375          
BLAST of Band 4.1 protein 2 vs. Ensembl Nematostella
Match: EDO32045 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW61])

HSP 1 Score: 141.354 bits (355), Expect = 3.428e-37
Identity = 94/282 (33.33%), Postives = 153/282 (54.26%), Query Frame = 1
Query:  343 CNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQ-WVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFR 1185
            C++ +LD +E   +I  ++ G  + +++ D L+L ER YFG+++ +K  +   WL   K ++ QL     ++  F VKFY    +   E+LT+Y F LQV++DI +G  P   +   L+ +  + +E GDFD  ++    Y+ +  F PK  QT++L  +IS+ HK++    P  A+  +L  A  L MYGVD+H VK +   E  V +  +G+++Y  +  +  + W KI K+ +K K F L ++  E    E    F   +    K LWK CVEHH FFR
Sbjct:   13 CHIVLLDESEFPIEITKSTKGFEVLEKVFDHLNLLERDYFGLRFIEKNTQSR-WLDPMKSVTKQLKAGPPYLMYFCVKFYAADPNKLHEELTRYLFFLQVKRDIFQGSAPCEIHADTLISSFILLAELGDFDYQSYTP-GYVSEFRFVPK--QTEDLEEKISDCHKRLIGVVPSVAEYMYLDKAKWLEMYGVDLHLVKGEDGVEYFVALKPAGVVVYHNKTAVGTYLWQKITKIDFKGKKFSLNVQGKE--DREYVYVFYLPNKSACKHLWKCCVEHHAFFR 288          
BLAST of Band 4.1 protein 2 vs. Ensembl Medaka
Match: epb41l3b (erythrocyte membrane protein band 4.1 like 3 [Source:NCBI gene;Acc:101175596])

HSP 1 Score: 252.292 bits (643), Expect = 4.939e-71
Identity = 150/365 (41.10%), Postives = 211/365 (57.81%), Query Frame = 1
Query:  331 KMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQRKEKETPLSPSGIAPCANNDEIF 1425
            K+  C V +LDG++   D++  + GQ LF +IC+ L+L E+ YFGI Y D   +   WL   K++  Q+    W F F VKFYPP      ED+T+Y+ CLQ+R D+V G LP SF    +LG++ VQSE GD+DP      +Y+ ++  AP   QT EL  ++ ELHK     TP EA+  FL NA KL MYGVD+H  K+ +  E+ +GV  SG+LIYR ++RI R +WPKI+K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK CVEHHTFFR+V  E P+K  L  G    K+ Y           ++Q    II  RP P   R  ++R      L  + IA   N+D + 
Sbjct:   80 KIMQCKVALLDGSDYTVDVEKRAKGQILFSKICEHLNLLEKDYFGITYRDIENQ-KNWLDPSKELKKQIRNGPWNFAFNVKFYPPDPSQLSEDITRYYLCLQLRDDVVSGRLPCSFATHTVLGSYTVQSELGDYDPE-EMASDYVSELRLAPN--QTKELEEKVMELHKTYKGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDKLRINRFAWPKILKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPEAPQKKFLSLG---SKFRYSGRTQAQTRRASSQ----II--RPAPFFERTSSKRYNMSRSLDGATIA--ENHDTLM 429          
BLAST of Band 4.1 protein 2 vs. Ensembl Medaka
Match: epb41l3b (erythrocyte membrane protein band 4.1 like 3 [Source:NCBI gene;Acc:101175596])

HSP 1 Score: 251.906 bits (642), Expect = 8.207e-71
Identity = 145/343 (42.27%), Postives = 202/343 (58.89%), Query Frame = 1
Query:  331 KMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            K+  C V +LDG++   D++  + GQ LF +IC+ L+L E+ YFGI Y D       WL   K++  Q+    W F F VKFYPP      ED+T+Y+ CLQ+R D+V G LP SF    +LG++ VQSE GD+DP      +Y+ ++  AP   QT EL  ++ ELHK     TP EA+  FL NA KL MYGVD+H  K+ +  E+ +GV  SG+LIYR ++RI R +WPKI+K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK CVEHHTFFR+V  E P+K  L  G    K+ Y           ++Q    II  RP P   R  ++R
Sbjct:   80 KIMQCKVALLDGSDYTVDVEKRAKGQILFSKICEHLNLLEKDYFGITYRD-IENQKNWLDPSKELKKQIRNGPWNFAFNVKFYPPDPSQLSEDITRYYLCLQLRDDVVSGRLPCSFATHTVLGSYTVQSELGDYDPE-EMASDYVSELRLAPN--QTKELEEKVMELHKTYKGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDKLRINRFAWPKILKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPEAPQKKFLSLG---SKFRYSGRTQAQTRRASSQ----II--RPAPFFERTSSKR 409          
BLAST of Band 4.1 protein 2 vs. Ensembl Medaka
Match: epb41l3b (erythrocyte membrane protein band 4.1 like 3 [Source:NCBI gene;Acc:101175596])

HSP 1 Score: 252.292 bits (643), Expect = 8.513e-71
Identity = 145/343 (42.27%), Postives = 202/343 (58.89%), Query Frame = 1
Query:  331 KMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            K+  C V +LDG++   D++  + GQ LF +IC+ L+L E+ YFGI Y D       WL   K++  Q+    W F F VKFYPP      ED+T+Y+ CLQ+R D+V G LP SF    +LG++ VQSE GD+DP      +Y+ ++  AP   QT EL  ++ ELHK     TP EA+  FL NA KL MYGVD+H  K+ +  E+ +GV  SG+LIYR ++RI R +WPKI+K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK CVEHHTFFR+V  E P+K  L  G    K+ Y           ++Q    II  RP P   R  ++R
Sbjct:   80 KIMQCKVALLDGSDYTVDVEKRAKGQILFSKICEHLNLLEKDYFGITYRD-IENQKNWLDPSKELKKQIRNGPWNFAFNVKFYPPDPSQLSEDITRYYLCLQLRDDVVSGRLPCSFATHTVLGSYTVQSELGDYDPE-EMASDYVSELRLAPN--QTKELEEKVMELHKTYKGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDKLRINRFAWPKILKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPEAPQKKFLSLG---SKFRYSGRTQAQTRRASSQ----II--RPAPFFERTSSKR 409          
BLAST of Band 4.1 protein 2 vs. Ensembl Medaka
Match: epb41l3b (erythrocyte membrane protein band 4.1 like 3 [Source:NCBI gene;Acc:101175596])

HSP 1 Score: 252.292 bits (643), Expect = 1.611e-70
Identity = 145/343 (42.27%), Postives = 202/343 (58.89%), Query Frame = 1
Query:  331 KMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            K+  C V +LDG++   D++  + GQ LF +IC+ L+L E+ YFGI Y D       WL   K++  Q+    W F F VKFYPP      ED+T+Y+ CLQ+R D+V G LP SF    +LG++ VQSE GD+DP      +Y+ ++  AP   QT EL  ++ ELHK     TP EA+  FL NA KL MYGVD+H  K+ +  E+ +GV  SG+LIYR ++RI R +WPKI+K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK CVEHHTFFR+V  E P+K  L  G    K+ Y           ++Q    II  RP P   R  ++R
Sbjct:   80 KIMQCKVALLDGSDYTVDVEKRAKGQILFSKICEHLNLLEKDYFGITYRD-IENQKNWLDPSKELKKQIRNGPWNFAFNVKFYPPDPSQLSEDITRYYLCLQLRDDVVSGRLPCSFATHTVLGSYTVQSELGDYDPE-EMASDYVSELRLAPN--QTKELEEKVMELHKTYKGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDKLRINRFAWPKILKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPEAPQKKFLSLG---SKFRYSGRTQAQTRRASSQ----II--RPAPFFERTSSKR 409          
BLAST of Band 4.1 protein 2 vs. Ensembl Medaka
Match: epb41l3b (erythrocyte membrane protein band 4.1 like 3 [Source:NCBI gene;Acc:101175596])

HSP 1 Score: 251.906 bits (642), Expect = 1.657e-70
Identity = 145/343 (42.27%), Postives = 202/343 (58.89%), Query Frame = 1
Query:  331 KMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQR 1359
            K+  C V +LDG++   D++  + GQ LF +IC+ L+L E+ YFGI Y D       WL   K++  Q+    W F F VKFYPP      ED+T+Y+ CLQ+R D+V G LP SF    +LG++ VQSE GD+DP      +Y+ ++  AP   QT EL  ++ ELHK     TP EA+  FL NA KL MYGVD+H  K+ +  E+ +GV  SG+LIYR ++RI R +WPKI+K++YK  +F++ +R  E  + E  + FK  +H+ AKRLWK CVEHHTFFR+V  E P+K  L  G    K+ Y           ++Q    II  RP P   R  ++R
Sbjct:   80 KIMQCKVALLDGSDYTVDVEKRAKGQILFSKICEHLNLLEKDYFGITYRD-IENQKNWLDPSKELKKQIRNGPWNFAFNVKFYPPDPSQLSEDITRYYLCLQLRDDVVSGRLPCSFATHTVLGSYTVQSELGDYDPE-EMASDYVSELRLAPN--QTKELEEKVMELHKTYKGMTPAEAEMHFLENAKKLSMYGVDLHHAKDSEGVEIMLGVCASGLLIYRDKLRINRFAWPKILKISYKRNNFYIKIRPGEFEQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPEAPQKKFLSLG---SKFRYSGRTQAQTRRASSQ----II--RPAPFFERTSSKR 409          
BLAST of Band 4.1 protein 2 vs. Planmine SMEST
Match: SMESG000062476.1 (SMESG000062476.1)

HSP 1 Score: 1893.24 bits (4903), Expect = 0.000e+0
Identity = 1069/1075 (99.44%), Postives = 1073/1075 (99.81%), Query Frame = 1
Query:   85 MSSNNLTLDKKVQRRELDNGQIEEIHVIPKSEYYASLRMGSTTSALRNSGNFSKSQSHTTLSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQRKEKETPLSPSGIAPCANNDEIFSLEESLDNAIERPELLEEYWQMSIDDSTPEMGIDPLGLDVAGNKGSGWQGSRANKGVKGPGKYYYEGKVVEDGLIRLGWATNDASLDLGSDKEGFGYGDSQAGDKNGGFKRNCNKENGYGQPIKEGDLIGCFLDFDNGNIQWSKNGATFEPAFKIPDELKDEAFFPASSIKDGRVIFNFGDEPLSFLPKRDWLPVSQANENNVVPNKNIGWKMNPFDATTGTDVSGNGYTLQSKLNGEWNGCRANKGVFDCGKYYYEVIPLEDGLARVGWATXXXXXXXXXXXXXXXYGADNDGFGLKGNQGKKMNSGEIENYGDPFMKGDVIGCFLDLDNKYVKWSKNGQVYKEGYVLPDDLVELRAFYPTASLINNTLDFNFGNKPFEFYPGSEWNPLCYAAHGNTEKTKKRDPSLYSKPFTDREEDVLEIRRQAREKFKRNDQLEEERKLNSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTKEKQETEESYQIVEKGDPEITTETYVDELGXXXXXXXXXXXXXXXXXXXXXXXERTEDEINTSKVAKLRGIGIVSYYXXXXXXXXLIKAILSVTKFNQNVRVLQDEHFLPTSSV 3309
            MSSNNLTLDKKVQRRELDNGQIEEIHVIPKSEYYASLRMGSTTSALRNSGNFSKSQSHTTLSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSGILIYRGRIRIIRHSWPKIVKLTYKHKSF+LFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYPSSPSPS+ NNNNQSAPNIILGRPQPKVRRMQTQRKEKETPLSPSGIAPCANNDEIFSLEESLDNAIERPELLEEYWQMSIDDSTPEMGIDPLGLDVAGNKGSGWQGSRANKGVKGPGKYYYEGKVVEDGLIRLGWATNDASLDLGSDKEGFGYGDSQAGDKNGGFKRNCNKENGYGQPIKEGDLIGCFLDFDNGNIQWSKNGATFEPAFKIPDELKDEAFFPASSIKDGRVIFNFGDEPLSFLPKRDWLPVSQANENNVVPNKNIGW+MNPFDATTGTDVSGNGYTLQSKLNGEWNGCRANKGVFDCGKYYYEVIPLEDGLARVGWATDDGSLNLGSDGSGFGYGADNDGFGLKGNQGKKMNSGEI+NYGDPFMKGDVIGCFLDLDNKYVKWSKNGQVYKEGYVLPDDLVELRAFYPTASLINNTLDFNFGNKPFEFYPGSEWNPLCYAAHGNTEKTKKRDPSLYSKPFTDREEDVLEIRRQAREKFKRNDQLEEERKLNSIKEKERIEKQEKERRILLQKERDEEERRRKELEREEYER QKELEELERQRQREIEIRQNEERQRLLNTKEKQETEESYQIVEKGDPEITTETYVDELGRTVTRTVKKTKIKTTTNLNRNTIERTEDEINTSKVAKLRGIGIVSYYEDDDDDEELIKAILSVTKFNQNVRVLQDEHFLPTSSV
Sbjct:    1 MSSNNLTLDKKVQRRELDNGQIEEIHVIPKSEYYASLRMGSTTSALRNSGNFSKSQSHTTLSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSGILIYRGRIRIIRHSWPKIVKLTYKHKSFYLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYPSSPSPSLFNNNNQSAPNIILGRPQPKVRRMQTQRKEKETPLSPSGIAPCANNDEIFSLEESLDNAIERPELLEEYWQMSIDDSTPEMGIDPLGLDVAGNKGSGWQGSRANKGVKGPGKYYYEGKVVEDGLIRLGWATNDASLDLGSDKEGFGYGDSQAGDKNGGFKRNCNKENGYGQPIKEGDLIGCFLDFDNGNIQWSKNGATFEPAFKIPDELKDEAFFPASSIKDGRVIFNFGDEPLSFLPKRDWLPVSQANENNVVPNKNIGWRMNPFDATTGTDVSGNGYTLQSKLNGEWNGCRANKGVFDCGKYYYEVIPLEDGLARVGWATDDGSLNLGSDGSGFGYGADNDGFGLKGNQGKKMNSGEIDNYGDPFMKGDVIGCFLDLDNKYVKWSKNGQVYKEGYVLPDDLVELRAFYPTASLINNTLDFNFGNKPFEFYPGSEWNPLCYAAHGNTEKTKKRDPSLYSKPFTDREEDVLEIRRQAREKFKRNDQLEEERKLNSIKEKERIEKQEKERRILLQKERDEEERRRKELEREEYERRQKELEELERQRQREIEIRQNEERQRLLNTKEKQETEESYQIVEKGDPEITTETYVDELGRTVTRTVKKTKIKTTTNLNRNTIERTEDEINTSKVAKLRGIGIVSYYEDDDDDEELIKAILSVTKFNQNVRVLQDEHFLPTSSV 1075          
BLAST of Band 4.1 protein 2 vs. Planmine SMEST
Match: SMESG000019493.1 (SMESG000019493.1)

HSP 1 Score: 763.837 bits (1971), Expect = 0.000e+0
Identity = 418/893 (46.81%), Postives = 562/893 (62.93%), Query Frame = 1
Query:   91 SNNLTLDKKVQRRELDNGQIEEIHVIPKSEYYASLR-----MGSTTSALRNSGNFSKSQSHTTLSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYXXXXXXXXXXXXXQSAPNIILGRPQPKVRRMQTQRKE------------------KETPLSPSGIAPCANNDEIFSLEESLDNAI--------ERPELLEEYWQMSIDDSTPEMGIDPLGLDVAGNKGSGWQGSRANKGVKGPGKYYYEGKVVEDGLIRLGWATNDASLDLGSDKEGFGYGDSQAGDKNGGFKRNC----NKENGYGQPIKEGDLIGCFLDFDNGNIQWSKNGATFEPAFKIPDELKDEAFFPASSIKDGRVIFNFGDEPLSFLP--KRDWLPVSQANENNVVPNKNIGWKMNPFDATTGTDVSGNGYTLQSKLNGEWNGCRANKGVFDCGKYYYEVIPLED-GLARVGWATXXXXXXXXXXXXXXXYGADNDGFGLKGNQGKKMNSGEIENYGDPFMKGDVIGCFLDLDNKYVKWSKNGQVYKEGYVLPDDLVELR----AFYPTASLINNTLDFNFGNKPFEFYPGSEWNPLCYAAHGNTEKTKKRDP 2643
            S N   +   Q   L++G IE    +PK +YY SLR     +G + S +    N        TL + Y   K ++ L+  +KPSGK+  C V MLDGTEE + ID ASFGQHLFD +CD L+LNER+YFGI Y D+  +I FWL   KKI+  +  N+ VF+FQVKFYPP +    EDLT+Y+  LQVRQD+V G LP SF ++ +L ++ +QSEAGD+DP  H+GIEY++  P AP+  QT + + ++  LHK    QTPEEAD+ FL NA KL +YG+DMHKVKN + EE+ +GVY+ GI++YR ++R+IR SW ++++++YK K   + +R    N  +++L FKC   KL K+ +KA V+HH FFRM++   P+KP L PGF TRKY    + +            N     P PK++R+   RKE                  K   L+ S I    N+    ++++   N I        ERP L   +W+MS  D T  +G+D  GLDVA   G+GWQG R+NKGVK PG+Y+YE +V+EDGL+RLGW+TNDASL +GSD+ G+GYG  + G   G   + C    +K   YG  +  GD +GC ++ +NG++ W KNG +    +KIP++L+ E  FP  S+KDGR+ FNFGD P  + P     W+PV QANE   VPNK+IGWK+N +DAT   D+S  G   QS++N EW G R NKGV   GKYYYEV PLE  GLARVGW+T+ GSL+LG+D  GFGYGAD DGFGL GNQGKKM + +IENYG  F KGDVIGCFLDLD   V+WS NG++Y   Y +P   +ELR    AF+P  SL NNT +FNFG K F+FYPG+EW PL Y      ++++++ P
Sbjct:   20 SINFHTESTSQVNRLEDGTIEITDTLPKKDYYMSLRKSDNRLGGSMSRIGGGSNAGFGTMTGTLRSGYNA-KSQSILD--FKPSGKLMECLVIMLDGTEEVFTIDRASFGQHLFDAVCDHLELNEREYFGISYKDR-CKIMFWLDFTKKITKHVPDNRLVFEFQVKFYPPEISMVVEDLTRYYLSLQVRQDLVCGKLPCSFYVYTILASYVIQSEAGDYDPQAHRGIEYIKSQPLAPQKFQTQDFMEKVVALHKLHRGQTPEEADKNFLDNARKLALYGLDMHKVKNSEGEEIMLGVYYGGIVLYRQKVRVIRFSWARLIQVSYKKKKLIITVRGVNKNDNKKELTFKCTDLKLTKKAYKAVVDHHYFFRMIEFGIPKKPNLQPGFHTRKYYKTPTSASPTAGGEFTYDRN-----PAPKIKRLPPPRKEQTDDGWYTLPSKNGTASKKGVVLNNSSIESNENHSTQLNIQKPNQNKISKTPLTDTERPTLPNLHWRMSPADCTLSLGMDDKGLDVASQPGTGWQGCRSNKGVKTPGEYFYEARVLEDGLVRLGWSTNDASLKVGSDENGYGYGADEVGRGWGENVKGCTMHDSKIKDYGSGLFMGDYVGCRVNLNNGDVVWYKNGESMGVGYKIPEQLRKEPMFPTLSVKDGRIEFNFGDSPFVYPPSDSETWIPVCQANEITEVPNKHIGWKLNAYDATKLIDISAEGLMAQSQMNAEWQGSRCNKGVKGRGKYYYEVSPLESGGLARVGWSTEAGSLDLGTDKCGFGYGADPDGFGLSGNQGKKMFNNDIENYGKSFNKGDVIGCFLDLDEGKVQWSLNGEIYAPAYDIP---LELRNGPSAFFPAVSLKNNTAEFNFGEKAFKFYPGNEWTPLTYTPEQFLKESRRKGP 900          
BLAST of Band 4.1 protein 2 vs. Planmine SMEST
Match: SMESG000029732.1 (SMESG000029732.1)

HSP 1 Score: 250.751 bits (639), Expect = 2.056e-68
Identity = 139/307 (45.28%), Postives = 199/307 (64.82%), Query Frame = 1
Query:  343 CNVTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLGK-NQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQ-GIEYLRKMPFAPKALQTDELLLRISELHKQ-VGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLY 1254
             ++ +LDG E  +D+D    G++LFD +C  LDL E+ +FG+ Y +  L+ WFWL MDKKIS QL   + W F+FQVKFYPP     +ED+T+Y   LQVRQD+  G LP S+    LLG+  VQSE GDFD   H+ GI+YLR+  F     Q+D+LL +I+ELHK+ +GM +P++AD  +L  A +L  YGVD+H  ++  + E+ +GV + G+LIYR RIRI R +WPK+++++YK   F+L +R+   + +   + FK  +H LAKRLWK  VE HTFFRM + +N +  Q     G+  Y Y
Sbjct:  263 AHIILLDGMEVEFDVDQKMLGKYLFDEVCSYLDLIEKDFFGMTYVNSKLQTWFWLEMDKKISKQLSSADDWAFNFQVKFYPPEPVLLQEDITRYLLSLQVRQDVFTGKLPCSWITQALLGSFMVQSELGDFDELEHEEGIDYLREFEFV--LNQSDQLLEKIAELHKKHIGM-SPDKADVKYLETAKRLEQYGVDLHPARDNDDVEILIGVCYQGVLIYRDRIRIGRFAWPKVLRISYKKNYFYLKIRSDRYDDSVAIVGFKLFNHNLAKRLWKNAVEQHTFFRMKEPQNQKPTQRYMVSGSSTYGY 566          
BLAST of Band 4.1 protein 2 vs. Planmine SMEST
Match: SMESG000038155.1 (SMESG000038155.1)

HSP 1 Score: 169.859 bits (429), Expect = 2.252e-42
Identity = 96/280 (34.29%), Postives = 159/280 (56.79%), Query Frame = 1
Query:  349 VTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLG-KNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFR 1185
            VT+LD + +++ +   + GQHL++++  +L L E  YF ++Y +K   +  WL   K++  Q   + +++F F +KFY P+ +  E++ T+Y F LQ+++DI +G L  + N   LL A   QSE GDF  + +    YL  +    +A   +E L+++ E H+ +  Q+P EAD   L  A K+  YG+ +H  ++ +N  L + V H GI+I++ RI+I   SW K+ KL++K K F++ L A      +  +EF   S    K  WK C+EHH FFR
Sbjct:   21 VTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKE-GVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQA--NEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFR 297          
BLAST of Band 4.1 protein 2 vs. Planmine SMEST
Match: SMESG000038155.1 (SMESG000038155.1)

HSP 1 Score: 169.859 bits (429), Expect = 2.273e-42
Identity = 96/280 (34.29%), Postives = 159/280 (56.79%), Query Frame = 1
Query:  349 VTMLDGTEENYDIDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQLG-KNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNIFVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELHKQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSXXXXXXXXXXXXXHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHKLAKRLWKACVEHHTFFR 1185
            VT+LD + +++ +   + GQHL++++  +L L E  YF ++Y +K   +  WL   K++  Q   + +++F F +KFY P+ +  E++ T+Y F LQ+++DI +G L  + N   LL A   QSE GDF  + +    YL  +    +A   +E L+++ E H+ +  Q+P EAD   L  A K+  YG+ +H  ++ +N  L + V H GI+I++ RI+I   SW K+ KL++K K F++ L A      +  +EF   S    K  WK C+EHH FFR
Sbjct:   21 VTLLDDSVQHFHVSVRAIGQHLYNQVIAKLQLLESDYFDLEYINKE-GVSCWLDHLKQVVKQCTQRKEYIFQFGIKFYAPYPNMLEDEYTRYLFALQIKRDIYQGHLQCNINTTALLLAFIAQSEIGDFLEDEYDDYTYLSSLRLTKQA--NEEFLMKVMECHRTLVGQSPSEADYNLLDTARKVESYGIKLHPARDHENLPLKLAVSHQGIVIHQNRIKINIFSWAKVRKLSFKRKRFYIKLHAEGYGYFKDIVEFIFNSRNECKNFWKQCIEHHAFFR 297          
The following BLAST results are available for this feature:
BLAST of Band 4.1 protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPB41L21.975e-7338.66erythrocyte membrane protein band 4.1 like 2 [Sour... [more]
EPB41L21.975e-7338.66erythrocyte membrane protein band 4.1 like 2 [Sour... [more]
EPB41L22.665e-7338.66erythrocyte membrane protein band 4.1 like 2 [Sour... [more]
EPB41L24.899e-7338.66erythrocyte membrane protein band 4.1 like 2 [Sour... [more]
EPB41L24.899e-7338.66erythrocyte membrane protein band 4.1 like 2 [Sour... [more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frm-11.343e-4632.20FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-11.343e-4632.20FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-13.167e-4332.20FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-13.168e-4332.20FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
frm-13.183e-4332.20FERM domain (Protein4.1-ezrin-radixin-moesin) fami... [more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cora4.119e-6642.11gene:FBgn0010434 transcript:FBtr0301279[more]
cora4.510e-6642.11gene:FBgn0010434 transcript:FBtr0086506[more]
cora5.262e-6542.11gene:FBgn0010434 transcript:FBtr0086508[more]
cora3.612e-6442.11gene:FBgn0010434 transcript:FBtr0086509[more]
cora3.639e-6442.11gene:FBgn0010434 transcript:FBtr0340469[more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EPB41L21.090e-7040.82si:ch73-18b11.1 [Source:ZFIN;Acc:ZDB-GENE-070912-3... [more]
si:dkey-178k16.12.771e-6936.85si:dkey-178k16.1 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
epb41l3b1.178e-6740.51erythrocyte membrane protein band 4.1-like 3b [Sou... [more]
si:dkey-178k16.19.517e-6740.63si:dkey-178k16.1 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
si:dkey-178k16.11.010e-6640.52si:dkey-178k16.1 [Source:ZFIN;Acc:ZDB-GENE-090312-... [more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dcx2.536e-6942.05doublecortin [Source:Xenbase;Acc:XB-GENE-992092][more]
dcx3.421e-6942.05doublecortin [Source:Xenbase;Acc:XB-GENE-992092][more]
dcx4.968e-6942.05doublecortin [Source:Xenbase;Acc:XB-GENE-992092][more]
dcx5.740e-6942.05doublecortin [Source:Xenbase;Acc:XB-GENE-992092][more]
dcx3.457e-6842.33doublecortin [Source:Xenbase;Acc:XB-GENE-992092][more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Epb41l28.068e-7241.54erythrocyte membrane protein band 4.1 like 2 [Sour... [more]
Epb41l28.068e-7241.54erythrocyte membrane protein band 4.1 like 2 [Sour... [more]
Epb41l38.293e-7241.44erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
Epb41l31.081e-7142.90erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
Epb41l32.572e-7142.90erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
back to top
BLAST of Band 4.1 protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43491|E41L2_HUMAN1.233e-7038.66Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN... [more]
sp|Q9WV92|E41L3_MOUSE3.113e-7042.90Band 4.1-like protein 3 OS=Mus musculus OX=10090 G... [more]
sp|O70318|E41L2_MOUSE5.238e-6938.07Band 4.1-like protein 2 OS=Mus musculus OX=10090 G... [more]
sp|Q9Y2J2|E41L3_HUMAN1.811e-6842.69Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN... [more]
sp|Q9Z2H5|E41L1_MOUSE2.315e-6741.10Band 4.1-like protein 1 OS=Mus musculus OX=10090 G... [more]
back to top
BLAST of Band 4.1 protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4F8W60.000e+043.50Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A430QPK30.000e+044.64Erythrocyte membrane protein band 4.1 OS=Schistoso... [more]
A0A095A0Q90.000e+044.56Band 4.1-like protein 3 OS=Schistosoma haematobium... [more]
A0A3Q0KRX10.000e+043.60Putative 4.1 G protein OS=Schistosoma mansoni OX=6... [more]
A0A564Y7850.000e+042.51Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epb41l3a3.651e-6841.26protein 4.1 [Source:NCBI gene;Acc:103040375][more]
ENSAMXT00000039790.16.906e-6840.28pep primary_assembly:Astyanax_mexicanus-2.0:22:763... [more]
si:dkey-178k16.19.697e-6841.21band 4.1-like protein 1 [Source:NCBI gene;Acc:1030... [more]
si:dkey-178k16.11.092e-6741.21band 4.1-like protein 1 [Source:NCBI gene;Acc:1030... [more]
epb41l3a1.725e-6741.26protein 4.1 [Source:NCBI gene;Acc:103040375][more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001599.12.394e-4944.95pep scaffold:Pmarinus_7.0:GL478896:2253:11647:-1 g... [more]
EPB41L22.867e-4835.24erythrocyte membrane protein band 4.1 like 2 [Sour... [more]
ENSPMAT00000001312.13.937e-4636.55pep scaffold:Pmarinus_7.0:GL477231:34421:73675:-1 ... [more]
epb41l51.585e-3735.58erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
epb41l52.274e-3735.58erythrocyte membrane protein band 4.1 like 5 [Sour... [more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO361301.919e-5642.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302245.164e-5437.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343913.576e-4133.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448239.374e-4132.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320453.428e-3733.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Band 4.1 protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
epb41l3b4.939e-7141.10erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
epb41l3b8.207e-7142.27erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
epb41l3b8.513e-7142.27erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
epb41l3b1.611e-7042.27erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
epb41l3b1.657e-7042.27erythrocyte membrane protein band 4.1 like 3 [Sour... [more]
back to top
BLAST of Band 4.1 protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062476.10.000e+099.44SMESG000062476.1[more]
SMESG000019493.10.000e+046.81SMESG000019493.1[more]
SMESG000029732.12.056e-6845.28SMESG000029732.1[more]
SMESG000038155.12.252e-4234.29SMESG000038155.1[more]
SMESG000038155.12.273e-4234.29SMESG000038155.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017206 ID=SMED30017206|Name=Band 4.1 protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3508bp
TTTCATTCAGTTTATCAACTACATTCATTTTAAAATTTAATACCAAACAA
AAATATTGTTTCTCGCTAAAAGCACGAGCTTCAAATGAGTTCAAACAATC
TTACATTGGATAAAAAAGTTCAACGTAGAGAACTAGATAATGGGCAAATT
GAAGAAATTCACGTTATTCCGAAAAGTGAATACTATGCAAGTTTGAGAAT
GGGAAGTACGACTTCGGCGCTTAGAAATTCTGGAAATTTCTCAAAATCTC
AAAGTCACACTACACTCAGTAATCGTTATGGAACAATCAAAAGAAAGAAC
TCATTAAATTCTGTGTATAAACCAAGTGGAAAAATGCAACCATGCAATGT
AACAATGCTTGATGGAACTGAAGAGAATTATGATATTGATTCAGCATCAT
TCGGTCAGCATCTTTTTGATAGAATCTGTGATCAATTAGATTTAAATGAA
AGACAATATTTTGGAATCAAATACAATGATAAAACTTTAAGGATATGGTT
TTGGTTGGCTATGGACAAAAAGATTTCAGATCAGTTAGGAAAAAACCAAT
GGGTCTTTGATTTCCAAGTTAAATTTTACCCACCACATGTCGATGATTTT
GAAGAAGATCTTACGAAATATTTTTTCTGTTTGCAAGTCAGACAAGATAT
AGTTGAAGGAATATTACCGATGTCCTTCAATATATTTGTTTTGCTTGGGG
CTCACGCTGTTCAGTCAGAGGCTGGGGACTTTGATCCCAATAACCATCAA
GGAATCGAATATCTTAGAAAAATGCCATTTGCTCCCAAAGCTTTACAAAC
AGATGAATTATTGCTAAGAATTAGTGAACTTCATAAACAAGTCGGGATGC
AGACTCCCGAAGAAGCAGATCGGGCTTTTCTCTGGAATGCAATGAAACTT
GGAATGTATGGAGTAGATATGCATAAAGTTAAAAATCAGCAAAACGAAGA
ACTAAGCGTCGGAGTTTACCACAGTGGGATTCTTATTTATCGAGGAAGAA
TCAGAATTATTCGTCACTCATGGCCTAAGATTGTCAAACTGACATACAAA
CATAAGAGTTTTTTCCTTTTTCTTCGCGCTACAGAAATAAACAAAGCCGA
AAGGCAACTGGAATTCAAATGTGGAAGCCATAAATTAGCCAAACGACTGT
GGAAAGCTTGTGTAGAACATCATACATTTTTCAGAATGGTTGATGCCGAA
AATCCAAGAAAACCTCAATTAATACCTGGATTTGGAACTCGAAAATACTT
ATATCCTTCCTCTCCTTCCCCTTCTATGTTAAATAATAATAACCAATCGG
CTCCAAACATTATTCTTGGTCGACCGCAACCAAAGGTCAGACGAATGCAA
ACTCAAAGAAAGGAAAAAGAAACTCCACTATCTCCCAGTGGTATTGCACC
ATGTGCAAATAACGATGAAATATTTAGCTTAGAAGAGAGTCTTGATAATG
CCATCGAAAGACCAGAACTTCTTGAAGAATATTGGCAAATGTCAATTGAC
GATTCAACTCCCGAGATGGGAATTGATCCTCTAGGCTTAGATGTTGCCGG
AAATAAAGGTTCAGGTTGGCAAGGTTCTAGGGCAAATAAAGGTGTTAAAG
GTCCTGGAAAATACTATTATGAGGGAAAGGTAGTTGAGGATGGGTTAATA
AGATTAGGCTGGGCGACAAACGATGCAAGTCTAGATCTAGGATCGGATAA
AGAAGGGTTTGGCTATGGTGACAGCCAAGCTGGAGATAAAAATGGTGGAT
TTAAACGAAATTGTAATAAAGAAAATGGATATGGTCAACCTATTAAAGAA
GGAGATTTAATTGGTTGTTTTCTTGATTTTGACAATGGCAATATTCAGTG
GAGCAAAAATGGAGCAACATTTGAGCCTGCATTTAAAATTCCAGATGAAT
TAAAAGATGAAGCATTTTTTCCAGCATCTAGTATTAAAGATGGTAGAGTA
ATTTTTAATTTTGGAGATGAGCCATTATCATTTCTACCGAAACGCGACTG
GTTACCTGTTTCTCAGGCTAATGAAAACAATGTTGTTCCTAATAAAAATA
TCGGATGGAAAATGAATCCGTTTGATGCAACGACAGGGACAGATGTATCT
GGAAATGGATACACTCTTCAATCAAAATTAAATGGAGAATGGAATGGATG
TAGAGCAAATAAGGGAGTTTTCGACTGTGGAAAATATTATTATGAAGTTA
TACCGTTGGAAGATGGTTTGGCAAGAGTTGGATGGGCGACTGATGATGGA
AGTTTAAATCTTGGAAGTGATGGTTCCGGATTTGGTTACGGCGCTGATAA
TGATGGATTTGGACTAAAAGGAAATCAAGGTAAAAAAATGAATTCGGGAG
AAATTGAAAATTACGGAGATCCATTTATGAAAGGAGATGTGATTGGCTGT
TTCTTAGATCTCGATAACAAATATGTCAAATGGTCCAAGAATGGACAAGT
TTATAAAGAGGGATATGTTCTTCCTGATGATCTAGTTGAATTAAGGGCAT
TTTATCCAACTGCAAGTCTTATTAATAACACATTAGACTTTAATTTTGGT
AACAAACCTTTTGAGTTTTATCCCGGAAGTGAATGGAATCCATTGTGTTA
TGCTGCTCATGGTAATACAGAGAAAACCAAAAAGAGAGATCCTTCACTGT
ATTCCAAACCTTTTACAGATCGAGAAGAAGATGTTTTGGAAATTCGAAGA
CAAGCCAGAGAAAAATTTAAAAGAAATGATCAATTAGAAGAAGAACGCAA
ATTAAATAGTATTAAAGAAAAGGAAAGAATTGAAAAACAAGAAAAAGAAC
GTAGAATCTTATTACAAAAAGAACGAGATGAAGAAGAAAGACGCCGTAAG
GAATTGGAAAGAGAAGAATATGAAAGACATCAAAAAGAATTAGAAGAACT
TGAAAGACAACGACAAAGAGAGATTGAAATTCGACAAAACGAAGAAAGAC
AAAGACTTCTTAATACAAAAGAAAAACAGGAAACTGAAGAAAGCTATCAG
ATTGTTGAAAAAGGTGATCCAGAAATTACTACAGAAACGTACGTCGATGA
ACTTGGAAGAACAGTGACCAGAACAGTAAAGAAGACTAAAATAAAAACAA
CCACAAATCTCAACAGAAACACGATTGAAAGAACAGAAGATGAGATAAAT
ACAAGTAAAGTAGCAAAGCTTCGAGGCATTGGAATAGTAAGTTATTACGA
AGACGATGATGATGATGAAGAGTTAATAAAGGCGATTCTATCGGTGACAA
AATTCAATCAAAATGTAAGAGTTCTGCAAGACGAGCACTTTTTACCAACG
AGTTCAGTATAGATATCCTCCAAATTAAATAAATAAAATGAACAACACAT
GACTATACAATATATTTATAAATAACAGAAATCCATTCTTACACCTGTTA
CTAAAAAAGTTGTTGAAATTGTCAAAGAATGTTAAATATTAGTTTTTATG
ACATTTTATGTGTATGTTGCTCATCAGCCACTGTTATTTTATAATTCTTT
ATTATTCG
back to top

protein sequence of SMED30017206-orf-1

>SMED30017206-orf-1 ID=SMED30017206-orf-1|Name=SMED30017206-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1076bp
MSSNNLTLDKKVQRRELDNGQIEEIHVIPKSEYYASLRMGSTTSALRNSG
NFSKSQSHTTLSNRYGTIKRKNSLNSVYKPSGKMQPCNVTMLDGTEENYD
IDSASFGQHLFDRICDQLDLNERQYFGIKYNDKTLRIWFWLAMDKKISDQ
LGKNQWVFDFQVKFYPPHVDDFEEDLTKYFFCLQVRQDIVEGILPMSFNI
FVLLGAHAVQSEAGDFDPNNHQGIEYLRKMPFAPKALQTDELLLRISELH
KQVGMQTPEEADRAFLWNAMKLGMYGVDMHKVKNQQNEELSVGVYHSGIL
IYRGRIRIIRHSWPKIVKLTYKHKSFFLFLRATEINKAERQLEFKCGSHK
LAKRLWKACVEHHTFFRMVDAENPRKPQLIPGFGTRKYLYPSSPSPSMLN
NNNQSAPNIILGRPQPKVRRMQTQRKEKETPLSPSGIAPCANNDEIFSLE
ESLDNAIERPELLEEYWQMSIDDSTPEMGIDPLGLDVAGNKGSGWQGSRA
NKGVKGPGKYYYEGKVVEDGLIRLGWATNDASLDLGSDKEGFGYGDSQAG
DKNGGFKRNCNKENGYGQPIKEGDLIGCFLDFDNGNIQWSKNGATFEPAF
KIPDELKDEAFFPASSIKDGRVIFNFGDEPLSFLPKRDWLPVSQANENNV
VPNKNIGWKMNPFDATTGTDVSGNGYTLQSKLNGEWNGCRANKGVFDCGK
YYYEVIPLEDGLARVGWATDDGSLNLGSDGSGFGYGADNDGFGLKGNQGK
KMNSGEIENYGDPFMKGDVIGCFLDLDNKYVKWSKNGQVYKEGYVLPDDL
VELRAFYPTASLINNTLDFNFGNKPFEFYPGSEWNPLCYAAHGNTEKTKK
RDPSLYSKPFTDREEDVLEIRRQAREKFKRNDQLEEERKLNSIKEKERIE
KQEKERRILLQKERDEEERRRKELEREEYERHQKELEELERQRQREIEIR
QNEERQRLLNTKEKQETEESYQIVEKGDPEITTETYVDELGRTVTRTVKK
TKIKTTTNLNRNTIERTEDEINTSKVAKLRGIGIVSYYEDDDDDEELIKA
ILSVTKFNQNVRVLQDEHFLPTSSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR043136B30.2/SPRY_sf
IPR035963FERM_2
IPR019749Band_41_domain
IPR000798Ez/rad/moesin-like
IPR018980FERM_PH-like_C
IPR003877SPRY_dom
IPR014352FERM/acyl-CoA-bd_prot_sf
IPR018979FERM_N
IPR019748FERM_central
IPR011993PH-like_dom_sf
IPR019747FERM_CS
IPR001870B30.2/SPRY
IPR000299FERM_domain
IPR013320ConA-like_dom_sf
IPR029071Ubiquitin-like_domsf
Vocabulary: molecular function
TermDefinition
GO:0008092cytoskeletal protein binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0019898extrinsic component of membrane
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 894..956
NoneNo IPR availableCOILSCoilCoilcoord: 867..887
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 83..163
e-value: 7.4E-22
score: 78.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 917..941
NoneNo IPR availablePANTHERPTHR232804.1 G PROTEINcoord: 71..961
NoneNo IPR availableCDDcd01765FERM_F0_F1coord: 86..164
e-value: 4.78432E-21
score: 86.1023
NoneNo IPR availableCDDcd12873SPRY_DDX1coord: 469..630
e-value: 1.08849E-66
score: 218.982
NoneNo IPR availableCDDcd12873SPRY_DDX1coord: 660..825
e-value: 2.88023E-63
score: 209.352
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 274..381
IPR000798Ezrin/radixin/moesin-likePRINTSPR00661ERMFAMILYcoord: 98..117
score: 26.67
coord: 283..303
score: 38.62
coord: 149..168
score: 37.22
IPR019749Band 4.1 domainPRINTSPR00935BAND41coord: 196..216
score: 38.39
coord: 260..276
score: 40.93
coord: 183..196
score: 42.11
coord: 118..130
score: 41.67
IPR019749Band 4.1 domainSMARTSM00295B41_5coord: 81..280
e-value: 2.8E-50
score: 183.0
IPR003877SPRY domainSMARTSM00449SPRY_3coord: 698..825
e-value: 8.4E-21
score: 85.1
coord: 507..630
e-value: 3.9E-14
score: 63.0
IPR003877SPRY domainPFAMPF00622SPRYcoord: 509..626
e-value: 9.5E-16
score: 58.0
coord: 700..823
e-value: 4.9E-17
score: 62.2
IPR018980FERM, C-terminal PH-like domainSMARTSM01196FERM_C_3coord: 284..374
e-value: 3.0E-27
score: 106.5
IPR018980FERM, C-terminal PH-like domainPFAMPF09380FERM_Ccoord: 284..369
e-value: 3.6E-20
score: 72.1
IPR043136B30.2/SPRY domain superfamilyGENE3DG3DSA:2.60.120.920coord: 463..656
e-value: 2.7E-51
score: 176.1
coord: 657..860
e-value: 2.2E-48
score: 166.6
IPR019748FERM central domainPFAMPF00373FERM_Mcoord: 171..280
e-value: 1.1E-11
score: 45.2
IPR019748FERM central domainCDDcd14473FERM_B-lobecoord: 177..272
e-value: 1.42946E-19
score: 82.6794
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 275..369
e-value: 4.9E-32
score: 112.1
IPR018979FERM, N-terminalPFAMPF09379FERM_Ncoord: 89..151
e-value: 8.1E-12
score: 44.9
IPR014352FERM/acyl-CoA-binding protein superfamilyGENE3DG3DSA:1.20.80.10coord: 164..274
e-value: 1.0E-26
score: 95.5
IPR019747FERM conserved sitePROSITEPS00661FERM_2coord: 250..279
IPR001870B30.2/SPRY domainPROSITEPS50188B302_SPRYcoord: 638..826
score: 16.892
IPR001870B30.2/SPRY domainPROSITEPS50188B302_SPRYcoord: 431..631
score: 17.181
IPR000299FERM domainPROSITEPS50057FERM_3coord: 85..370
score: 69.4
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 82..167
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 657..828
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 465..630
IPR035963FERM superfamily, second domainSUPERFAMILYSSF47031Second domain of FERMcoord: 162..275