3'(2'),5'-bisphosphate nucleotidase 1

Overview
Name3'(2'),5'-bisphosphate nucleotidase 1
Smed IDSMED30017200
Length (bp)1284
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 3'(2'),5'-bisphosphate nucleotidase 1 (SMED30017200) t-SNE clustered cells

Violin plots show distribution of expression levels for 3'(2'),5'-bisphosphate nucleotidase 1 (SMED30017200) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 3'(2'),5'-bisphosphate nucleotidase 1 (SMED30017200) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 3'(2'),5'-bisphosphate nucleotidase 1 (SMED30017200) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017200

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017200SMESG000030959.1 SMESG000014111.1 PL030016B10F04ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30017200SMESG000014111.1 Contig4084GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30017200SMESG000014111.1 Contig4084GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30017200SMESG000014111.1 SMESG000014107.1 dd_Smed_v4_1334_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017200SMESG000014111.1 SMESG000014107.1 dd_Smed_v4_1334_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Human
Match: BPNT1 (3'(2'), 5'-bisphosphate nucleotidase 1 [Source:HGNC Symbol;Acc:HGNC:1096])

HSP 1 Score: 244.202 bits (622), Expect = 2.226e-77
Identity = 130/311 (41.80%), Postives = 201/311 (64.63%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKG-VNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHFL 1107
            +++RL++++  I+ KAG IVR+V++ G+LGI++K    DLQTKADR AQ  I  SL  +FP + +IGEE  D   +++    +E +  + +L Q CP+    +  +D+VVWVDPLDGT EYT+GL+++VTVLIG++  G+ + GVI+QP+    +  D   GR+I+ + G+G FGF+ +       P    +++TTTR H   +V   + A  P  ++RVGG G+K++ ++EG+   Y+FAS GCKKWDTCAPE +L   GG LTD+ G    Y +DV   NS GVLAT +   + +Y S++P+++K   +
Sbjct:    7 VLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEE--DLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLK-----EVP-AGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRN--YDYYASRVPESIKNALV 307          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Human
Match: BPNT1 (3'(2'), 5'-bisphosphate nucleotidase 1 [Source:HGNC Symbol;Acc:HGNC:1096])

HSP 1 Score: 244.202 bits (622), Expect = 2.226e-77
Identity = 130/311 (41.80%), Postives = 201/311 (64.63%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKG-VNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHFL 1107
            +++RL++++  I+ KAG IVR+V++ G+LGI++K    DLQTKADR AQ  I  SL  +FP + +IGEE  D   +++    +E +  + +L Q CP+    +  +D+VVWVDPLDGT EYT+GL+++VTVLIG++  G+ + GVI+QP+    +  D   GR+I+ + G+G FGF+ +       P    +++TTTR H   +V   + A  P  ++RVGG G+K++ ++EG+   Y+FAS GCKKWDTCAPE +L   GG LTD+ G    Y +DV   NS GVLAT +   + +Y S++P+++K   +
Sbjct:    7 VLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEE--DLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLK-----EVP-AGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRN--YDYYASRVPESIKNALV 307          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Human
Match: BPNT1 (3'(2'), 5'-bisphosphate nucleotidase 1 [Source:HGNC Symbol;Acc:HGNC:1096])

HSP 1 Score: 222.246 bits (565), Expect = 2.052e-69
Identity = 122/311 (39.23%), Postives = 183/311 (58.84%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKG-VNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHFL 1107
            +++RL++++  I+ KAG IVR+V++ G+LGI++K    DLQTKADR AQ  I  SL  +FP + +IGEE +                                      VWVDPLDGT EYT+GL+++VTVLIG++  G+ + GVI+QP+    +  D   GR+I+ + G+G FGF+ +       P    +++TTTR H   +V   + A  P  ++RVGG G+K++ ++EG+   Y+FAS GCKKWDTCAPE +L   GG LTD+ G    Y +DV   NS GVLAT +   + +Y S++P+++K   +
Sbjct:    7 VLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEELV--------------------------------------VWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLK-----EVP-AGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRN--YDYYASRVPESIKNALV 271          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Human
Match: BPNT1 (3'(2'), 5'-bisphosphate nucleotidase 1 [Source:HGNC Symbol;Acc:HGNC:1096])

HSP 1 Score: 221.476 bits (563), Expect = 7.398e-69
Identity = 120/293 (40.96%), Postives = 183/293 (62.46%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKG-VNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNK-------------------GRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDV 1008
            +++RL++++  I+ KAG IVR+V++ G+LGI++K    DLQTKADR AQ  I  SL  +FP + +IGEE  D   +++    +E +  + +L Q CP+    +  +D+VVWVDPLDGT EYT+GL+++VTVLIG++  G+ + GVI+QP+   +NN+                   GR+I+ + G+G FGF+ +       P    +++TTTR H   +V   + A  P  ++RVGG G+K++ ++EG+   Y+FAS GCKKWDTCAPE +L   GG LTD+ G    Y +DV
Sbjct:    7 VLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEE--DLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYENNEKQQLREHRNEAKAGPDAVLGRTIWGVLGLGAFGFQLK-----EVP-AGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDV 291          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Human
Match: BPNT1 (3'(2'), 5'-bisphosphate nucleotidase 1 [Source:HGNC Symbol;Acc:HGNC:1096])

HSP 1 Score: 196.438 bits (498), Expect = 1.176e-59
Identity = 105/260 (40.38%), Postives = 162/260 (62.31%), Query Frame = 1
Query:  340 IVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHFL 1107
            I  SL  +FP + +IGEE  D   +++    +E +  + +L Q CP+    +  +D+VVWVDPLDGT EYT+GL+++VTVLIG++  G+ + GVI+QP+    +  D   GR+I+ + G+G FGF+ +       P    +++TTTR H   +V   + A  P  ++RVGG G+K++ ++EG+   Y+FAS GCKKWDTCAPE +L   GG LTD+ G    Y +DV   NS GVLAT +   + +Y S++P+++K   +
Sbjct:    3 ICSSLARKFPKLTIIGEE--DLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLK-----EVP-AGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRN--YDYYASRVPESIKNALV 252          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Celegans
Match: bpnt-1 (3'(2'), 5'-BisPhosphate NucleoTidase 1 homolog [Source:UniProtKB/TrEMBL;Acc:Q23493])

HSP 1 Score: 215.312 bits (547), Expect = 1.950e-66
Identity = 141/317 (44.48%), Postives = 189/317 (59.62%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKGVN----DLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYT-------QGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEII----RVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVK 1095
             + RL+++SV++S  AG +++ VM+ G+L IIDK  +    D QT+ADR AQ CIV SL+  F  I +IGEE    A  ++   E+  + D   + +   T L N+  +D+VVWVDPLDGTSE           L+E VTVLIG++  GRPV G+IHQP+       GR+++A++G G  G       T NA      ++ TTR H +  V+ ALEA     +     +VGG G KVL +LEG C  Y+FASAGCKKWDTCA EAVL  AGG LTD+ GR   YE  V  +N+ GVLATA    H+ Y+  IPQ +K
Sbjct:    7 FLTRLVASSVRVSEAAGGLIKNVMAGGDLKIIDKSEHGSGYDPQTEADRRAQYCIVQSLQKHFKNINIIGEEEDTTACPEI---EMGFSADVLQMERLMSTELKNIQENDVVVWVDPLDGTSEVALAVKNKNMALLEQVTVLIGIAYKGRPVAGIIHQPY---HEKLGRTVWAIQGCGVHGVV---PATGNA----QKIVVTTRSHLSESVSNALEALKTRNLADSVEKVGGAGFKVLKVLEG-CAAYVFASAGCKKWDTCAVEAVLTAAGGTLTDISGRDIRYEPGVQLNNTGGVLATASWVKHKDYIDTIPQEIK 309          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Celegans
Match: gpap-1 (Golgi-resident PAp (PAP) 3-Phosphatase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XWE8])

HSP 1 Score: 111.309 bits (277), Expect = 3.621e-27
Identity = 105/343 (30.61%), Postives = 163/343 (47.52%), Query Frame = 1
Query:  103 FLYIFYLTYITCVQLVGYINPIKKEMDIPLIIRLLSASVKISYKAGAIVRKVMSSGNL-----GIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTD---DQFVLNQTCPTNLCX-----XXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNV---LTTTRGHGTNIVNQALEACG-PTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKI 1080
            FLY+ YL +       G   P   E+D+ L   ++S +V      G  V KV    NL     G+ D+G  +L T+AD  +   I+D L+ RFP + ++ EE      +K + SE E+     D + + Q+    L       + + D+ V+VDPLD T E+T+GL E+VTV+  + ++  P+ G I++PF         +I+ L+G G        D     P E S     +  +R H   +     +  G    I   GG G+K L ++ G    Y+  +A  KKWDTCA +A+LR  GG + D+ G+P  Y       N  G+LAT +  +   YL+K 
Sbjct:   19 FLYLAYLIFFES----GDGMP---EIDVDLK-DVISYAVLAIEMGGHAVMKVNEEKNLNAAAKGLTDEGKEELLTRADLISNHLILDILQ-RFPQLQIVSEE------KKSEFSEREIEPYRLDNYAVWQSVKEILDKIPSRRLQLSDVRVFVDPLDATQEFTEGLTEYVTVMACIVLDAEPIFGAIYRPFF------NETIFGLQGFGVI----TSDGVRLNPIEDSKTAKKVVVSRSHAGKVKEIVEKVYGDKMNIEPAGGSGYKTLRLVNGTAELYLHTTA-IKKWDTCAGDAILRTMGGAMLDLEGQPLRYSSADPLLNKKGLLATVRNPYS--YLNKF 333          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Celegans
Match: gpap-1 (Golgi-resident PAp (PAP) 3-Phosphatase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XWE8])

HSP 1 Score: 111.309 bits (277), Expect = 4.582e-27
Identity = 101/343 (29.45%), Postives = 158/343 (46.06%), Query Frame = 1
Query:  103 FLYIFYLTYITCVQLVGYINPIKKEMDIPLIIRLLSASVKISYKAGAIVRKVMSSGNL-----GIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTD---DQFVLNQTCPTNLCXXXXXXXXXXXX-----PLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNV---LTTTRGHGTNIVNQALEACG-PTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKI 1080
            FLY+ YL +       G   P   E+D+ L   ++S +V      G  V KV    NL     G+ D+G  +L T+AD  +   I+D L+ RFP + ++ EE      +K + SE E+     D + + Q+    L  +    + +        PLD T E+T+GL E+VTV+  + ++  P+ G I++PF         +I+ L+G G        D     P E S     +  +R H   +     +  G    I   GG G+K L ++ G    Y+  +A  KKWDTCA +A+LR  GG + D+ G+P  Y       N  G+LAT +  +   YL+K 
Sbjct:   28 FLYLAYLIFFES----GDGMP---EIDVDLK-DVISYAVLAIEMGGHAVMKVNEEKNLNAAAKGLTDEGKEELLTRADLISNHLILDILQ-RFPQLQIVSEE------KKSEFSEREIEPYRLDNYAVWQSVKEILDKIPSRRLQLSDVRVFVDPLDATQEFTEGLTEYVTVMACIVLDAEPIFGAIYRPFF------NETIFGLQGFGVI----TSDGVRLNPIEDSKTAKKVVVSRSHAGKVKEIVEKVYGDKMNIEPAGGSGYKTLRLVNGTAELYLHTTA-IKKWDTCAGDAILRTMGGAMLDLEGQPLRYSSADPLLNKKGLLATVRNPYS--YLNKF 342          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Fly
Match: CG7789 (gene:FBgn0039698 transcript:FBtr0085483)

HSP 1 Score: 257.684 bits (657), Expect = 5.215e-83
Identity = 144/311 (46.30%), Postives = 194/311 (62.38%), Query Frame = 1
Query:  187 PLIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFV-------LNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPN-DNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVK 1095
            P+I+R++++S+  + +AG I+R V+  G+LGI+DKG ND QT+ADR AQ CI+ SL  +FP + +IGEE           S+L + DD  V       L  +CP    +V  +D V+WVDPLDGT+EYTQG +EHVTVLIG++V    VGG+IHQPF    D   GR+I+ L+G+G  GF      T         ++TTTR H   +  QAL A   TE+++VGG G KVL +LEG+ H Y+FA+ GCKKWDTCAPEAVL   GG LT++ G  + Y  DV   N  GVLA+  +D H   + KIP  V+
Sbjct:    6 PVIMRVMASSISTAKRAGGIIRDVLKKGDLGIVDKGKNDPQTEADRSAQRCIIASLAKKFPTVKIIGEEG---------GSDLNVCDDWLVNELDEEFLQHSCPAEWKDVKPEDFVIWVDPLDGTAEYTQGHVEHVTVLIGIAVKDAAVGGIIHQPFYQQPDGEMGRTIWGLKGLGTGGF------TAVPAPAGQFIITTTRSHSNALHQQALNAFASTEVLKVGGAGFKVLQLLEGKAHAYVFATPGCKKWDTCAPEAVLEAQGGCLTNINGEHYAYNADVEHVNRQGVLASLGQD-HAALVEKIPAEVR 300          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Fly
Match: CG15743 (gene:FBgn0030465 transcript:FBtr0333330)

HSP 1 Score: 113.62 bits (283), Expect = 9.079e-28
Identity = 94/307 (30.62%), Postives = 152/307 (49.51%), Query Frame = 1
Query:  199 RLLSASVKISYKAGAIVRKVMSSGNL-----GIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGP-TEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEH 1101
            ++L A+++ + + G  V  V  S  L     G  D+GVND  T AD  +   +   L+  FP + +  EE   D E   Q    +L  D  VL++T       VN  D+ VWVDPLD T E+T+ L E+VT ++ V+V GRP+ GVIH PF+      G++ +A  G     +        ++P+  + ++T +R H     + A    G    ++   G G+KVL ++      Y+  S   KKWD CA +A+L   GG +T +  +   Y  + +  N+ G+LAT ++  H  Y+ K+ +  + H
Sbjct:   59 KMLIAAIQAAQRGGLEVLDVARSRQLKERSKGKTDEGVNDPFTDADGRSHCVMKQGLQRIFPRVQIFSEE---DKEHCKQAHGYDL--DPTVLHETAQIPDVTVNAQDVTVWVDPLDATKEFTEELYEYVTTMVCVAVAGRPIIGVIHSPFN------GQTAWAWVGNSMSEYLSNLH-PQHSPNNQAPIITVSRSHTAGAKDLARGIFGENVSLLTAAGAGYKVLQVVANNATAYLHTSK-IKKWDICAGDAILHALGGTMTTLNDQLINYGPEESPVNTEGLLATLEQ--HDEYMDKLSKYREAH 350          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Fly
Match: CG15743 (gene:FBgn0030465 transcript:FBtr0346123)

HSP 1 Score: 113.62 bits (283), Expect = 9.079e-28
Identity = 94/307 (30.62%), Postives = 152/307 (49.51%), Query Frame = 1
Query:  199 RLLSASVKISYKAGAIVRKVMSSGNL-----GIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGP-TEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEH 1101
            ++L A+++ + + G  V  V  S  L     G  D+GVND  T AD  +   +   L+  FP + +  EE   D E   Q    +L  D  VL++T       VN  D+ VWVDPLD T E+T+ L E+VT ++ V+V GRP+ GVIH PF+      G++ +A  G     +        ++P+  + ++T +R H     + A    G    ++   G G+KVL ++      Y+  S   KKWD CA +A+L   GG +T +  +   Y  + +  N+ G+LAT ++  H  Y+ K+ +  + H
Sbjct:   59 KMLIAAIQAAQRGGLEVLDVARSRQLKERSKGKTDEGVNDPFTDADGRSHCVMKQGLQRIFPRVQIFSEE---DKEHCKQAHGYDL--DPTVLHETAQIPDVTVNAQDVTVWVDPLDATKEFTEELYEYVTTMVCVAVAGRPIIGVIHSPFN------GQTAWAWVGNSMSEYLSNLH-PQHSPNNQAPIITVSRSHTAGAKDLARGIFGENVSLLTAAGAGYKVLQVVANNATAYLHTSK-IKKWDICAGDAILHALGGTMTTLNDQLINYGPEESPVNTEGLLATLEQ--HDEYMDKLSKYREAH 350          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Fly
Match: CG15743 (gene:FBgn0030465 transcript:FBtr0073755)

HSP 1 Score: 113.62 bits (283), Expect = 9.079e-28
Identity = 94/307 (30.62%), Postives = 152/307 (49.51%), Query Frame = 1
Query:  199 RLLSASVKISYKAGAIVRKVMSSGNL-----GIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGP-TEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEH 1101
            ++L A+++ + + G  V  V  S  L     G  D+GVND  T AD  +   +   L+  FP + +  EE   D E   Q    +L  D  VL++T       VN  D+ VWVDPLD T E+T+ L E+VT ++ V+V GRP+ GVIH PF+      G++ +A  G     +        ++P+  + ++T +R H     + A    G    ++   G G+KVL ++      Y+  S   KKWD CA +A+L   GG +T +  +   Y  + +  N+ G+LAT ++  H  Y+ K+ +  + H
Sbjct:   59 KMLIAAIQAAQRGGLEVLDVARSRQLKERSKGKTDEGVNDPFTDADGRSHCVMKQGLQRIFPRVQIFSEE---DKEHCKQAHGYDL--DPTVLHETAQIPDVTVNAQDVTVWVDPLDATKEFTEELYEYVTTMVCVAVAGRPIIGVIHSPFN------GQTAWAWVGNSMSEYLSNLH-PQHSPNNQAPIITVSRSHTAGAKDLARGIFGENVSLLTAAGAGYKVLQVVANNATAYLHTSK-IKKWDICAGDAILHALGGTMTTLNDQLINYGPEESPVNTEGLLATLEQ--HDEYMDKLSKYREAH 350          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Fly
Match: Ipp (gene:FBgn0016672 transcript:FBtr0082865)

HSP 1 Score: 65.855 bits (159), Expect = 1.958e-11
Identity = 50/164 (30.49%), Postives = 72/164 (43.90%), Query Frame = 1
Query:  526 PLDGTSEYTQGL-------------IEHVTVLIGVSV--NGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTD 972
            P+D T+EY  G              ++ VTVLIGV     G PV GV+ QPF         S     G+ C    R  +    A DE+  +   +    ++I+ + L+     E     G GHK L ++      Y+ +     KWDTCAP+A+LR  GG + D
Sbjct:  163 PIDATAEYISGDTMFTDFPGITSTGLDCVTVLIGVYERDTGVPVMGVVAQPFGEKLEENVYSSSMFWGV-CLPTVRAHNCDFEARDENRRLGIFSSSEQSDILQRFLDL--GYEFAFSAGAGHKALKVITHEVDVYLLSKGSTFKWDTCAPQAILRALGGDVLD 323          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Zebrafish
Match: bpnt1 (bisphosphate nucleotidase 1 [Source:ZFIN;Acc:ZDB-GENE-040718-46])

HSP 1 Score: 253.062 bits (645), Expect = 4.647e-81
Identity = 135/308 (43.83%), Postives = 201/308 (65.26%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKE 1098
            +++RL++++  ++ KAG IVR+V+ SG LGI++K G NDLQT ADR  Q  I  SL   FP + +IGEE  D   + ++   +E   +  +L ++CP    ++  +++VVWVDPLDGT EYT+GL++HVTVLIG++  G  + GVI+QPF    +      GR+++ + G+G FGF+ +       PD    ++TTTR H   +V   ++A  P ++IRVGG G+K++ ++EG    Y+FAS GCKKWDTCAPEA+L   GG LTDM G  + Y+ +V   NS GVLAT +   H++YLSK+PQ V++
Sbjct:    7 VLMRLVASAHAVAEKAGTIVRRVLKSGELGIVEKTGANDLQTLADRLVQKSICASLSKSFPKLTIIGEE--DLPAETVEDDLIENGQNSLILEKSCPDQYASLKEEELVVWVDPLDGTKEYTEGLLDHVTVLIGIAHAGTAIAGVINQPFYNYQAGAGATLGRTLWGVLGLGAFGFQLK-----EVPD-GKRIITTTRSHSNKLVIDTVQAMEPHDVIRVGGAGNKIIQLVEGTASAYVFASLGCKKWDTCAPEAILHAVGGKLTDMHGNTYKYDANVKHMNSAGVLATLRN--HEYYLSKVPQAVQQ 304          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Zebrafish
Match: bpnt1 (bisphosphate nucleotidase 1 [Source:ZFIN;Acc:ZDB-GENE-040718-46])

HSP 1 Score: 238.039 bits (606), Expect = 7.528e-75
Identity = 134/330 (40.61%), Postives = 200/330 (60.61%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQG----------------------LIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKE 1098
            +++RL++++  ++ KAG IVR+V+ SG LGI++K G NDLQT ADR  Q  I  SL   FP + +IGEE  D   + ++   +E   +  +L ++CP    ++  +++VVWVDPLDGT EYT+                       L++HVTVLIG++  G  + GVI+QPF    +      GR+++ + G+G FGF+ +       PD    ++TTTR H   +V   ++A  P ++IRVGG G+K++ ++EG    Y+FAS GCKKWDTCAPEA+L   GG LTDM G  + Y+ +V   NS GVLAT +   H++YLSK+PQ V++
Sbjct:    7 VLMRLVASAHAVAEKAGTIVRRVLKSGELGIVEKTGANDLQTLADRLVQKSICASLSKSFPKLTIIGEE--DLPAETVEDDLIENGQNSLILEKSCPDQYASLKEEELVVWVDPLDGTKEYTEAARVLYSPVYIQKPVLPHRTPNRLLDHVTVLIGIAHAGTAIAGVINQPFYNYQAGAGATLGRTLWGVLGLGAFGFQLK-----EVPDG-KRIITTTRSHSNKLVIDTVQAMEPHDVIRVGGAGNKIIQLVEGTASAYVFASLGCKKWDTCAPEAILHAVGGKLTDMHGNTYKYDANVKHMNSAGVLATLRN--HEYYLSKVPQAVQQ 326          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Zebrafish
Match: bpnt1 (bisphosphate nucleotidase 1 [Source:ZFIN;Acc:ZDB-GENE-040718-46])

HSP 1 Score: 234.572 bits (597), Expect = 2.047e-73
Identity = 136/345 (39.42%), Postives = 200/345 (57.97%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCP-------------------------------------TNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKE 1098
            +++RL++++  ++ KAG IVR+V+ SG LGI++K G NDLQT ADR  Q  I  SL   FP + +IGEE  D   + ++   +E   +  +L ++CP                                       +  + I  +VVWVDPLDGT EYT+GL++HVTVLIG++  G  + GVI+QPF    +      GR+++ + G+G FGF+ +       PD    ++TTTR H   +V   ++A  P ++IRVGG G+K++ ++EG    Y+FAS GCKKWDTCAPEA+L   GG LTDM G  + Y+ +V   NS GVLAT +   H++YLSK+PQ V++
Sbjct:    7 VLMRLVASAHAVAEKAGTIVRRVLKSGELGIVEKTGANDLQTLADRLVQKSICASLSKSFPKLTIIGEE--DLPAETVEDDLIENGQNSLILEKSCPDQYASLKEEEVRQKENVHFVIISFILKYLNIYVAQFGIQMIFICISQLVVWVDPLDGTKEYTEGLLDHVTVLIGIAHAGTAIAGVINQPFYNYQAGAGATLGRTLWGVLGLGAFGFQLK-----EVPDG-KRIITTTRSHSNKLVIDTVQAMEPHDVIRVGGAGNKIIQLVEGTASAYVFASLGCKKWDTCAPEAILHAVGGKLTDMHGNTYKYDANVKHMNSAGVLATLRN--HEYYLSKVPQAVQQ 341          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Zebrafish
Match: bpnt1 (bisphosphate nucleotidase 1 [Source:ZFIN;Acc:ZDB-GENE-040718-46])

HSP 1 Score: 219.935 bits (559), Expect = 2.146e-67
Identity = 135/367 (36.78%), Postives = 199/367 (54.22%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCP-------------------------------------TNLCXXXXXXXXXXXXPLDGTSEYTQG----------------------LIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKE 1098
            +++RL++++  ++ KAG IVR+V+ SG LGI++K G NDLQT ADR  Q  I  SL   FP + +IGEE  D   + ++   +E   +  +L ++CP                                       +  + I  +VVWVDPLDGT EYT+                       L++HVTVLIG++  G  + GVI+QPF    +      GR+++ + G+G FGF+ +       PD    ++TTTR H   +V   ++A  P ++IRVGG G+K++ ++EG    Y+FAS GCKKWDTCAPEA+L   GG LTDM G  + Y+ +V   NS GVLAT +   H++YLSK+PQ V++
Sbjct:    7 VLMRLVASAHAVAEKAGTIVRRVLKSGELGIVEKTGANDLQTLADRLVQKSICASLSKSFPKLTIIGEE--DLPAETVEDDLIENGQNSLILEKSCPDQYASLKEEEVRQKENVHFVIISFILKYLNIYVAQFGIQMIFICISQLVVWVDPLDGTKEYTEAARVLYSPVYIQKPVLPHRTPNRLLDHVTVLIGIAHAGTAIAGVINQPFYNYQAGAGATLGRTLWGVLGLGAFGFQLK-----EVPDG-KRIITTTRSHSNKLVIDTVQAMEPHDVIRVGGAGNKIIQLVEGTASAYVFASLGCKKWDTCAPEAILHAVGGKLTDMHGNTYKYDANVKHMNSAGVLATLRN--HEYYLSKVPQAVQQ 363          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Zebrafish
Match: impad1 (inositol monophosphatase domain containing 1 [Source:NCBI gene;Acc:641570])

HSP 1 Score: 92.0485 bits (227), Expect = 3.233e-20
Identity = 90/317 (28.39%), Postives = 146/317 (46.06%), Query Frame = 1
Query:  202 LLSASVKISYKAGAIVRKVMSSGNL-----GIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXX-------XXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNV----LTTTRGHGTNIVNQALEACG-PTEIIRVGGCGHKVLLML------EGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIP 1083
            LL+ S+  + + G  V+++     L     G   +G ++  T  D  +   +   +++ FP I V  EE  +        +E E T    V  +  P ++            + I VW+DPLD T EYT+ L+++VT ++ V+V+G PV GVIH+PF+      G +++   G G          +N AP +  N     +  +R H   + +    A G  TEII  GG G+K L +L      +     YI  +   KKWD CA +A+L+  GG +T + G    Y       N  G+LA+ K D H+  + ++P
Sbjct:   50 LLALSIDAAVQGGREVKRIREDNTLEEKSKGKTKEGASEKYTLGDLNSHRKMYYLIKNTFPNIQVNSEEHAN--------AEGEAT----VWTRMIPEDILAKVSGGKEIPAEKITVWIDPLDATQEYTENLLKYVTTMVCVAVDGEPVIGVIHKPFT------GYTVWGFVGEG----------SNVAPRDSYNTNSPKVIVSRSHAGKVKSFVQTAFGNNTEIIPAGGAGYKALALLNPTDDKQETADIYIHVTY-IKKWDICAGDAILKSLGGQMTTLKGEQIDYSG--LEGNKGGLLASMKVD-HKALVKRLP 334          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Xenopus
Match: ptprf (protein tyrosine phosphatase receptor type F [Source:Xenbase;Acc:XB-GENE-495325])

HSP 1 Score: 268.855 bits (686), Expect = 1.008e-86
Identity = 140/311 (45.02%), Postives = 209/311 (67.20%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHFL 1107
            L+++L++++  ++ KAG IVR VMS+G+LGI++K G NDLQT ADR  Q  I  SL  +FP + +IGEE  D   ++++ S L L   + +L  TCP+    +  ++IVVWVDPLDGT EYT+GL++HVTVLIG++  G+ + GVI+QP+    + N+   GR+I+ + G+G FGFE +      AP    +++TTTR H + +VN  + A  P +++RVGG G+K++ ++EG+   Y+FAS GCKKWDTCAPEA+L   GG LTD+ G PF Y++DV   NS GVLA  +     +Y S++P +VK+  +
Sbjct:   28 LLMKLVASAYSVAEKAGTIVRNVMSAGDLGIVEKTGANDLQTAADRLVQQSICSSLAKKFPKLTIIGEE--DLPSEEVEDSLLALGQSEDILKHTCPSQYSGIKEEEIVVWVDPLDGTKEYTEGLLDHVTVLIGIAYGGKAIAGVINQPYYNYQAGNNAVLGRTIWGVLGIGAFGFELK-----EAP-AGQHIITTTRSHSSKLVNDCIAAINPDKVVRVGGAGNKIIQLIEGQASAYVFASPGCKKWDTCAPEAILHAVGGQLTDIHGNPFQYQKDVKHMNSAGVLAALRN--FDYYFSRVPDSVKQALV 328          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Xenopus
Match: ptprf (protein tyrosine phosphatase receptor type F [Source:Xenbase;Acc:XB-GENE-495325])

HSP 1 Score: 268.47 bits (685), Expect = 1.108e-86
Identity = 140/311 (45.02%), Postives = 209/311 (67.20%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHFL 1107
            L+++L++++  ++ KAG IVR VMS+G+LGI++K G NDLQT ADR  Q  I  SL  +FP + +IGEE  D   ++++ S L L   + +L  TCP+    +  ++IVVWVDPLDGT EYT+GL++HVTVLIG++  G+ + GVI+QP+    + N+   GR+I+ + G+G FGFE +      AP    +++TTTR H + +VN  + A  P +++RVGG G+K++ ++EG+   Y+FAS GCKKWDTCAPEA+L   GG LTD+ G PF Y++DV   NS GVLA  +     +Y S++P +VK+  +
Sbjct:   19 LLMKLVASAYSVAEKAGTIVRNVMSAGDLGIVEKTGANDLQTAADRLVQQSICSSLAKKFPKLTIIGEE--DLPSEEVEDSLLALGQSEDILKHTCPSQYSGIKEEEIVVWVDPLDGTKEYTEGLLDHVTVLIGIAYGGKAIAGVINQPYYNYQAGNNAVLGRTIWGVLGIGAFGFELK-----EAP-AGQHIITTTRSHSSKLVNDCIAAINPDKVVRVGGAGNKIIQLIEGQASAYVFASPGCKKWDTCAPEAILHAVGGQLTDIHGNPFQYQKDVKHMNSAGVLAALRN--FDYYFSRVPDSVKQALV 319          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Xenopus
Match: cd40lg (CD40 ligand (TNF superfamily, member 5, hyper-IgM syndrome) [Source:Xenbase;Acc:XB-GENE-489737])

HSP 1 Score: 102.064 bits (253), Expect = 2.304e-23
Identity = 91/311 (29.26%), Postives = 152/311 (48.87%), Query Frame = 1
Query:  199 RLLSASVKISYKAGAIVRKVMSSGNL-----GIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACG-PTEIIRVGGCGHKVLLML------EGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVK 1095
             LL+ SV+ +   G  V+KV  S +L     G   +G +D  T  D  +   +   +++ FP + V  EE ++  ++   + +  + DD   + +   T   +V  + I +W+DPLD T EYT+ L+ +VT ++ V+VNG+PV GVIH+PF+      G + +A+   G    ++R     N+ +E +     +R H   +     +  G  TEII  GG G+KVL +L      +     YI  +   KKWD CA  A+L   GG +T + G    Y    +  N  G+LA+   D H   + K+ + ++
Sbjct:   59 ELLAVSVRAAELGGLEVKKVRESNSLNEKAKGKTMEGADDKMTSGDVLSNKKMYHLIKNAFPALKVNTEEKVEADDEDAVSWDRNIPDD---IKEQIKTK--HVASESITMWIDPLDATQEYTENLVNYVTTMVCVAVNGKPVIGVIHKPFT------GFTAWAMLDGGS-SIKKR-----NSYNEKTPTFIVSRSHSGEVKEVTRQTFGNKTEIISAGGAGYKVLSLLDVTDDKQETADVYIHVTY-IKKWDICAGNAILNALGGQMTTLKGEEIMYTG--SELNKGGLLASIGMD-HGVLVEKLSEKLQ 348          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Xenopus
Match: foxn1 (forkhead box N1 [Source:Xenbase;Acc:XB-GENE-954872])

HSP 1 Score: 67.0106 bits (162), Expect = 1.766e-11
Identity = 50/182 (27.47%), Postives = 76/182 (41.76%), Query Frame = 1
Query:  526 PLDGTSEYTQGL-------------IEHVTVLIGVSVN--GRPVGGVIHQPFSPNDN----NKGRSIYALEGMGCFGFERRWDVTNNAPDE-------------HSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDM 975
            P+D T +Y +G              ++ VTVLIGV +   G P+ GVI+QPF+  D      K    + L  M        +  +    DE             +S    T+     +I+N     CG   +    G G+K L ++ G    Y+F+     KWD CAP A+L+  GG + D+
Sbjct:  153 PIDSTYQYIKGFADTKTNNGIYSKGLQCVTVLIGVFLTDTGLPIMGVINQPFATRDKVTLRWKSHVYWGLSYMDINICSLNFSTSAGTNDETNYCTSDNGSAARNSYSAVTSSAEAKDILNSLSRVCGKN-VYFAAGAGYKCLCVILGLVDFYVFSEDTTFKWDCCAPHAILKSLGGGILDL 333          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Xenopus
Match: nle1 (notchless homolog 1 [Source:Xenbase;Acc:XB-GENE-984059])

HSP 1 Score: 51.9878 bits (123), Expect = 7.676e-7
Identity = 68/271 (25.09%), Postives = 105/271 (38.75%), Query Frame = 1
Query:  205 LSASVKISYKAGAIVRKVMSSGNLGIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVL----LMLEGRCH-----GYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPF 990
            +  +V+++ +AG +++K ++          V DL T+ D   +  I+ +L  +FP    IGEE+          S+  LTD         PT +            DP+DGT  +       V V IG +VN     GVI+          G      +G G F  E R  VTN     ++ +LT   G   +     L      +++     G +V+    L L   CH        +   G   WD  A   ++REAGG + D  G P 
Sbjct:   41 METAVQLALRAGQVIKKALTEEKRVSTKTSVVDLVTETDHFVEELIISALREKFPLHRFIGEESTSAG------SKCVLTDS--------PTWII-----------DPIDGTCNFVHRF-PPVAVSIGFAVNRELEFGVIYH------CTNGNLYTGRKGHGAFCNEERLHVTNETGIRNALILTEI-GPKRDPATLKLFLGNMEKLLTFQAHGIRVIGSSTLAL---CHIASGAADAYYQYGLHCWDLAAATVIIREAGGVVIDTTGGPL 275          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Mouse
Match: Bpnt1 (bisphosphate 3'-nucleotidase 1 [Source:MGI Symbol;Acc:MGI:1338800])

HSP 1 Score: 238.81 bits (608), Expect = 1.764e-75
Identity = 130/314 (41.40%), Postives = 198/314 (63.06%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDD---QFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHFL 1107
            +++RL++++  I+ KAG IVR V++ G+LGI+ K    DLQTKADR  Q  I  SL  +FP + +IGEE +   E      + EL +D   + +L Q CP+    +  +D+VVWVDPLDGT EYT+GL+++VTVLIG++  G+ + G+I+QP+    +  D   GR+I+ + G+G FGF+ +      AP    +++TTTR H   +V   + A  P  ++RVGG G+K++ ++EG+   Y+FAS GCKKWDTCAPE +L   GG LTD+ G    Y ++V   NS GVLA  +   +++Y S +P++VK   +
Sbjct:    7 VLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRLVQMSICSSLARKFPKLTIIGEEDLPPGE-----VDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAALGRTIWGVLGLGAFGFQLK-----EAP-AGKHIITTTRSHSNQLVTDCISAMNPDTVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNALQYNKEVKHMNSAGVLAALRN--YEYYASHVPESVKNALI 307          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Mouse
Match: Bpnt1 (bisphosphate 3'-nucleotidase 1 [Source:MGI Symbol;Acc:MGI:1338800])

HSP 1 Score: 236.498 bits (602), Expect = 2.610e-74
Identity = 131/329 (39.82%), Postives = 199/329 (60.49%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDD---QFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNK-------------------GRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHFL 1107
            +++RL++++  I+ KAG IVR V++ G+LGI+ K    DLQTKADR  Q  I  SL  +FP + +IGEE +   E      + EL +D   + +L Q CP+    +  +D+VVWVDPLDGT EYT+GL+++VTVLIG++  G+ + G+I+QP+    NN+                   GR+I+ + G+G FGF+ +      AP    +++TTTR H   +V   + A  P  ++RVGG G+K++ ++EG+   Y+FAS GCKKWDTCAPE +L   GG LTD+ G    Y ++V   NS GVLA  +   +++Y S +P++VK   +
Sbjct:    7 VLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRLVQMSICSSLARKFPKLTIIGEEDLPPGE-----VDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQNNEKEKLREHGNEAQAGPDAALGRTIWGVLGLGAFGFQLK-----EAP-AGKHIITTTRSHSNQLVTDCISAMNPDTVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNALQYNKEVKHMNSAGVLAALRN--YEYYASHVPESVKNALI 322          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Mouse
Match: Bpnt1 (bisphosphate 3'-nucleotidase 1 [Source:MGI Symbol;Acc:MGI:1338800])

HSP 1 Score: 194.512 bits (493), Expect = 4.142e-59
Identity = 106/263 (40.30%), Postives = 162/263 (61.60%), Query Frame = 1
Query:  340 IVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDD---QFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHFL 1107
            I  SL  +FP + +IGEE +   E      + EL +D   + +L Q CP+    +  +D+VVWVDPLDGT EYT+GL+++VTVLIG++  G+ + G+I+QP+    +  D   GR+I+ + G+G FGF+ +      AP    +++TTTR H   +V   + A  P  ++RVGG G+K++ ++EG+   Y+FAS GCKKWDTCAPE +L   GG LTD+ G    Y ++V   NS GVLA  +   +++Y S +P++VK   +
Sbjct:    3 ICSSLARKFPKLTIIGEEDLPPGE-----VDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAALGRTIWGVLGLGAFGFQLK-----EAP-AGKHIITTTRSHSNQLVTDCISAMNPDTVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNALQYNKEVKHMNSAGVLAALRN--YEYYASHVPESVKNALI 252          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Mouse
Match: Impad1 (inositol monophosphatase domain containing 1 [Source:MGI Symbol;Acc:MGI:1915720])

HSP 1 Score: 99.7525 bits (247), Expect = 1.129e-22
Identity = 92/319 (28.84%), Postives = 150/319 (47.02%), Query Frame = 1
Query:  202 LLSASVKISYKAGAIVRKVMSSGNL-----GIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSP---------NDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACG-PTEIIRVGGCGHKVLLML------EGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVK 1095
            +L+ +V  + + G  VR+V  S  L     G   +G +D  T  D  +   +   L+  FP + +  EE +D +++++     ++ +D  +L +        V  + + VW+DPLD T EYT+ L ++VT ++ V+VNG+PV GVIH+PFS            N K RS Y                     +E +  +  +R H   +   AL+  G  T II  GG G+KVL +L      + +   YI  +   KKWD CA  A+L+  GG++T + G   +Y          G+LA+ + + HQ  + K+P   K
Sbjct:   64 MLAVAVLAAERGGDEVRRVRESNVLHEKSKGKTREGADDKMTSGDVLSNRKMFYLLKTAFPNVQINTEEHVDASDKEVIVWNRKIPED--ILKEIAAPK--EVPAESVTVWIDPLDATQEYTEDLRKYVTTMVCVAVNGKPVLGVIHKPFSEYTAWAMVDGGSNVKARSSY---------------------NEKTPKIIVSRSHAGMVKQVALQTFGNQTSIIPAGGAGYKVLALLDVPDMTQEKADLYIHVTY-IKKWDICAGNAILKALGGHMTTLNGEEISYTGSDGIEG--GLLASIRMN-HQALVRKLPDLEK 353          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Mouse
Match: Bpnt1 (bisphosphate 3'-nucleotidase 1 [Source:MGI Symbol;Acc:MGI:1338800])

HSP 1 Score: 67.3958 bits (163), Expect = 9.971e-14
Identity = 34/75 (45.33%), Postives = 50/75 (66.67%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAE 411
            +++RL++++  I+ KAG IVR V++ G+LGI+ K    DLQTKADR  Q  I  SL  +FP + +IGEE +   E
Sbjct:    7 VLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRLVQMSICSSLARKFPKLTIIGEEDLPPGE 81          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. UniProt/SwissProt
Match: sp|Q3ZCK3|BPNT1_BOVIN (3'(2'),5'-bisphosphate nucleotidase 1 OS=Bos taurus OX=9913 GN=BPNT1 PE=2 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 2.891e-78
Identity = 135/315 (42.86%), Postives = 206/315 (65.40%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKG-VNDLQTKADREAQACIVDSLEHRFPGICVIGEEAI--DDAEQKLQTSELELTDDQF--VLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHFL 1107
            +++RL++++  I+ KAG IVR+V++ G+LGII+K    DLQTKADR  Q  I  SL  +FP + +IGEE +  +D +Q+L      + D Q+  +L Q CP+    +  +D+VVWVDPLDGT EYT+GL+++VTVLIG++  G+ + GVI+QP+    +  D   GR+I+ + G+G FGF+ +      AP    +++TTTR H + +V   + A  P +++RVGG G+K++ ++EG+   Y+FAS GCKKWDTCAPE +L   GG LTD+ G    Y ++V   NS GVLAT +   + +Y S++PQ+VK   +
Sbjct:    7 VLMRLVASAYSIAQKAGTIVRRVIAEGDLGIIEKTCATDLQTKADRLVQVSICSSLARKFPKLTIIGEEDLPPEDVDQEL------IEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYQAGPDAVLGRTIWGVLGLGAFGFQLK-----EAP-AGKHIITTTRSHNSQLVTDCITAMNPDDVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNALQYNKEVKHMNSAGVLATLRN--YDYYASRVPQSVKNALV 307          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. UniProt/SwissProt
Match: sp|O95861|BPNT1_HUMAN (3'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapiens OX=9606 GN=BPNT1 PE=1 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 1.069e-76
Identity = 130/311 (41.80%), Postives = 201/311 (64.63%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKG-VNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHFL 1107
            +++RL++++  I+ KAG IVR+V++ G+LGI++K    DLQTKADR AQ  I  SL  +FP + +IGEE  D   +++    +E +  + +L Q CP+    +  +D+VVWVDPLDGT EYT+GL+++VTVLIG++  G+ + GVI+QP+    +  D   GR+I+ + G+G FGF+ +       P    +++TTTR H   +V   + A  P  ++RVGG G+K++ ++EG+   Y+FAS GCKKWDTCAPE +L   GG LTD+ G    Y +DV   NS GVLAT +   + +Y S++P+++K   +
Sbjct:    7 VLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEE--DLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLK-----EVP-AGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRN--YDYYASRVPESIKNALV 307          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. UniProt/SwissProt
Match: sp|Q9Z1N4|BPNT1_RAT (3'(2'),5'-bisphosphate nucleotidase 1 OS=Rattus norvegicus OX=10116 GN=Bpnt1 PE=1 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 3.384e-76
Identity = 128/311 (41.16%), Postives = 199/311 (63.99%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHFL 1107
            +++RL++++  I+ KAG IVR V++ G+LGI+ K    DLQTKADR  Q  I  SL  +FP + +IGEE +   E  +    +E    + +L Q CP+    +  +D+VVWVDP+DGT EYT+GL+++VTVLIG++  G+ + G+I+QP+    +  D   GR+I+ + G+G FGF+ +      AP    +++TTTR H   +V   + A  P  ++RVGG G+K++ ++EG+   Y+FAS GCKKWDTCAPE +L   GG LTD+ G P  Y+++V   NS GVLA  +   +++Y S++P++VK   +
Sbjct:    7 VLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRMVQMSICSSLSRKFPKLTIIGEEDLPPGE--VDQELIEDGQSEEILKQPCPSQYSAIKEEDLVVWVDPVDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAVLGRTIWGVLGLGAFGFQLK-----EAP-AGKHIITTTRSHSNKLVTDCIAAMNPDNVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNPLQYDKEVKHMNSAGVLAALRN--YEYYASRVPESVKSALI 307          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. UniProt/SwissProt
Match: sp|Q9Z0S1|BPNT1_MOUSE (3'(2'),5'-bisphosphate nucleotidase 1 OS=Mus musculus OX=10090 GN=Bpnt1 PE=1 SV=2)

HSP 1 Score: 238.81 bits (608), Expect = 1.234e-74
Identity = 130/314 (41.40%), Postives = 198/314 (63.06%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDD---QFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHFL 1107
            +++RL++++  I+ KAG IVR V++ G+LGI+ K    DLQTKADR  Q  I  SL  +FP + +IGEE +   E      + EL +D   + +L Q CP+    +  +D+VVWVDPLDGT EYT+GL+++VTVLIG++  G+ + G+I+QP+    +  D   GR+I+ + G+G FGF+ +      AP    +++TTTR H   +V   + A  P  ++RVGG G+K++ ++EG+   Y+FAS GCKKWDTCAPE +L   GG LTD+ G    Y ++V   NS GVLA  +   +++Y S +P++VK   +
Sbjct:    7 VLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRLVQMSICSSLARKFPKLTIIGEEDLPPGE-----VDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAALGRTIWGVLGLGAFGFQLK-----EAP-AGKHIITTTRSHSNQLVTDCISAMNPDTVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNALQYNKEVKHMNSAGVLAALRN--YEYYASHVPESVKNALI 307          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. UniProt/SwissProt
Match: sp|Q869K3|BPNT1_DICDI (3'(2'),5'-bisphosphate nucleotidase 1 OS=Dictyostelium discoideum OX=44689 GN=bpnt1 PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 3.000e-45
Identity = 111/305 (36.39%), Postives = 168/305 (55.08%), Query Frame = 1
Query:  193 IIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF------SPNDNNK--GRSIYALEGMG--CFGFERRWDVTNNAPDEHSNV-LTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNR-SNSYGVLATAKKDWHQFYL 1071
            I+ L SA +K++ ++G I+R V  SG+LGI  K V+D  TKAD  +Q  I+ SL   +  I ++GEE  +      +     L +D+  + + CP     + IDD+++++DPLD T E+T G +  V  LIG+S  G+P+ G+I+QPF         D +K  GR+I+A+ G G    G + R      AP++   V LTTT  H  + V QA++A  P +++R GG G+K LL++E +   Y+F + G K WD C P A+L   GG LTD  G    Y  D  +  N  G++ T     HQ Y+
Sbjct:    7 ILELTSACIKLAQESGDIIRDVFKSGSLGIEMKSVDDPMTKADLLSQQHIIGSLRTIWSDIKIVGEEQCEIPTIDKKPPIDLLANDKDCIEK-CPEEFKQLPIDDLIIFIDPLDATREFTLGRVGCVMTLIGISFKGKPIAGIIYQPFVDCNGDGTTDQSKWVGRTIWAIVGGGIPVKGIKDR-----RAPEDVGKVILTTTASHFNDKVQQAVDAIKPDKLLRAGGAGYKSLLVIENQADVYVFPTVGSKLWDICGPHAILLAVGGKLTDPQGNDIIYSTDPEKIENKNGIIITISN--HQKYI 303          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. TrEMBL
Match: V3ZYJ6 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_127279 PE=4 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 7.484e-100
Identity = 162/308 (52.60%), Postives = 214/308 (69.48%), Query Frame = 1
Query:  187 PLIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKE 1098
            PL++R++SASV +S++AG I+R VM  G LGI++KG ND QT+ADR AQ CIV SL  +FP + + GEE +D  E K++   +E   D+ VL + CP  L NV  ++IV+WVDPLDGT+EYTQG ++HVTVLIGV+V G  VGGVI+QP+     P +  +GR I+ + G+  FGF      T+ +P    N++TT+R H   IV +++EAC PTE++RVGG GHKVLL++EG+ H Y+FAS GCKKWDTCAPEAVL   GG LTDM G    Y + V + NS GVLAT  K  H +Y+ KIP  VKE
Sbjct:    3 PLVMRIISASVAVSHRAGRIIRDVMDKGQLGIVEKGKNDFQTQADRSAQRCIVASLHRQFPKVSIFGEEDLDPTE-KIEPDFIETNYDEEVLTKNCPEYLQNVTDEEIVIWVDPLDGTAEYTQGYLDHVTVLIGVAVKGTAVGGVIYQPYYNYQEPPEVKRGRCIWGVVGLDSFGF------THTSPPADKNIITTSRSHSNRIVTESVEACEPTEVVRVGGAGHKVLLLIEGKVHAYVFASPGCKKWDTCAPEAVLHAVGGTLTDMHGNKIYYHKGVQKRNSGGVLATLSK--HNWYVDKIPDHVKE 301          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. TrEMBL
Match: A0A2C9JJ03 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106056967 PE=4 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 1.788e-99
Identity = 165/311 (53.05%), Postives = 218/311 (70.10%), Query Frame = 1
Query:  187 PLIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHFL 1107
            PL++RLL+ASV +SYKAG I+R ++ +G LGII+KG NDLQT+ADR AQ CIV +L   FP + + GEE++D A  ++    +    D  VL+  CPT   +V  D +VVWVDPLDGT+E+TQGL++HVTVLIGV+VNG   GGVI+QP+       D   GR I+ L G+G FGF+ +       P    N++TTTR H   +V +A+ +C PT+IIRVGG GHKV+L+LEG+ H Y+FAS GCKKWDTCAPEAVL   GG+LTD+LG+P  Y  +V R+NS GVLAT     HQ+Y+ KIP  +KE+F+
Sbjct:   10 PLVMRLLAASVSVSYKAGNIIRDILKTGELGIIEKGRNDLQTEADRAAQRCIVATLHKHFPKVAIFGEESLDPA-IRIPEDYIVKDFDPEVLSHPCPTGYKDVTDDQVVVWVDPLDGTAEFTQGLLDHVTVLIGVAVNGEAKGGVIYQPYYNYQEGPDATLGRCIWGLVGLGAFGFQPQ------NPPVGKNLITTTRSHSDRMVTEAVNSCEPTDIIRVGGAGHKVVLLLEGKVHAYVFASKGCKKWDTCAPEAVLHAIGGHLTDLLGKPILYYANVQRANSGGVLATLHN--HQWYVDKIPAEIKENFI 311          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. TrEMBL
Match: A0A0B7AE85 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF109726 PE=4 SV=1)

HSP 1 Score: 308.531 bits (789), Expect = 9.851e-99
Identity = 159/310 (51.29%), Postives = 217/310 (70.00%), Query Frame = 1
Query:  187 PLIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHF 1104
            PL++R+L+ASV +S+KAG+I+R ++ +GNLGI++KG NDLQT+ADR AQ  IV +L  +FP + + GEE++D  E K+    +    DQ VL   CP     V  D +V+WVDPLDGT+E+T+GL++HVTVLIGV++NG   GGVI+QP+       +   GR I+ L G+G FGF      T  +P  + NV+TTTR H   IV +A+ +C PT+II+VGG GHKVLL++EG+ H Y+FAS GCKKWDTCAPEAVL   GG+LTD++G+P  Y   V R N+ GVLAT +   HQ+Y+ KIPQ +K +F
Sbjct:   10 PLVMRILAASVSVSHKAGSIIRDILKTGNLGIVEKGKNDLQTEADRAAQRSIVATLHKQFPKVAIFGEESLDPIE-KIPDDYIVKELDQDVLAHACPDLYKEVTSDQVVIWVDPLDGTAEFTEGLLDHVTVLIGVAINGEAKGGVIYQPYYNYQEGAEARLGRCIWGLIGLGSFGF------TQMSPPANKNVITTTRSHADWIVTEAVNSCEPTDIIKVGGAGHKVLLLIEGKVHAYVFASKGCKKWDTCAPEAVLHAIGGHLTDLMGKPILYHEKVPRKNAGGVLATLQN--HQWYVDKIPQNIKSNF 310          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. TrEMBL
Match: A0A482WC15 (3'(2'),5'-bisphosphate nucleotidase 1 OS=Asbolus verrucosus OX=1661398 GN=BDFB_005043 PE=4 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 1.088e-98
Identity = 163/309 (52.75%), Postives = 216/309 (69.90%), Query Frame = 1
Query:  187 PLIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTD-DQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFS--PNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHF 1104
            P+++RLL++SV  + +AG I+R +MS G+LGI+DKG+NDLQT+ADR AQ CIV SL  ++P + +IGEE   + E     S+  +TD DQ V+++ CPT   ++  DD+VVWVDPLDGTSEYTQGL+EHVTVL+G+SV GRP+ GVIHQP+    + N+ GR+I+ L GMG  GF  +       P     ++TTTR H  N V +AL++  P EIIRVGG GHKVL+++EG+ H Y+FAS GCKKWDTCAPEAVL  +GG LTDM G P+ Y ++V   N  GV AT +   H+  LSKIPQ V +  
Sbjct:    6 PMVLRLLASSVTAANRAGKIIRDIMSRGDLGIVDKGINDLQTEADRSAQRCIVASLTQQYPNLTIIGEEGATNCEVP---SDWIVTDYDQTVISEQCPTEYSHITKDDVVVWVDPLDGTSEYTQGLLEHVTVLVGLSVKGRPIAGVIHQPYYDYKSGNSLGRTIWGLVGMGVGGFNPQ------NPPSGKLIVTTTRSHSDNTVQKALDSLNPDEIIRVGGAGHKVLMLIEGKAHAYVFASKGCKKWDTCAPEAVLVASGGKLTDMHGLPYEYGKNVQHPNVGGVFATVRGIDHEELLSKIPQEVTDKL 305          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. TrEMBL
Match: Q0GU40 (Biphosphate nucleotidase OS=Paracentrotus lividus OX=7656 GN=BPNT PE=2 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 1.282e-98
Identity = 163/311 (52.41%), Postives = 223/311 (71.70%), Query Frame = 1
Query:  181 DIPLIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKGV--NDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF---SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKE 1098
            D+PL ++++S++  I+ KAG I+R +M +G+LG++ K    +D QT+ADR+AQ CIV SL+ RFPGI VIGEE + ++   L    +E+ D + VL++ CP +L +V++ DIVVWVDP+DGT EYTQG ++HVTVLIGV+VNG  VGGVIHQP+      D+  GR+++ + G+GCFGF      T+    E   V+TTTR HGT  V + ++A  PTEI+RVGG GHKVLL LEG    YIFAS GCKKWDTCAPEA+L+ AGG LTD+ G  + YE+D+ R N+ GV+AT +   H FYLSK+PQ++K+
Sbjct:    6 DVPLFMQVMSSAHAIASKAGMIIRDIMKAGDLGVVLKNQREDDPQTEADRKAQRCIVSSLQTRFPGITVIGEEDLIESATDL----IEMGDSEDVLSKACPDSLKSVSLADIVVWVDPVDGTKEYTQGFLDHVTVLIGVAVNGESVGGVIHQPYYNYQVPDSKMGRTMWGVVGLGCFGF------THKQLPESERVITTTRSHGTQAVQETIDAMCPTEILRVGGAGHKVLLCLEGTASAYIFASPGCKKWDTCAPEALLKAAGGTLTDVHGNKYRYEKDIKRMNTGGVIATYRS--HDFYLSKVPQSIKD 304          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Cavefish
Match: bpnt1 (bisphosphate nucleotidase 1 [Source:ZFIN;Acc:ZDB-GENE-040718-46])

HSP 1 Score: 260.766 bits (665), Expect = 7.106e-84
Identity = 138/306 (45.10%), Postives = 201/306 (65.69%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSP----NDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTV 1092
            +++RLL+++  ++ K+G IVR+V+ SG+LGI++K G NDLQT ADR  Q  I  SL   FP I +IGEE  D   + ++   +E      +L + CP    ++  +++VVWVDPLDGT EYT+GL++HVTVLIG++  G+ + GVI+QPF       D   GR+++ + G+G FGF+ +     + P E   ++TTTR H   +V   ++A  P ++IRVGG G+K++ ++EG+   Y+FAS GCKKWDTCAPEA+L   GG LTDM G+ + Y+ DV   NS GVLAT K   HQ+Y S++PQ V
Sbjct:   22 VVMRLLASAYTVAEKSGKIVRRVLHSGDLGIVEKTGANDLQTLADRLVQKSICASLSKSFPKITIIGEE--DLPSEAVEDDLIETGQYDVILQKQCPDEYSSLKEEELVVWVDPLDGTKEYTEGLLDHVTVLIGIAYKGKAIAGVINQPFYNYQMGADATLGRTLWGILGLGAFGFQLQ-----DVP-EGKRIVTTTRSHSNKLVIDTVQAMEPHDVIRVGGAGNKIIQLVEGKASAYVFASPGCKKWDTCAPEAILHAVGGTLTDMHGKAYRYDADVKHMNSAGVLATLKN--HQYYASRVPQAV 317          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Cavefish
Match: bpnt1 (bisphosphate nucleotidase 1 [Source:ZFIN;Acc:ZDB-GENE-040718-46])

HSP 1 Score: 245.743 bits (626), Expect = 7.690e-78
Identity = 137/328 (41.77%), Postives = 199/328 (60.67%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQG----------------------LIEHVTVLIGVSVNGRPVGGVIHQPFSP----NDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTV 1092
            +++RLL+++  ++ K+G IVR+V+ SG+LGI++K G NDLQT ADR  Q  I  SL   FP I +IGEE  D   + ++   +E      +L + CP    ++  +++VVWVDPLDGT EYT+                       L++HVTVLIG++  G+ + GVI+QPF       D   GR+++ + G+G FGF+       + P E   ++TTTR H   +V   ++A  P ++IRVGG G+K++ ++EG+   Y+FAS GCKKWDTCAPEA+L   GG LTDM G+ + Y+ DV   NS GVLAT K   HQ+Y S++PQ V
Sbjct:   22 VVMRLLASAYTVAEKSGKIVRRVLHSGDLGIVEKTGANDLQTLADRLVQKSICASLSKSFPKITIIGEE--DLPSEAVEDDLIETGQYDVILQKQCPDEYSSLKEEELVVWVDPLDGTKEYTEAARLMDSPVVVQKQLQVHRAPTRLLDHVTVLIGIAYKGKAIAGVINQPFYNYQMGADATLGRTLWGILGLGAFGFQ-----LQDVP-EGKRIVTTTRSHSNKLVIDTVQAMEPHDVIRVGGAGNKIIQLVEGKASAYVFASPGCKKWDTCAPEAILHAVGGTLTDMHGKAYRYDADVKHMNSAGVLATLKN--HQYYASRVPQAV 339          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Cavefish
Match: IMPAD1 (inositol monophosphatase domain containing 1 [Source:NCBI gene;Acc:103046746])

HSP 1 Score: 94.3597 bits (233), Expect = 4.406e-21
Identity = 84/307 (27.36%), Postives = 147/307 (47.88%), Query Frame = 1
Query:  202 LLSASVKISYKAGAIVRKVMSSGNL-----GIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAID-DAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACG-PTEIIRVGGCGHKVLLMLEG------RCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIP 1083
            LL+ S++ + + G  V+++     L     G   +G N++ T  D  +   +   +++ +P + V  EE  + D E  +    +       +LN+     L   +   + +   PLD T EYT+ L ++VT ++ V+V+G PV GVIH+PF+      G + + + G G    + R    +N P      +  +R H   + +   +A G  T+II  GG G+KVL +L+       +   YI  +   KKWD CA  A+L+  GG++T + G    Y    +  N  GVLA+   D H+  ++++P
Sbjct:   50 LLALSLEAAVQGGREVKRIREEDTLEQRSKGKTKEGANEMLTLGDLNSHRKMYYLIKNTYPYLQVNSEEHDNSDGEATIWMRNIP----SEILNKIPAGKLVPADSVTVWID--PLDATQEYTENLRQYVTTMVCVAVDGDPVIGVIHKPFT------GYTAWGMVGEGG-NIKPRDSYNSNNPK-----VIVSRSHSGRVKSFVQQAFGNNTDIIPAGGAGYKVLALLDASDEEYEKADMYIHVTF-IKKWDICAGNAILKALGGHMTTLKGEEIDYSG--SEKNPGGVLASVNID-HKAVVNRLP 334          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Cavefish
Match: si:ch211-160o17.2 (inositol polyphosphate-1-phosphatase [Source:NCBI gene;Acc:103037924])

HSP 1 Score: 74.3294 bits (181), Expect = 4.515e-14
Identity = 54/171 (31.58%), Postives = 80/171 (46.78%), Query Frame = 1
Query:  526 PLDGTSEYTQGLIEHVT-------------VLIGVSV--NGRPVGGVIHQPFSPNDNNK----GRSIYALE--GMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDM 975
            P+DGTS+Y +G  E +T             VLIG  +   G PV GVI+QPF+  D+      G+  + +   G+    F           D  S VL+++      +V  AL       +    G G+K+L ++ G    Y+ + A   KWD+CAP AVLR  GG ++DM
Sbjct:  181 PIDGTSQYIEGKEEEMTDEGFCSSGLPCALVLIGAYLRSTGEPVMGVINQPFNHKDSTGKGWVGQHFWGVSYGGVNACSFPNPKLSLGKKRDALSVVLSSSE---RQVVKDALAPLCNCHLTYASGAGYKILCVILGLVDVYVLSEASTYKWDSCAPHAVLRALGGGVSDM 348          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Cavefish
Match: impa2 (inositol monophosphatase 2 [Source:NCBI gene;Acc:103044696])

HSP 1 Score: 53.5286 bits (127), Expect = 1.209e-7
Identity = 71/269 (26.39%), Postives = 102/269 (37.92%), Query Frame = 1
Query:  205 LSASVKISYKAGAIVRKVMSSGNLGIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLT---TTRGHGTNIV---NQALEACGPTEIIRVGGCGHKVLLML-EGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPF 990
            L  +V+I+  AG +V++ +             DL T+AD++ +  I+ +L  RFP    IGEE+    E+ +      LTD         PT +           +DP+DGT  +       V V IG +V      GVI+  F       G    A  G G F    R  V+       S +LT     R   T  +   N       P   +R+ G     L  +  G    Y      C  WD  A   ++REAGG + D  G P 
Sbjct:   10 LELAVRIARSAGQMVQEAVKQEKRVSSKSTPTDLVTEADQQVEDLIISTLRERFPSHRFIGEESSATGEKCV------LTDS--------PTWI-----------IDPIDGTCNFVHSF-PMVAVSIGFAVKKELEFGVIYHCFD------GTLYTARRGHGAFCNGVRLRVSQEKDVSKSLILTEIGAKRDPNTLEIFLGNMKKLLSAPVHGVRIIGSSTLALCHIASGAAEAYYQYGLHC--WDIAAAAVIIREAGGCVIDTTGGPL 244          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Sea Lamprey
Match: bpnt1 (bisphosphate nucleotidase 1 [Source:ZFIN;Acc:ZDB-GENE-040718-46])

HSP 1 Score: 248.44 bits (633), Expect = 5.785e-80
Identity = 138/311 (44.37%), Postives = 201/311 (64.63%), Query Frame = 1
Query:  178 MDIPLIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVK 1095
            M  PL++R+L+++ +++ +A  +VR V+ +G+LGI+ K  VNDLQTKADR AQ  I  SL  +FP + +IGEE +   E   Q  E    ++  +L   CP    NV  +++VVWVDPLDGT EYT+GL+++VTVLIG++  G+ + GVI+QPF    +      GR+++ L G+G FG+     V  + P     V+TTTR H   +V+  ++A  PT+++RVGG G+KVLL++EG+   Y+FAS GCKKWDTCAPEA+L   GG LTDM G  F Y ++V   NS GVLA      +++Y +++P T K
Sbjct:    3 MSGPLVLRVLASAGRVAERAAELVRSVLRTGDLGIVIKENVNDLQTKADRLAQQSICTSLALKFPKLTIIGEEDLPPGEVDAQMVEDGFMEE--ILGHKCPAEYENVKEEELVVWVDPLDGTKEYTEGLLDNVTVLIGIAYKGKAIAGVINQPFFNYQAGEGATLGRTVWGLLGLGAFGY-----VPASVP-AGKRVITTTRSHSNPVVSACVDAMEPTDVLRVGGAGNKVLLLIEGKASAYVFASLGCKKWDTCAPEAILHAVGGKLTDMHGNSFEYHKEVKHMNSAGVLAALTD--YEYYAARVPPTTK 303          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Sea Lamprey
Match: impad1 (inositol monophosphatase domain containing 1 [Source:NCBI gene;Acc:641570])

HSP 1 Score: 92.4337 bits (228), Expect = 7.613e-22
Identity = 67/196 (34.18%), Postives = 99/196 (50.51%), Query Frame = 1
Query:  526 PLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMG-CFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGG----CGHKVLLMLE------GRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKI 1080
            PLD T EYT  L+++VT ++ V++NG+PV GVIH+PF         +++   G G     ++R     ++P E S V   +R H  N+  QA  A G   +I   G     G+KVL +L+       +   YI  +   KKWD CA  A+L   GG++T + G    YE   +  N  G+LA+A  D H   L K+
Sbjct:   51 PLDATQEYTDNLVKYVTTMVCVAINGKPVIGVIHKPF------LKLTVWGFVGRGHSANVQQRH--AGHSPHE-SPVFIVSRSHAGNVARQAHAAFGNKSVIVPAGGAVNTGYKVLSLLDVTGDDSDKADVYIHTTL-IKKWDICAGNAILTALGGHMTTLRGEEIVYEG--SPKNEGGLLASATLD-HTLLLKKL 233          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Sea Lamprey
Match: si:ch211-160o17.2 (si:ch211-160o17.2 [Source:ZFIN;Acc:ZDB-GENE-141219-3])

HSP 1 Score: 58.9214 bits (141), Expect = 8.287e-10
Identity = 58/195 (29.74%), Postives = 85/195 (43.59%), Query Frame = 1
Query:  526 PLDGTSEYTQG---------LIEH----VTVLIGV--SVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGF---ERRWDVTNNAPD--EHSNVLTTTRGHGTNIVNQALEACGPTEIIR-VGGCGHKVLLMLEGRCHGYIFASAGCKK------WDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYG 1029
            P+D T++Y +G         + EH    VTVL+G     +G P+ GV++QPF   D   GR      G G +G      R       P   + S V++ + G    +    L   G +E +R V G G+K L + EG    Y+     C K      WD+CAP AVLR  GG + ++     +Y + V      G
Sbjct:  155 PIDSTNQYIEGASDDKGRGGVFEHGLQCVTVLVGAYGRHDGLPIMGVVNQPFVRRDPQTGR----WSGKGFWGLCYDGVRVSSIQGPPHSVDLSVVMSGSEGEHVRLAMGKL-CGGDSERVRLVAGAGYKALCVAEGFVSAYV-----CTKPKTTYAWDSCAPHAVLRSLGGGVANLRRCMASYRQGVTERGEEG 339          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Yeast
Match: INM2 (Inositol monophosphatase; involved in biosynthesis of inositol; enzymatic activity requires magnesium ions and is inhibited by lithium and sodium ions; inm1 inm2 double mutant lacks inositol auxotrophy [Source:SGD;Acc:S000002695])

HSP 1 Score: 47.7506 bits (112), Expect = 1.235e-6
Identity = 58/250 (23.20%), Postives = 88/250 (35.20%), Query Frame = 1
Query:  301 DLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQP-----FSPNDNNKG-----------------RSIYALEG-----MGCFG-FERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYL 966
            DL T  D++ ++ I ++L  ++P    IGEE       K+      + D                          P+DGT+ +  G     T L G++  G+PV GV+  P     F  +  N                   +S+ ALEG      G  G F+++ +   N   E    +   R  G+  +N    A G                ML+    G      GC  WD CA   +L EAGG +
Sbjct:   46 DLVTALDKQIESIIKENLTAKYPSFKFIGEETYVKGVTKITNGPTFIVD--------------------------PIDGTTNFIHGYPYSCTSL-GLAEMGKPVVGVVFNPHLNQLFHASKGNGAFLNDQEIKVSKRPLILQKSLIALEGGSERTEGSQGNFDKKMNTYKNLLSESGAFVHGFRSAGSAAMNICYVASG----------------MLDAYWEG------GCWAWDVCAGWCILEEAGGIM 246          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Nematostella
Match: EDO38164 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDS6])

HSP 1 Score: 240.736 bits (613), Expect = 1.350e-76
Identity = 146/316 (46.20%), Postives = 201/316 (63.61%), Query Frame = 1
Query:  184 IPLIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-----GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPF----SPNDNNK-GRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRS-NSYGVLATAKKDWHQFYLSKIPQTVKE 1098
            +P I+RL+S+SV I+ +AG+++R ++  G LGIIDK     G  D QT+ADR AQ CI+ SL  +FP + ++GEE   DA   L    L  + D  +L+  CP NL N+  +D+VVWVDP+DGT E+T+GL+ H TVLIGVS  GRPV GVIHQPF    S +D +K GR+++ + G+G FGF+     T   PD    ++TTTR H T  V  A+ A  P  +++VGG G+KVLL+L+G   GYIFAS G K WDTCA +A+L   GG LTD+ G    Y+ D     N  GV+A  ++  H +Y+  IP TV++
Sbjct:    5 VPFIVRLVSSSVSIANRAGSVIRDILKKGELGIIDKSAAGSGKFDPQTEADRAAQRCIIGSLLVQFPSLRIVGEEEGIDAND-LGDDLLVTSQDSSILDVKCPENLNNIKAEDVVVWVDPVDGTKEFTEGLLHHATVLIGVSYEGRPVAGVIHQPFFGHNSSSDLSKLGRTLWGINGLGAFGFK-----TKPIPDGR-RIITTTRSHLTQDVTDAIAAMKPESVLKVGGSGYKVLLLLDGDADGYIFASPGTKMWDTCACQAILEAVGGKLTDICGNEVVYDFDAESYLNRLGVVAALRE--HDWYIEMIPDTVRD 311          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Nematostella
Match: EDO35259 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLX4])

HSP 1 Score: 123.635 bits (309), Expect = 4.845e-32
Identity = 92/292 (31.51%), Postives = 144/292 (49.32%), Query Frame = 1
Query:  193 IIRLLSASVKISYKAGAIVRKVMSSGNL-----GIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFG-FERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEAC-GPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAK 1047
            I +LL+AS++++   G  VR V    NL     G   +GVND  T+ D ++   +       FP + V+    I      L  +EL+  +D++V     P +       +++VW+DPLD T EYT+ L+  VT ++ + VNG+PV GVIH+PF      + +S +A  G G       +  VT +  D  S  +  +R H   +   A +A  G   +I  GG G+KVL + +G    Y+  +   KKWD CA +A+LR  GG +T + G    Y      +N  G+LA  +
Sbjct:   45 IKQLLAASIQLAEDGGIAVRTVREQNNLSEKSKGKTKEGVNDPVTQGDLQSHRAMFYGFRKAFPSVKVLSSATI------LLNNELQNIEDEYV-----PVS-------NVLVWIDPLDATKEYTENLLHFVTTMVCIVVNGKPVAGVIHKPF------QKKSFWAWNGHGSSSNLNSKESVTKS--DMSSPRIIISRSHAGKVNATARKAFGGKAVVIPAGGAGYKVLSLFDGSADAYVHVTK-IKKWDICAGDAILRALGGRMTTLKGDDIIYTDPSKPANDQGLLAALR 309          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Nematostella
Match: EDO35565 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL18])

HSP 1 Score: 63.1586 bits (152), Expect = 6.688e-11
Identity = 49/169 (28.99%), Postives = 81/169 (47.93%), Query Frame = 1
Query:  526 PLDGTSEY--------TQGLIEH----VTVLIGV--SVNGRPVGGVIHQPF-SPNDNNK---GRSIYALEGMGCFGFE-RRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDM 975
            P+DGT++Y        T GL+      V VLIGV   + G+P+ GVI+QPF   N+  +   G   +     GC     +  +  NN  D+   +  T     T  V + L+  G +  + +   G+K+L +++     Y+ + A   KWDTCA  A++R  GG + ++
Sbjct:  157 PIDGTAQYMSGSHGVFTNGLLAQGLPCVCVLIGVYDEITGQPIAGVINQPFIKYNETTQTWTGGKTWGYSLPGCNRTSIKNINRENNNMDDRRTLTVTNSASETEDVIRKLKEDGIS-CLTMSTVGYKLLKVIDSTVDAYVLSRATSFKWDTCAAHAIIRAMGGGVVNL 324          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Medaka
Match: bpnt1 (3'(2'), 5'-bisphosphate nucleotidase 1 [Source:NCBI gene;Acc:101161770])

HSP 1 Score: 261.151 bits (666), Expect = 2.326e-83
Identity = 139/306 (45.42%), Postives = 205/306 (66.99%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPND----NNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTV 1092
            +++RL++++ K++ KAG+IVRKV+ SG LG+++K G NDLQT ADR AQ  I  SL   FP I +IGEE  D   +K++   +E   ++ +L ++CP    ++  +++VVWVDPLDGT EYT+GL+++VTVLIG++  GR + GVI+QPF           GR+++A+ G+G FGF+         P +   ++TTTR H   +V + + A  P ++IRVGG G+K++ ++EGR   Y+FASAGCKKWDTCAPEA+L   GG LTDM G  + Y  DV   NS GVLAT +   H++Y+S++P +V
Sbjct:   69 VVMRLVASAYKVAEKAGSIVRKVLHSGELGVVEKTGANDLQTLADRLAQKSICASLSRHFPNITIIGEE--DLPAEKVEEDLIEKGQEEEILQKSCPEEFQDLKEEELVVWVDPLDGTKEYTEGLLDNVTVLIGIAYGGRAIAGVINQPFYNYQLGPGATLGRTLWAVLGLGAFGFQ-----LQELPGDR-RIVTTTRSHSNKVVIECVHAMEPHKVIRVGGAGNKIIQLIEGRASAYVFASAGCKKWDTCAPEAILHAVGGKLTDMYGNAYCYHADVKHMNSAGVLATLRN--HEYYVSRVPPSV 364          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Medaka
Match: bpnt1 (3'(2'), 5'-bisphosphate nucleotidase 1 [Source:NCBI gene;Acc:101161770])

HSP 1 Score: 243.047 bits (619), Expect = 6.994e-77
Identity = 138/334 (41.32%), Postives = 205/334 (61.38%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQG----------------------------LIEHVTVLIGVSVNGRPVGGVIHQPFSPND----NNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTV 1092
            +++RL++++ K++ KAG+IVRKV+ SG LG+++K G NDLQT ADR AQ  I  SL   FP I +IGEE  D   +K++   +E   ++ +L ++CP    ++  +++VVWVDPLDGT EYT+                             L+++VTVLIG++  GR + GVI+QPF           GR+++A+ G+G FGF+ +       P +   ++TTTR H   +V + + A  P ++IRVGG G+K++ ++EGR   Y+FASAGCKKWDTCAPEA+L   GG LTDM G  + Y  DV   NS GVLAT +   H++Y+S++P +V
Sbjct:    7 VVMRLVASAYKVAEKAGSIVRKVLHSGELGVVEKTGANDLQTLADRLAQKSICASLSRHFPNITIIGEE--DLPAEKVEEDLIEKGQEEEILQKSCPEEFQDLKEEELVVWVDPLDGTKEYTEASRFLHLGAVTPIPHKGLNTSQFHSPILWLLDNVTVLIGIAYGGRAIAGVINQPFYNYQLGPGATLGRTLWAVLGLGAFGFQLQ-----ELPGDR-RIVTTTRSHSNKVVIECVHAMEPHKVIRVGGAGNKIIQLIEGRASAYVFASAGCKKWDTCAPEAILHAVGGKLTDMYGNAYCYHADVKHMNSAGVLATLRN--HEYYVSRVPPSV 330          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Medaka
Match: bpnt1 (3'(2'), 5'-bisphosphate nucleotidase 1 [Source:NCBI gene;Acc:101161770])

HSP 1 Score: 243.047 bits (619), Expect = 6.994e-77
Identity = 138/334 (41.32%), Postives = 205/334 (61.38%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQG----------------------------LIEHVTVLIGVSVNGRPVGGVIHQPFSPND----NNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTV 1092
            +++RL++++ K++ KAG+IVRKV+ SG LG+++K G NDLQT ADR AQ  I  SL   FP I +IGEE  D   +K++   +E   ++ +L ++CP    ++  +++VVWVDPLDGT EYT+                             L+++VTVLIG++  GR + GVI+QPF           GR+++A+ G+G FGF+ +       P +   ++TTTR H   +V + + A  P ++IRVGG G+K++ ++EGR   Y+FASAGCKKWDTCAPEA+L   GG LTDM G  + Y  DV   NS GVLAT +   H++Y+S++P +V
Sbjct:    7 VVMRLVASAYKVAEKAGSIVRKVLHSGELGVVEKTGANDLQTLADRLAQKSICASLSRHFPNITIIGEE--DLPAEKVEEDLIEKGQEEEILQKSCPEEFQDLKEEELVVWVDPLDGTKEYTEASRFLHLGAVTPIPHKGLNTSQFHSPILWLLDNVTVLIGIAYGGRAIAGVINQPFYNYQLGPGATLGRTLWAVLGLGAFGFQLQ-----ELPGDR-RIVTTTRSHSNKVVIECVHAMEPHKVIRVGGAGNKIIQLIEGRASAYVFASAGCKKWDTCAPEAILHAVGGKLTDMYGNAYCYHADVKHMNSAGVLATLRN--HEYYVSRVPPSV 330          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Medaka
Match: bpnt1 (3'(2'), 5'-bisphosphate nucleotidase 1 [Source:NCBI gene;Acc:101161770])

HSP 1 Score: 244.202 bits (622), Expect = 1.955e-76
Identity = 138/334 (41.32%), Postives = 204/334 (61.08%), Query Frame = 1
Query:  190 LIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDK-GVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQG----------------------------LIEHVTVLIGVSVNGRPVGGVIHQPFSPND----NNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTV 1092
            +++RL++++ K++ KAG+IVRKV+ SG LG+++K G NDLQT ADR AQ  I  SL   FP I +IGEE  D   +K++   +E   ++ +L ++CP    ++  +++VVWVDPLDGT EYT+                             L+++VTVLIG++  GR + GVI+QPF           GR+++A+ G+G FGF+         P +   ++TTTR H   +V + + A  P ++IRVGG G+K++ ++EGR   Y+FASAGCKKWDTCAPEA+L   GG LTDM G  + Y  DV   NS GVLAT +   H++Y+S++P +V
Sbjct:   69 VVMRLVASAYKVAEKAGSIVRKVLHSGELGVVEKTGANDLQTLADRLAQKSICASLSRHFPNITIIGEE--DLPAEKVEEDLIEKGQEEEILQKSCPEEFQDLKEEELVVWVDPLDGTKEYTEASRFLHLGAVTPIPHKGLNTSQFHSPILWLLDNVTVLIGIAYGGRAIAGVINQPFYNYQLGPGATLGRTLWAVLGLGAFGFQ-----LQELPGDR-RIVTTTRSHSNKVVIECVHAMEPHKVIRVGGAGNKIIQLIEGRASAYVFASAGCKKWDTCAPEAILHAVGGKLTDMYGNAYCYHADVKHMNSAGVLATLRN--HEYYVSRVPPSV 392          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Medaka
Match: impad1 (inositol monophosphatase domain containing 1 [Source:NCBI gene;Acc:101174377])

HSP 1 Score: 99.3673 bits (246), Expect = 7.774e-23
Identity = 93/315 (29.52%), Postives = 150/315 (47.62%), Query Frame = 1
Query:  199 RLLSASVKISYKAGAIVRKVMSSGNL-----GIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEE---AIDDA--EQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACG-PTEIIRVGGCGHKVLLMLE---------GRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIP 1083
             LL+ SV+ +   G  V++V +  +L     G   +G  +L T  D ++   + + L + FP + V  EE   A+D    ++K+    LE   +    +   P +        I VW+DPLD T EYT+ L+++VT ++ V+V GRPV GVIH PF+      G + +   G G    + R   + N P      +  +R H   +     +A G  T II  GG G+KVL +L+          +   Y+  +   KKWD CA  A+L+  GG++T + G    Y       N  G++AT  ++ H+F + K+P
Sbjct:   49 ELLAVSVEAAVLGGKEVKRVRNENSLNEKSKGETREGAKELLTTGDLQSHRKMFNLLSNTFPDVKVHSEERDNALDSVTWDKKIPAEILEKVKE----STEVPAD-------SITVWIDPLDATQEYTESLVKYVTTMVCVAVEGRPVIGVIHLPFT------GLTAWGFVGQGS-NVQARSSYSYNPPK-----VIVSRSHSGEVKKFIQDAFGNSTTIITAGGAGYKVLSLLDIAASDSDPMDQADVYVHITF-IKKWDICAGAALLKALGGHMTTLKGEDIDYSG--TPLNKGGLVATIGEN-HKFIIEKLP 336          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Planmine SMEST
Match: SMESG000014111.1 (SMESG000014111.1)

HSP 1 Score: 412.149 bits (1058), Expect = 1.319e-144
Identity = 213/216 (98.61%), Postives = 216/216 (100.00%), Query Frame = 1
Query:  178 MDIPLIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCPTNLCXXXXXXXXXXXXPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHGTNIVNQALEACGPTEI 825
            MDIPLIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAID+AEQKLQTSELELTDDQFVLNQTCPTNLCNVNIDDIVVWVDPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGFERRWDVTN+APDEHSNVLTTTRGHGTNIVNQALEACGPTE+
Sbjct:    1 MDIPLIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKGVNDLQTKADREAQACIVDSLEHRFPGICVIGEEAIDNAEQKLQTSELELTDDQFVLNQTCPTNLCNVNIDDIVVWVDPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGFERRWDVTNSAPDEHSNVLTTTRGHGTNIVNQALEACGPTEV 216          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Planmine SMEST
Match: SMESG000014107.1 (SMESG000014107.1)

HSP 1 Score: 181.8 bits (460), Expect = 1.214e-56
Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 1
Query:  862 MLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHFLQ 1110
            MLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHFLQ
Sbjct:    1 MLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSKIPQTVKEHFLQ 83          
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Planmine SMEST
Match: SMESG000065023.1 (SMESG000065023.1)

HSP 1 Score: 48.9062 bits (115), Expect = 5.055e-6
Identity = 44/178 (24.72%), Postives = 69/178 (38.76%), Query Frame = 1
Query:  526 PLDGTSEYTQGL--------------IEHVTVLIGV--SVNGRPVGGVIHQPFSPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSN------------VLTTTRGHGTNIVNQ-ALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTCAPEAVLREAGGYLTD 972
            P+D T EY  GL              I + TVLIG      G P  GVI QPF           ++ + +G +     W +  ++   +SN            ++T+ R      +N  ++E     ++    G G K+L ++       +   A   KWDTC P  +L   GG + D
Sbjct:  159 PIDSTKEYVNGLGLDGCDSSVFEGDSIRNATVLIGAYSKTTGIPFAGVICQPF-----------HSCDTVGLWTHSCYWGIHFDSISLYSNNIRKRIFSLPGKIITSYREADNLRLNMNSVENMKNWKVFGRYGAGCKLLSLITSEMDCCLVTKASTYKWDTCGPHGILLSIGGGIVD 325          
The following BLAST results are available for this feature:
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BPNT12.226e-7741.803'(2'), 5'-bisphosphate nucleotidase 1 [Source:HGN... [more]
BPNT12.226e-7741.803'(2'), 5'-bisphosphate nucleotidase 1 [Source:HGN... [more]
BPNT12.052e-6939.233'(2'), 5'-bisphosphate nucleotidase 1 [Source:HGN... [more]
BPNT17.398e-6940.963'(2'), 5'-bisphosphate nucleotidase 1 [Source:HGN... [more]
BPNT11.176e-5940.383'(2'), 5'-bisphosphate nucleotidase 1 [Source:HGN... [more]
back to top
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
bpnt-11.950e-6644.483'(2'), 5'-BisPhosphate NucleoTidase 1 homolog [S... [more]
gpap-13.621e-2730.61Golgi-resident PAp (PAP) 3-Phosphatase homolog [S... [more]
gpap-14.582e-2729.45Golgi-resident PAp (PAP) 3-Phosphatase homolog [S... [more]
back to top
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG77895.215e-8346.30gene:FBgn0039698 transcript:FBtr0085483[more]
CG157439.079e-2830.62gene:FBgn0030465 transcript:FBtr0333330[more]
CG157439.079e-2830.62gene:FBgn0030465 transcript:FBtr0346123[more]
CG157439.079e-2830.62gene:FBgn0030465 transcript:FBtr0073755[more]
Ipp1.958e-1130.49gene:FBgn0016672 transcript:FBtr0082865[more]
back to top
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bpnt14.647e-8143.83bisphosphate nucleotidase 1 [Source:ZFIN;Acc:ZDB-G... [more]
bpnt17.528e-7540.61bisphosphate nucleotidase 1 [Source:ZFIN;Acc:ZDB-G... [more]
bpnt12.047e-7339.42bisphosphate nucleotidase 1 [Source:ZFIN;Acc:ZDB-G... [more]
bpnt12.146e-6736.78bisphosphate nucleotidase 1 [Source:ZFIN;Acc:ZDB-G... [more]
impad13.233e-2028.39inositol monophosphatase domain containing 1 [Sour... [more]
back to top
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprf1.008e-8645.02protein tyrosine phosphatase receptor type F [Sour... [more]
ptprf1.108e-8645.02protein tyrosine phosphatase receptor type F [Sour... [more]
cd40lg2.304e-2329.26CD40 ligand (TNF superfamily, member 5, hyper-IgM ... [more]
foxn11.766e-1127.47forkhead box N1 [Source:Xenbase;Acc:XB-GENE-954872... [more]
nle17.676e-725.09notchless homolog 1 [Source:Xenbase;Acc:XB-GENE-98... [more]
back to top
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Bpnt11.764e-7541.40bisphosphate 3'-nucleotidase 1 [Source:MGI Symbol;... [more]
Bpnt12.610e-7439.82bisphosphate 3'-nucleotidase 1 [Source:MGI Symbol;... [more]
Bpnt14.142e-5940.30bisphosphate 3'-nucleotidase 1 [Source:MGI Symbol;... [more]
Impad11.129e-2228.84inositol monophosphatase domain containing 1 [Sour... [more]
Bpnt19.971e-1445.33bisphosphate 3'-nucleotidase 1 [Source:MGI Symbol;... [more]
back to top
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3ZCK3|BPNT1_BOVIN2.891e-7842.863'(2'),5'-bisphosphate nucleotidase 1 OS=Bos tauru... [more]
sp|O95861|BPNT1_HUMAN1.069e-7641.803'(2'),5'-bisphosphate nucleotidase 1 OS=Homo sapi... [more]
sp|Q9Z1N4|BPNT1_RAT3.384e-7641.163'(2'),5'-bisphosphate nucleotidase 1 OS=Rattus no... [more]
sp|Q9Z0S1|BPNT1_MOUSE1.234e-7441.403'(2'),5'-bisphosphate nucleotidase 1 OS=Mus muscu... [more]
sp|Q869K3|BPNT1_DICDI3.000e-4536.393'(2'),5'-bisphosphate nucleotidase 1 OS=Dictyoste... [more]
back to top
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZYJ67.484e-10052.60Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2C9JJ031.788e-9953.05Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A0B7AE859.851e-9951.29Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A482WC151.088e-9852.753'(2'),5'-bisphosphate nucleotidase 1 OS=Asbolus v... [more]
Q0GU401.282e-9852.41Biphosphate nucleotidase OS=Paracentrotus lividus ... [more]
back to top
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bpnt17.106e-8445.10bisphosphate nucleotidase 1 [Source:ZFIN;Acc:ZDB-G... [more]
bpnt17.690e-7841.77bisphosphate nucleotidase 1 [Source:ZFIN;Acc:ZDB-G... [more]
IMPAD14.406e-2127.36inositol monophosphatase domain containing 1 [Sour... [more]
si:ch211-160o17.24.515e-1431.58inositol polyphosphate-1-phosphatase [Source:NCBI ... [more]
impa21.209e-726.39inositol monophosphatase 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
bpnt15.785e-8044.37bisphosphate nucleotidase 1 [Source:ZFIN;Acc:ZDB-G... [more]
impad17.613e-2234.18inositol monophosphatase domain containing 1 [Sour... [more]
si:ch211-160o17.28.287e-1029.74si:ch211-160o17.2 [Source:ZFIN;Acc:ZDB-GENE-141219... [more]
back to top
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
INM21.235e-623.20Inositol monophosphatase; involved in biosynthesis... [more]
back to top
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO381641.350e-7646.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352594.845e-3231.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355656.688e-1128.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bpnt12.326e-8345.423'(2'), 5'-bisphosphate nucleotidase 1 [Source:NCB... [more]
bpnt16.994e-7741.323'(2'), 5'-bisphosphate nucleotidase 1 [Source:NCB... [more]
bpnt16.994e-7741.323'(2'), 5'-bisphosphate nucleotidase 1 [Source:NCB... [more]
bpnt11.955e-7641.323'(2'), 5'-bisphosphate nucleotidase 1 [Source:NCB... [more]
impad17.774e-2329.52inositol monophosphatase domain containing 1 [Sour... [more]
back to top
BLAST of 3'(2'),5'-bisphosphate nucleotidase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000014111.11.319e-14498.61SMESG000014111.1[more]
SMESG000014107.11.214e-56100.00SMESG000014107.1[more]
SMESG000065023.15.055e-624.72SMESG000065023.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017200 ID=SMED30017200|Name=3'(2'),5'-bisphosphate nucleotidase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1284bp
ATGGAAATCAGTCAATAATAAAAATTGGAAACTTTTTAAATTATGTTTAA
GACCACATGCTAACATATCAAATTTAACAGTTTATGCATCAATTGAAATA
AATTTCTTTATATTTTTTATTTGACCTACATCACTTGCGTACAACTTGTC
GGTTACATTAATCCAATTAAAAAAGAAATGGATATTCCTCTAATCATTAG
GTTATTATCAGCGTCAGTAAAAATCTCTTATAAAGCTGGTGCAATTGTTA
GAAAAGTTATGTCTAGTGGGAATTTAGGAATTATTGATAAAGGAGTAAAT
GATTTACAAACTAAAGCTGACAGAGAAGCCCAGGCTTGTATTGTTGATTC
ATTGGAACATCGTTTTCCAGGAATATGCGTCATAGGTGAAGAGGCAATCG
ATGATGCAGAACAAAAATTGCAAACATCTGAATTAGAATTAACGGATGAT
CAATTTGTGTTAAACCAAACATGTCCTACAAATTTATGCAATGTAAACAT
AGATGATATTGTTGTTTGGGTTGATCCGCTTGATGGAACAAGTGAATATA
CTCAAGGACTTATTGAGCACGTAACAGTATTAATTGGAGTATCAGTTAAT
GGTCGACCCGTTGGCGGAGTTATACATCAACCATTTTCTCCTAATGATAA
TAACAAAGGAAGATCTATTTATGCGTTAGAAGGCATGGGATGCTTTGGAT
TCGAACGGCGATGGGATGTAACAAATAATGCACCGGATGAACATTCAAAT
GTATTAACTACCACTCGCGGTCATGGCACCAATATTGTTAATCAAGCTCT
TGAAGCGTGTGGACCTACTGAAATTATTCGGGTTGGAGGATGTGGACACA
AAGTGCTATTGATGCTTGAAGGTCGATGTCATGGATACATATTTGCCAGT
GCTGGCTGTAAAAAATGGGACACTTGCGCTCCTGAAGCCGTTTTACGAGA
AGCTGGGGGTTATTTAACTGACATGTTGGGTCGCCCTTTCACATATGAGC
GCGACGTTAACCGATCAAACAGTTATGGGGTTCTTGCAACTGCAAAGAAA
GATTGGCATCAGTTTTATTTGAGTAAAATACCGCAGACTGTGAAAGAACA
TTTCCTGCAATAACTGACTGATTACCGGATTTCCTATTCTGTTGCTCACT
AGTTCCAGTATCAATTGAACGGAAACATTTCATTTGTCTTGTAATTTTCT
TTTAACTTTAGGAAACTTTCTCAAATCGACTTGCTAAATTAGTTTTGTAT
TTTATTTCCATTTATTTGTGCCGAAATTATTTTT
back to top

protein sequence of SMED30017200-orf-1

>SMED30017200-orf-1 ID=SMED30017200-orf-1|Name=SMED30017200-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=312bp
MDIPLIIRLLSASVKISYKAGAIVRKVMSSGNLGIIDKGVNDLQTKADRE
AQACIVDSLEHRFPGICVIGEEAIDDAEQKLQTSELELTDDQFVLNQTCP
TNLCNVNIDDIVVWVDPLDGTSEYTQGLIEHVTVLIGVSVNGRPVGGVIH
QPFSPNDNNKGRSIYALEGMGCFGFERRWDVTNNAPDEHSNVLTTTRGHG
TNIVNQALEACGPTEIIRVGGCGHKVLLMLEGRCHGYIFASAGCKKWDTC
APEAVLREAGGYLTDMLGRPFTYERDVNRSNSYGVLATAKKDWHQFYLSK
IPQTVKEHFLQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0046855inositol phosphate dephosphorylation
GO:0046854phosphatidylinositol phosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000760Inositol_monophosphatase-like
IPR020583Inositol_monoP_metal-BS
IPR020550Inositol_monophosphatase_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000760Inositol monophosphatase-likePRINTSPR00377IMPHPHTASEScoord: 42..62
score: 29.97
coord: 244..268
score: 37.38
coord: 64..80
score: 24.19
IPR000760Inositol monophosphatase-likePFAMPF00459Inositol_Pcoord: 10..299
e-value: 7.0E-51
score: 173.3
NoneNo IPR availableGENE3DG3DSA:3.40.190.80coord: 183..311
e-value: 1.1E-38
score: 134.0
NoneNo IPR availableGENE3DG3DSA:3.30.540.10coord: 4..174
e-value: 8.3E-51
score: 173.9
NoneNo IPR availablePANTHERPTHR43028FAMILY NOT NAMEDcoord: 4..307
NoneNo IPR availablePANTHERPTHR43028:SF53'(2'),5'-BISPHOSPHATE NUCLEOTIDASE 1coord: 4..307
NoneNo IPR availableCDDcd01640IPPasecoord: 9..300
e-value: 8.47831E-98
score: 288.067
NoneNo IPR availableSUPERFAMILYSSF56655Carbohydrate phosphatasecoord: 8..305
IPR020550Inositol monophosphatase, conserved sitePROSITEPS00630IMP_2coord: 247..261
IPR020583Inositol monophosphatase, metal-binding sitePROSITEPS00629IMP_1coord: 113..125