slc4a-7

Overview
Nameslc4a-7 (AKN21412.1)
Smed IDSMED30017190
Length (bp)3213
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc4a-7 (SMED30017190) t-SNE clustered cells

Violin plots show distribution of expression levels for slc4a-7 (SMED30017190) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc4a-7 (SMED30017190) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc4a-7 (SMED30017190) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017190

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30017190SMESG000063821.1 dd_Smed_v4_2778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30017190SMESG000063821.1 dd_Smed_v4_2778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017190SMESG000063821.1 dd_Smed_v4_2778_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30017190SMESG000063821.1 dd_Smed_v4_2778_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30017190SMESG000063821.1 dd_Smed_v4_2778_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30017190SMESG000063821.1 dd_Smed_v4_2778_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
collecting ductSMED30017190SMESG000063821.1 Smed-slc4a-7smed_ncbi_20200123PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc4a-7 vs. Ensembl Human
Match: SLC4A1 (solute carrier family 4 member 1 (Diego blood group) [Source:HGNC Symbol;Acc:HGNC:11027])

HSP 1 Score: 229.18 bits (583), Expect = 1.059e-61
Identity = 207/864 (23.96%), Postives = 390/864 (45.14%), Query Frame = 3
Query:  219 DQPIYMKKESSATTICQTSVPD---LLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL---LSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXV---KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISM---WVNIP-----DFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            ++P     E++AT    TS P    + +EL  L ++ +     W E +RW+  EE+   E   +  PHLS L+   L   + +F  G         +   V N   +     ++    + +E+  AL+L H H G  L +     P +      +  + ++  +P       +      +      S   + E +P  SE  L+ VG    +E+    F+RL Q   E   ++   P+R +F++ GP++   +  ++GR    ++S R FR   Y A+S+ +++ + + F++ S ++      + + L+  +P  +    + +     K   + Y           K +++  GP+         D L+   +                   F  L  D++     YLSD  D F+    P +   ++F YF  LSPAITFG L  +     M ++ LL+S+    +L+ L+  QPL +VG +  + + E+   S   + G+   + R WIG +L +L  +   F G+ +V    R  +E+++F  S+I++    S L  +F+  P   T      N  + +  + +  +  T L   +LM     + +   K     Y     R+++G F VP+ I+++  +++   + +    LS+PD  K++ S    WV  P     +F      ++A      L  + +FI++ +E    ++ V+K ERK+ K + + L++  ++ +  + ++F G P+ S   VRS  H  ++      + PG   +I    EQRISG++V +LV  S+ +  IL  IP+A ++G+FLYMGV  +S + L+ R++ L +  K+  +  Y+K +  W +
Sbjct:   32 EEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLG-ENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAG-ELEALGGVKPAVL----TRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRL-QEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFY-----------KGLDLNGGPD---------DPLQQTGQ------------------LFGGLVRDIRRRYPYYLSDITDAFS----PQVLAAVIFIYFAALSPAITFGGLLGEKTRNQMGVSELLISTAVQGILFALLGAQPLLVVGFSGPLLVFEEAFFSFCETNGLEYIVGRVWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIFIYETFSKLIKIFQDHPLQKTY-----NYNVLMVPKPQGPLPNTALLSLVLMAGTFFFAMMLRKFKNSSYFPGKLRRVIGDFGVPISILIMVLVDFFIQDTYTQ-KLSVPDGFKVSNSSARGWVIHPLGLRSEFPIWMMFASA------LPALLVFILIFLESQITTLIVSKPERKMVKGSGFHLDLLLVVGMGGVAALF-GMPWLSATTVRSVTHANALTVMGKASTPGAAAQIQEVKEQRISGLLVAVLVGLSILMEPILSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPYVKRVKTWRM 833          
BLAST of slc4a-7 vs. Ensembl Human
Match: SLC4A2 (solute carrier family 4 member 2 [Source:HGNC Symbol;Acc:HGNC:11028])

HSP 1 Score: 227.254 bits (578), Expect = 3.214e-60
Identity = 208/898 (23.16%), Postives = 382/898 (42.54%), Query Frame = 3
Query:  240 KESSATTICQTSVP----DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH---------------------VGMHLSSTIHECPTIHFNE-------EKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENST--------LYINERDKFGIGGTTXXXXXXXXXXXXXX--------------------VKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISM---WVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            +E   T   +   P    ++ +EL+ L L+ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +    V +   E +  S++   ++   +  AL+L H H                     +G H        P  H  E       E +     E  +P        + IT +++ H +    KL E +P  +E  ++ VG +  + R    F+RL + V  D +L+   P+R +F++ GP S   +  E+GR    ++S+++F E  Y A+ + D+++A   F++ S ++  +     E+L                   Q+ +    EE+ R   T        + P  + +DKA   ++E     E    ++              L  D++     YLSDFRD       P     ++F YF  LSPAITFG L  +     + ++ L++S+    +++ L+  QPL ++G +  + + E+   S   S  +   + R WIG +L  L  +     G+ +V    R  +E++ F  S+I++    + + K           A NS+         +   R   G G  +L                                  K     +     R+++G F VP+ I+++  ++Y   + +    LS+P    +       WV  P   + +           L  I +FI++ +E    ++ ++K ER L+K + + L++  ++ +  I ++F G P+ + A VRS  H  ++   S   APG   +I    EQR++G++V +LV  S+ +G +L+ IP+A ++G+FLYMGV  ++ +  ++RL  L+   KH  +  Y+K +
Sbjct:  290 REPGPTPRARPRAPHKPHEVFVELNELLLD-KNQEPQWRETARWIKFEEDVEEETERWGKPHVASLSFRSLLELRRTLAHGAVLLDLDQQTLPGVAHQVVEQMVISDQIKAEDRANVLRALLLKHSHPSDEKDFSFPRNISAGSLGSLLGHHHGQGAESDP--HVTEPLMGGVPETRLEVERERELPPPA---PPAGITRSKSKHEL----KLLEKIPENAEATVVLVGCVEFLSRPTMAFVRLREAVELDAVLEVPVPVRFLFLLLGPSSANMDYHEIGRSISTLMSDKQFHEAAYLADEREDLLTAINAFLDCSVVLPPSEVQGEELL-------------RSVAHFQRQMLKKREEQGRLLPT-----GAGLEPK-SAQDKALLQMVEAAGAAEDDPLRRTGRPFGG-------LIRDVRRRYPHYLSDFRDALD----PQCLAAVIFIYFAALSPAITFGGLLGEKTQDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSSNHLEYLVGRVWIGFWLVFLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETFYKLVKIFQEHPLHGCSASNSSEVDGGENMTWAGARPTLGPGNRSLAGQSGQGKPRGQPNTALLSLVLMAGTFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLVDYSIEDTYTQ-KLSVPSGFSVTAPEKRGWVINP-LGEKSPFPVWMMVASLLPAILVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALF-GLPWLAAATVRSVTHANALTVMSKAVAPGDKPKIQEVKEQRVTGLLVALLVGLSIVIGDLLRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKV 1144          
BLAST of slc4a-7 vs. Ensembl Human
Match: SLC4A2 (solute carrier family 4 member 2 [Source:HGNC Symbol;Acc:HGNC:11028])

HSP 1 Score: 226.868 bits (577), Expect = 4.290e-60
Identity = 208/898 (23.16%), Postives = 382/898 (42.54%), Query Frame = 3
Query:  240 KESSATTICQTSVP----DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH---------------------VGMHLSSTIHECPTIHFNE-------EKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENST--------LYINERDKFGIGGTTXXXXXXXXXXXXXX--------------------VKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISM---WVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            +E   T   +   P    ++ +EL+ L L+ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +    V +   E +  S++   ++   +  AL+L H H                     +G H        P  H  E       E +     E  +P        + IT +++ H +    KL E +P  +E  ++ VG +  + R    F+RL + V  D +L+   P+R +F++ GP S   +  E+GR    ++S+++F E  Y A+ + D+++A   F++ S ++  +     E+L                   Q+ +    EE+ R   T        + P  + +DKA   ++E     E    ++              L  D++     YLSDFRD       P     ++F YF  LSPAITFG L  +     + ++ L++S+    +++ L+  QPL ++G +  + + E+   S   S  +   + R WIG +L  L  +     G+ +V    R  +E++ F  S+I++    + + K           A NS+         +   R   G G  +L                                  K     +     R+++G F VP+ I+++  ++Y   + +    LS+P    +       WV  P   + +           L  I +FI++ +E    ++ ++K ER L+K + + L++  ++ +  I ++F G P+ + A VRS  H  ++   S   APG   +I    EQR++G++V +LV  S+ +G +L+ IP+A ++G+FLYMGV  ++ +  ++RL  L+   KH  +  Y+K +
Sbjct:  295 REPGPTPRARPRAPHKPHEVFVELNELLLD-KNQEPQWRETARWIKFEEDVEEETERWGKPHVASLSFRSLLELRRTLAHGAVLLDLDQQTLPGVAHQVVEQMVISDQIKAEDRANVLRALLLKHSHPSDEKDFSFPRNISAGSLGSLLGHHHGQGAESDP--HVTEPLMGGVPETRLEVERERELPPPA---PPAGITRSKSKHEL----KLLEKIPENAEATVVLVGCVEFLSRPTMAFVRLREAVELDAVLEVPVPVRFLFLLLGPSSANMDYHEIGRSISTLMSDKQFHEAAYLADEREDLLTAINAFLDCSVVLPPSEVQGEELL-------------RSVAHFQRQMLKKREEQGRLLPT-----GAGLEPK-SAQDKALLQMVEAAGAAEDDPLRRTGRPFGG-------LIRDVRRRYPHYLSDFRDALD----PQCLAAVIFIYFAALSPAITFGGLLGEKTQDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSSNHLEYLVGRVWIGFWLVFLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETFYKLVKIFQEHPLHGCSASNSSEVDGGENMTWAGARPTLGPGNRSLAGQSGQGKPRGQPNTALLSLVLMAGTFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLVDYSIEDTYTQ-KLSVPSGFSVTAPEKRGWVINP-LGEKSPFPVWMMVASLLPAILVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALF-GLPWLAAATVRSVTHANALTVMSKAVAPGDKPKIQEVKEQRVTGLLVALLVGLSIVIGDLLRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKV 1149          
BLAST of slc4a-7 vs. Ensembl Human
Match: SLC4A2 (solute carrier family 4 member 2 [Source:HGNC Symbol;Acc:HGNC:11028])

HSP 1 Score: 226.868 bits (577), Expect = 4.427e-60
Identity = 208/898 (23.16%), Postives = 382/898 (42.54%), Query Frame = 3
Query:  240 KESSATTICQTSVP----DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH---------------------VGMHLSSTIHECPTIHFNE-------EKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENST--------LYINERDKFGIGGTTXXXXXXXXXXXXXX--------------------VKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISM---WVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            +E   T   +   P    ++ +EL+ L L+ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +    V +   E +  S++   ++   +  AL+L H H                     +G H        P  H  E       E +     E  +P        + IT +++ H +    KL E +P  +E  ++ VG +  + R    F+RL + V  D +L+   P+R +F++ GP S   +  E+GR    ++S+++F E  Y A+ + D+++A   F++ S ++  +     E+L                   Q+ +    EE+ R   T        + P  + +DKA   ++E     E    ++              L  D++     YLSDFRD       P     ++F YF  LSPAITFG L  +     + ++ L++S+    +++ L+  QPL ++G +  + + E+   S   S  +   + R WIG +L  L  +     G+ +V    R  +E++ F  S+I++    + + K           A NS+         +   R   G G  +L                                  K     +     R+++G F VP+ I+++  ++Y   + +    LS+P    +       WV  P   + +           L  I +FI++ +E    ++ ++K ER L+K + + L++  ++ +  I ++F G P+ + A VRS  H  ++   S   APG   +I    EQR++G++V +LV  S+ +G +L+ IP+A ++G+FLYMGV  ++ +  ++RL  L+   KH  +  Y+K +
Sbjct:  304 REPGPTPRARPRAPHKPHEVFVELNELLLD-KNQEPQWRETARWIKFEEDVEEETERWGKPHVASLSFRSLLELRRTLAHGAVLLDLDQQTLPGVAHQVVEQMVISDQIKAEDRANVLRALLLKHSHPSDEKDFSFPRNISAGSLGSLLGHHHGQGAESDP--HVTEPLMGGVPETRLEVERERELPPPA---PPAGITRSKSKHEL----KLLEKIPENAEATVVLVGCVEFLSRPTMAFVRLREAVELDAVLEVPVPVRFLFLLLGPSSANMDYHEIGRSISTLMSDKQFHEAAYLADEREDLLTAINAFLDCSVVLPPSEVQGEELL-------------RSVAHFQRQMLKKREEQGRLLPT-----GAGLEPK-SAQDKALLQMVEAAGAAEDDPLRRTGRPFGG-------LIRDVRRRYPHYLSDFRDALD----PQCLAAVIFIYFAALSPAITFGGLLGEKTQDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSSNHLEYLVGRVWIGFWLVFLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETFYKLVKIFQEHPLHGCSASNSSEVDGGENMTWAGARPTLGPGNRSLAGQSGQGKPRGQPNTALLSLVLMAGTFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLVDYSIEDTYTQ-KLSVPSGFSVTAPEKRGWVINP-LGEKSPFPVWMMVASLLPAILVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALF-GLPWLAAATVRSVTHANALTVMSKAVAPGDKPKIQEVKEQRVTGLLVALLVGLSIVIGDLLRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKV 1158          
BLAST of slc4a-7 vs. Ensembl Human
Match: SLC4A2 (solute carrier family 4 member 2 [Source:HGNC Symbol;Acc:HGNC:11028])

HSP 1 Score: 226.868 bits (577), Expect = 4.427e-60
Identity = 208/898 (23.16%), Postives = 382/898 (42.54%), Query Frame = 3
Query:  240 KESSATTICQTSVP----DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH---------------------VGMHLSSTIHECPTIHFNE-------EKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENST--------LYINERDKFGIGGTTXXXXXXXXXXXXXX--------------------VKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISM---WVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            +E   T   +   P    ++ +EL+ L L+ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +    V +   E +  S++   ++   +  AL+L H H                     +G H        P  H  E       E +     E  +P        + IT +++ H +    KL E +P  +E  ++ VG +  + R    F+RL + V  D +L+   P+R +F++ GP S   +  E+GR    ++S+++F E  Y A+ + D+++A   F++ S ++  +     E+L                   Q+ +    EE+ R   T        + P  + +DKA   ++E     E    ++              L  D++     YLSDFRD       P     ++F YF  LSPAITFG L  +     + ++ L++S+    +++ L+  QPL ++G +  + + E+   S   S  +   + R WIG +L  L  +     G+ +V    R  +E++ F  S+I++    + + K           A NS+         +   R   G G  +L                                  K     +     R+++G F VP+ I+++  ++Y   + +    LS+P    +       WV  P   + +           L  I +FI++ +E    ++ ++K ER L+K + + L++  ++ +  I ++F G P+ + A VRS  H  ++   S   APG   +I    EQR++G++V +LV  S+ +G +L+ IP+A ++G+FLYMGV  ++ +  ++RL  L+   KH  +  Y+K +
Sbjct:  304 REPGPTPRARPRAPHKPHEVFVELNELLLD-KNQEPQWRETARWIKFEEDVEEETERWGKPHVASLSFRSLLELRRTLAHGAVLLDLDQQTLPGVAHQVVEQMVISDQIKAEDRANVLRALLLKHSHPSDEKDFSFPRNISAGSLGSLLGHHHGQGAESDP--HVTEPLMGGVPETRLEVERERELPPPA---PPAGITRSKSKHEL----KLLEKIPENAEATVVLVGCVEFLSRPTMAFVRLREAVELDAVLEVPVPVRFLFLLLGPSSANMDYHEIGRSISTLMSDKQFHEAAYLADEREDLLTAINAFLDCSVVLPPSEVQGEELL-------------RSVAHFQRQMLKKREEQGRLLPT-----GAGLEPK-SAQDKALLQMVEAAGAAEDDPLRRTGRPFGG-------LIRDVRRRYPHYLSDFRDALD----PQCLAAVIFIYFAALSPAITFGGLLGEKTQDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSSNHLEYLVGRVWIGFWLVFLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETFYKLVKIFQEHPLHGCSASNSSEVDGGENMTWAGARPTLGPGNRSLAGQSGQGKPRGQPNTALLSLVLMAGTFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLVDYSIEDTYTQ-KLSVPSGFSVTAPEKRGWVINP-LGEKSPFPVWMMVASLLPAILVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALF-GLPWLAAATVRSVTHANALTVMSKAVAPGDKPKIQEVKEQRVTGLLVALLVGLSIVIGDLLRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKV 1158          
BLAST of slc4a-7 vs. Ensembl Celegans
Match: abts-1 (Anion exchange protein [Source:UniProtKB/TrEMBL;Acc:B3WFV9])

HSP 1 Score: 130.183 bits (326), Expect = 2.528e-30
Identity = 118/556 (21.22%), Postives = 217/556 (39.03%), Query Frame = 3
Query:  327 NSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHV-------------GMHLSS---------TIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSEC-------LPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALV-----HLNRRITHEILVHCLPQLKYYANKSHTE-QHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFK 1889
            N+  W E +RW+ +EED +    R++ PH++TLS+  L   +    +G+        +   + N   E++E+S     +  +E+R  L+  H H              G  LS+         +      +   EEK                 N+ ++   E++ +  S ++ S+        LP G E + + +G +  + R    F+RL        L +   P R IF++ GP    ++  E+GR    ++++  F ++ Y A    D++    +F++   ++       N RI     +    + K    +   E    KH++ + EEE+  S  D+  +    G  F                                      L +D+K     ++SDF D F  +        I F YF +L+P +TFG L  +     M     L       ++Y    GQPL IVG T  V + E ++       GI     RFW+ V+ +++ F+  + + + +V    R  EE +    ++I++  A+  + K
Sbjct:   93 NNEEWRETARWVKFEEDVEQGGNRWSKPHVATLSLHSLFQLRSCIMNGHFMNDLAETDIPSIFNAVIENLEKSGDLPSENREELREILLRKHVHQYEQAKKNGAGGEKGGFLSTVRSISDIGKSFSHGKNLSKIEEKPEGPVTSQTAGAPSGSSNQLTLPTVESVPKDISSEESSKGNLHFLKKLPAGVEASNVLIGEVDFLTRHICCFIRLKNANQLGDLTEVPVPTRFIFLLLGPTGHGQQYREIGRAIATLMADEIFHDVAYGARDVDDLLDGIDEFLDQVTVLPPGEWDPNIRIEPPSKLPSQEKRKQIGQELLVEPSSHKHVKKVVEEEEIHSHGDDPALK-RTGKLFGG------------------------------------LILDIKRKAPHFVSDFTDAFNLQ----CLASICFMYFGLLAPIVTFGGLLEEATHQRMAAMENLFGGALCGVIYHFFAGQPLTIVGSTGPVLVFETIVFDFCHRFGIVYLSFRFWVHVWTAVIIFLMVVTDASALVSFITRFTEESFATLIAVIFIYEAIMKLVK 607          

HSP 2 Score: 92.8189 bits (229), Expect = 9.375e-19
Identity = 94/344 (27.33%), Postives = 156/344 (45.35%), Query Frame = 3
Query: 2028 KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVN----IPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRTXXXXXXXXXXXXXXXXXXSQFTTYVWTLFLFPIFVGIYAMIRGYALPRWPRLNTHLSKMDKK----HFVKLYDGKKVKSEAEIVQ-----DNQA 3020
            K+    Y   + R+LL  F V + I  +T ++   F     P L++P + +     W      IP F       TA      L  +   I++ ++    ++ V + E KLKK   Y L++  L +V  ++  FLG P +  A V S  H  S+   S   APG   + +G  EQR++G++  +++  SV   +IL  IPM  +YG+FLYMG+  +  + L+ R + L    K+  +  Y++ +P+  I      Q+  + +L +I  +        T  LFPI + +   IR      +    T L  +D      H  K  D K+ +SE E V+     +NQA
Sbjct:  709 KMRNSCYFPSSVRQLLSDFAVMIAIASMTFVD--IFVGVNTPKLNVPSTFR---PTWEGRGWFIPPFDA-NEWWTAP--LAILPALLACILIFMDQQITTVIVNRKENKLKKGCGYHLDLLVL-SVSILMVGFLGLPIYVAATVLSINHINSLKVESECKAPGEVAQFVGVREQRVTGIVTFLIIGLSVLATNILGRIPMPVLYGVFLYMGISALGGIQLFDRTLLLFMPMKYQPDTIYIRHVPIRKIHLFTAFQIGCLALLWVIKSIKS------TSILFPIMLVVMVAIRKMMEKAF--TTTDLKYLDDPMPDFHLRKKEDAKRRQSEGEAVEIEFDNENQA 1035          
BLAST of slc4a-7 vs. Ensembl Celegans
Match: abts-1 (Anion exchange protein [Source:UniProtKB/TrEMBL;Acc:B3WFV9])

HSP 1 Score: 130.183 bits (326), Expect = 3.073e-30
Identity = 118/556 (21.22%), Postives = 217/556 (39.03%), Query Frame = 3
Query:  327 NSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHV-------------GMHLSS---------TIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSEC-------LPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALV-----HLNRRITHEILVHCLPQLKYYANKSHTE-QHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFK 1889
            N+  W E +RW+ +EED +    R++ PH++TLS+  L   +    +G+        +   + N   E++E+S     +  +E+R  L+  H H              G  LS+         +      +   EEK                 N+ ++   E++ +  S ++ S+        LP G E + + +G +  + R    F+RL        L +   P R IF++ GP    ++  E+GR    ++++  F ++ Y A    D++    +F++   ++       N RI     +    + K    +   E    KH++ + EEE+  S  D+  +    G  F                                      L +D+K     ++SDF D F  +        I F YF +L+P +TFG L  +     M     L       ++Y    GQPL IVG T  V + E ++       GI     RFW+ V+ +++ F+  + + + +V    R  EE +    ++I++  A+  + K
Sbjct:   51 NNEEWRETARWVKFEEDVEQGGNRWSKPHVATLSLHSLFQLRSCIMNGHFMNDLAETDIPSIFNAVIENLEKSGDLPSENREELREILLRKHVHQYEQAKKNGAGGEKGGFLSTVRSISDIGKSFSHGKNLSKIEEKPEGPVTSQTAGAPSGSSNQLTLPTVESVPKDISSEESSKGNLHFLKKLPAGVEASNVLIGEVDFLTRHICCFIRLKNANQLGDLTEVPVPTRFIFLLLGPTGHGQQYREIGRAIATLMADEIFHDVAYGARDVDDLLDGIDEFLDQVTVLPPGEWDPNIRIEPPSKLPSQEKRKQIGQELLVEPSSHKHVKKVVEEEEIHSHGDDPALK-RTGKLFGG------------------------------------LILDIKRKAPHFVSDFTDAFNLQ----CLASICFMYFGLLAPIVTFGGLLEEATHQRMAAMENLFGGALCGVIYHFFAGQPLTIVGSTGPVLVFETIVFDFCHRFGIVYLSFRFWVHVWTAVIIFLMVVTDASALVSFITRFTEESFATLIAVIFIYEAIMKLVK 565          

HSP 2 Score: 92.4337 bits (228), Expect = 1.147e-18
Identity = 94/344 (27.33%), Postives = 156/344 (45.35%), Query Frame = 3
Query: 2028 KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVN----IPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRTXXXXXXXXXXXXXXXXXXSQFTTYVWTLFLFPIFVGIYAMIRGYALPRWPRLNTHLSKMDKK----HFVKLYDGKKVKSEAEIVQ-----DNQA 3020
            K+    Y   + R+LL  F V + I  +T ++   F     P L++P + +     W      IP F       TA      L  +   I++ ++    ++ V + E KLKK   Y L++  L +V  ++  FLG P +  A V S  H  S+   S   APG   + +G  EQR++G++  +++  SV   +IL  IPM  +YG+FLYMG+  +  + L+ R + L    K+  +  Y++ +P+  I      Q+  + +L +I  +        T  LFPI + +   IR      +    T L  +D      H  K  D K+ +SE E V+     +NQA
Sbjct:  667 KMRNSCYFPSSVRQLLSDFAVMIAIASMTFVD--IFVGVNTPKLNVPSTFR---PTWEGRGWFIPPFDA-NEWWTAP--LAILPALLACILIFMDQQITTVIVNRKENKLKKGCGYHLDLLVL-SVSILMVGFLGLPIYVAATVLSINHINSLKVESECKAPGEVAQFVGVREQRVTGIVTFLIIGLSVLATNILGRIPMPVLYGVFLYMGISALGGIQLFDRTLLLFMPMKYQPDTIYIRHVPIRKIHLFTAFQIGCLALLWVIKSIKS------TSILFPIMLVVMVAIRKMMEKAF--TTTDLKYLDDPMPDFHLRKKEDAKRRQSEGEAVEIEFDNENQA 993          
BLAST of slc4a-7 vs. Ensembl Celegans
Match: abts-4 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:H2L0C4])

HSP 1 Score: 125.176 bits (313), Expect = 7.646e-29
Identity = 186/865 (21.50%), Postives = 337/865 (38.96%), Query Frame = 3
Query:  282 DLLIELDILYLNPRTNSYCWTEKSRWIIYEED---FDMELRRFNNP--------HLSTLSVRGLKFFKDLFK--DGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIH----FNEEKQCFETNENYIPHIGRRRNRSSIT-LNENMHRVQSQKKLSECLPT----GSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXV-------------KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIP---DSNKINISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIR 2762
            D  I +D+  +N   +   W + SR+  YEED   FD  L R + P         L  ++ + + F K  ++  D + NF      + DV     +  E+  +   D + EI     L+  +     S       TI     F         N   + H   RR  +S + L      +  Q  +S+  P      +E +++  G +P +     + +R  +    + +      +R +F + GP       L++GR    ++SN        + +S   +  A ++F+  + ++   R I ++ LV                   + L N+  E+        KD+++E                 T+K EE       + +             DL+   + Y SD+RDGF       IFT + + + V + P +TFGA+     S  + +   LVS     L++ +++ QPL ++  T    + E+ L        +    +RF+ G++L  +  V    N A ++       E+++    S+I+     F+      +    ++  EN   YI       +             F L L+             +++R  +   TFR L   F     +I V+    I F    +  + IP     ++    ++V IP      S  T       +  I +F+++ VE         +  RKLKK      ++  ++    ++S  LG P+   A V+S AH  S+ ++   +APG+P RI    EQR+SGM+  +L+     LG  L  IP A+++G+F Y+GV  +    +  RL       K+   H +L+  P + I+
Sbjct:   71 DHHIVVDVFTVN--NDDGTWKQASRFARYEEDCEGFDNHLGRPHVPCIPMGTYDALKMVTAKSILFPKVQYESLDEFVNFLETKIVDPDV----PKLGEKIAKLINDRIAEIEKMRPLHQRNSSSTQSLDASNPQTISTVGIFPRSLLSAPNNLGSLAHHPMRRLPTSHSGLRFGSSFLPQQPVVSQLEPVIWDEDNEISMLVAGEIPHVNVCRFIAIRFVETTAMEKIFPNMTNVRHLFFLIGPALENVTYLDLGRALASVVSNPPATTTFDQLKSPDSITKAIERFLAGTVVIAPGR-IDNKNLVR--------------SDLIRKLVNMQGEKTETKIVHPKDVDVERN--------------ATKKAEEAEDKPFRLFSGVTS---------DLRNRAKHYFSDYRDGFNIS----IFTVVFYMFCVTVVPTLTFGAIMGAGTSGLLAVKECLVSQALSGLIWSVLSCQPLLVMSPTGPFLVFEKALFKFTDQNDMDFLEVRFYTGIFLFFISIVGAATNCAHLIHYVTIYTEDIFCALISLIF-----FSEVVEFIHLQEEHNSIENLKYYIENAANCTVTEVKDCALSRPNTFLLQLIMVVVSIAIFHYLRQVSRSTFFGRTFRNLCKNFGGIFAVIAVSIAYRILFQNVGVAVVDIPVAVGQSRPFDGIFV-IPSAPPTASTLT----IALISSILLFVLIFVETEIPEQMALREGRKLKKGGGLHWDLI-VVGFCTLVSSVLGLPWMCPAAVQSLAHITSLTEYK-KSAPGVPSRISHVIEQRVSGMVTYLLLGTFAILGHFLA-IPAATIFGVFFYLGVRNLEGSKMILRLKLCFLPSKYRGSHKFLEIAPFYTIQ 874          
BLAST of slc4a-7 vs. Ensembl Celegans
Match: abts-4 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:H2L0C4])

HSP 1 Score: 121.324 bits (303), Expect = 9.932e-28
Identity = 184/857 (21.47%), Postives = 333/857 (38.86%), Query Frame = 3
Query:  282 DLLIELDILYLNPRTNSYCWTEKSRWIIYEED---FDMELRRFNNP--------HLSTLSVRGLKFFKDLFK--DGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIH----FNEEKQCFETNENYIPHIGRRRNRSSIT-LNENMHRVQSQKKLSECLPT----GSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXV-------------KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIP---DSNKINISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLK 2738
            D  I +D+  +N   +   W + SR+  YEED   FD  L R + P         L  ++ + + F K  ++  D + NF      + DV     +  E+  +   D + EI     L+  +     S       TI     F         N   + H   RR  +S + L      +  Q  +S+  P      +E +++  G +P +     + +R  +    + +      +R +F + GP       L++GR    ++SN        + +S   +  A ++F+  + ++   R I ++ LV                   + L N+  E+        KD+++E                 T+K EE       + +             DL+   + Y SD+RDGF       IFT + + + V + P +TFGA+     S  + +   LVS     L++ +++ QPL ++  T    + E+ L        +    +RF+ G++L  +  V    N A ++       E+++    S+I+     F+      +    ++  EN   YI       +             F L L+             +++R  +   TFR L   F     +I V+    I F    +  + IP     ++    ++V IP      S  T       +  I +F+++ VE         +  RKLKK      ++  ++    ++S  LG P+   A V+S AH  S+ ++   +APG+P RI    EQR+SGM+  +L+     LG  L  IP A+++G+F Y+GV  +    +  RL       K+   H +L+
Sbjct:   71 DHHIVVDVFTVN--NDDGTWKQASRFARYEEDCEGFDNHLGRPHVPCIPMGTYDALKMVTAKSILFPKVQYESLDEFVNFLETKIVDPDV----PKLGEKIAKLINDRIAEIEKMRPLHQRNSSSTQSLDASNPQTISTVGIFPRSLLSAPNNLGSLAHHPMRRLPTSHSGLRFGSSFLPQQPVVSQLEPVIWDEDNEISMLVAGEIPHVNVCRFIAIRFVETTAMEKIFPNMTNVRHLFFLIGPALENVTYLDLGRALASVVSNPPATTTFDQLKSPDSITKAIERFLAGTVVIAPGR-IDNKNLVR--------------SDLIRKLVNMQGEKTETKIVHPKDVDVERN--------------ATKKAEEAEDKPFRLFSGVTS---------DLRNRAKHYFSDYRDGFNIS----IFTVVFYMFCVTVVPTLTFGAIMGAGTSGLLAVKECLVSQALSGLIWSVLSCQPLLVMSPTGPFLVFEKALFKFTDQNDMDFLEVRFYTGIFLFFISIVGAATNCAHLIHYVTIYTEDIFCALISLIF-----FSEVVEFIHLQEEHNSIENLKYYIENAANCTVTEVKDCALSRPNTFLLQLIMVVVSIAIFHYLRQVSRSTFFGRTFRNLCKNFGGIFAVIAVSIAYRILFQNVGVAVVDIPVAVGQSRPFDGIFV-IPSAPPTASTLT----IALISSILLFVLIFVETEIPEQMALREGRKLKKGGGLHWDLI-VVGFCTLVSSVLGLPWMCPAAVQSLAHITSLTEYK-KSAPGVPSRISHVIEQRVSGMVTYLLLGTFAILGHFLA-IPAATIFGVFFYLGVRNLEGSKMILRLKLCFLPSKYRGSHKFLE 866          
BLAST of slc4a-7 vs. Ensembl Celegans
Match: abts-4 (Anion/Bicarbonate TranSporter family [Source:UniProtKB/TrEMBL;Acc:H2L0C4])

HSP 1 Score: 121.324 bits (303), Expect = 1.322e-27
Identity = 184/857 (21.47%), Postives = 333/857 (38.86%), Query Frame = 3
Query:  282 DLLIELDILYLNPRTNSYCWTEKSRWIIYEED---FDMELRRFNNP--------HLSTLSVRGLKFFKDLFK--DGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIH----FNEEKQCFETNENYIPHIGRRRNRSSIT-LNENMHRVQSQKKLSECLPT----GSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXV-------------KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIP---DSNKINISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLK 2738
            D  I +D+  +N   +   W + SR+  YEED   FD  L R + P         L  ++ + + F K  ++  D + NF      + DV     +  E+  +   D + EI     L+  +     S       TI     F         N   + H   RR  +S + L      +  Q  +S+  P      +E +++  G +P +     + +R  +    + +      +R +F + GP       L++GR    ++SN        + +S   +  A ++F+  + ++   R I ++ LV                   + L N+  E+        KD+++E                 T+K EE       + +             DL+   + Y SD+RDGF       IFT + + + V + P +TFGA+     S  + +   LVS     L++ +++ QPL ++  T    + E+ L        +    +RF+ G++L  +  V    N A ++       E+++    S+I+     F+      +    ++  EN   YI       +             F L L+             +++R  +   TFR L   F     +I V+    I F    +  + IP     ++    ++V IP      S  T       +  I +F+++ VE         +  RKLKK      ++  ++    ++S  LG P+   A V+S AH  S+ ++   +APG+P RI    EQR+SGM+  +L+     LG  L  IP A+++G+F Y+GV  +    +  RL       K+   H +L+
Sbjct:   71 DHHIVVDVFTVN--NDDGTWKQASRFARYEEDCEGFDNHLGRPHVPCIPMGTYDALKMVTAKSILFPKVQYESLDEFVNFLETKIVDPDV----PKLGEKIAKLINDRIAEIEKMRPLHQRNSSSTQSLDASNPQTISTVGIFPRSLLSAPNNLGSLAHHPMRRLPTSHSGLRFGSSFLPQQPVVSQLEPVIWDEDNEISMLVAGEIPHVNVCRFIAIRFVETTAMEKIFPNMTNVRHLFFLIGPALENVTYLDLGRALASVVSNPPATTTFDQLKSPDSITKAIERFLAGTVVIAPGR-IDNKNLVR--------------SDLIRKLVNMQGEKTETKIVHPKDVDVERN--------------ATKKAEEAEDKPFRLFSGVTS---------DLRNRAKHYFSDYRDGFNIS----IFTVVFYMFCVTVVPTLTFGAIMGAGTSGLLAVKECLVSQALSGLIWSVLSCQPLLVMSPTGPFLVFEKALFKFTDQNDMDFLEVRFYTGIFLFFISIVGAATNCAHLIHYVTIYTEDIFCALISLIF-----FSEVVEFIHLQEEHNSIENLKYYIENAANCTVTEVKDCALSRPNTFLLQLIMVVVSIAIFHYLRQVSRSTFFGRTFRNLCKNFGGIFAVIAVSIAYRILFQNVGVAVVDIPVAVGQSRPFDGIFV-IPSAPPTASTLT----IALISSILLFVLIFVETEIPEQMALREGRKLKKGGGLHWDLI-VVGFCTLVSSVLGLPWMCPAAVQSLAHITSLTEYK-KSAPGVPSRISHVIEQRVSGMVTYLLLGTFAILGHFLA-IPAATIFGVFFYLGVRNLEGSKMILRLKLCFLPSKYRGSHKFLE 866          
BLAST of slc4a-7 vs. Ensembl Fly
Match: CG8177 (gene:FBgn0036043 transcript:FBtr0076322)

HSP 1 Score: 204.527 bits (519), Expect = 2.447e-53
Identity = 225/975 (23.08%), Postives = 410/975 (42.05%), Query Frame = 3
Query:   93 DNPVYEEDENEIKDDQPDSEVAGGELKQWRNSIEQEGDMSFHDQPIYMKKESSATTICQTSVPDLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMH---LSSTIHECPTIHFNEEKQCFETNENYI-----PHIG--RRRNRSSITLNENMHRVQSQKKLSEC--------LPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQ-KHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQK---------------KEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYL----SDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSA---LFTMFKALPYF--YTLYSPA----ENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKI----------NRGIY-----------------------LRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSK------LTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            D  + E D NE++  + D   A    K   +SI+          P   KK          S  ++ ++LD   L        W E +RWI YEED +    R+  PH+++LS   L   +   + G      + ++   V     E +   +  + ++   +  +L+L H HV  H   L  T  +  +  +   +    T++  I       IG  +R N   I + ++M+   SQ+ L +         +P G+E   + VG +  +E+    F+RL + V    L +   P+R +F++ GP++ + +  EVGR    +++N  F  + Y+A+ + D++SA  +F+++S ++       H++    LP  +  A K      + K LQ      KR+S        I+IG    +++KA   +LE Q                  +                   +L+  L+ + +R +    SD  DG   E         +F YF  LS AITFG L +   +  + I+  L+S     +++  ++ QPL I+G T  + + ++ L             +R ++GV+L I+    + F G++ V    R  +E+++   ++IY++     L ++++  P    Y L  P     E++T   NE         T  +  +++N     + I          N  ++                       L    R+ LG F VP+ I +   ++Y+    +         + K+ +   ++  D SK        + ST     C +  + ++I++ +E   + + V K +R LKK +    ++  L  +     IF G P+   A VRS  H  S+   S   APG   RI+   EQR+SG  V +++  SV +  +L+ IPMA ++G+FLYMGV  +S + L++R+       KH+    Y+K +  W +
Sbjct:  160 DTALEEADLNELRSHRSDDPRALRRHKIHHSSIKLRELPQITISPFTNKKPE-----VDHSPHEIFVQLD--ELTGVGEDREWKETARWIKYEEDVEEGSDRWGKPHVASLSFHSLLNLRRCLETGVVLLDLNEKDLPAVAYRVVEQMVIEDLIDINDKPSVMRSLLLRHRHVNEHQGVLPFTKRKYNS--YTSLQNLSGTDDKKIKIMPAAEIGGSKRSNELKIDMKDDMYS-SSQEDLKKLQNDTILKRIPAGAEATTVLVGAVEFLEQPTIAFVRLSEGVLMPTLTEVPVPVRFMFVLLGPRNFDLDYHEVGRSISTLMANEHFHSIAYKADDRKDLLSAINEFLDDSIVLPPGNWDRHDL----LPFEELKAKKDWIRTRKIKALQ-----VKRDSEM------IKIG---KDEEKA---LLEKQTLGAIGFTIGGGDGGGDGDSDDDNGRKKKKPSPLEKTGRLWGGLRNDLKRRMPMYKSDILDGLNTET----LAATIFMYFACLSTAITFGGLVSAKTNSWIGISETLISCSLVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQHEFDFLSLRVYVGVWLIIIALTVSAFEGSVYVRLLTRFTQEIFSALITLIYIVETFMKLISIYRENPLLSDYNLPPPTLVAHEHAT---NESLLNATASVTTNITQMVMNISTTAMPIGPPPLPKNQPNTALFCTILTLATFVVAYYLKLFRNSHFLGRNARRALGDFGVPISIAIFVLVDYLVPAVY---------TEKLVVPEGLSPSDPSKRGWYIGFDTSSTWIPFACVIPALLVYILIFMESQISELIVDKPDRGLKKGSGLHWDIVLLCLLNCACGIF-GMPWHCAATVRSVTHVSSVTIMSRTHAPGESPRIVDVKEQRLSGFFVCLMIGLSVLMAPLLRLIPMAVLFGVFLYMGVASMSGVQLFERIRLYFMPVKHYPPTSYVKRLRPWKL 1086          
BLAST of slc4a-7 vs. Ensembl Fly
Match: CG8177 (gene:FBgn0036043 transcript:FBtr0076326)

HSP 1 Score: 203.756 bits (517), Expect = 3.613e-53
Identity = 225/975 (23.08%), Postives = 410/975 (42.05%), Query Frame = 3
Query:   93 DNPVYEEDENEIKDDQPDSEVAGGELKQWRNSIEQEGDMSFHDQPIYMKKESSATTICQTSVPDLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMH---LSSTIHECPTIHFNEEKQCFETNENYI-----PHIG--RRRNRSSITLNENMHRVQSQKKLSEC--------LPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQ-KHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQK---------------KEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYL----SDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSA---LFTMFKALPYF--YTLYSPA----ENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKI----------NRGIY-----------------------LRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSK------LTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            D  + E D NE++  + D   A    K   +SI+          P   KK          S  ++ ++LD   L        W E +RWI YEED +    R+  PH+++LS   L   +   + G      + ++   V     E +   +  + ++   +  +L+L H HV  H   L  T  +  +  +   +    T++  I       IG  +R N   I + ++M+   SQ+ L +         +P G+E   + VG +  +E+    F+RL + V    L +   P+R +F++ GP++ + +  EVGR    +++N  F  + Y+A+ + D++SA  +F+++S ++       H++    LP  +  A K      + K LQ      KR+S        I+IG    +++KA   +LE Q                  +                   +L+  L+ + +R +    SD  DG   E         +F YF  LS AITFG L +   +  + I+  L+S     +++  ++ QPL I+G T  + + ++ L             +R ++GV+L I+    + F G++ V    R  +E+++   ++IY++     L ++++  P    Y L  P     E++T   NE         T  +  +++N     + I          N  ++                       L    R+ LG F VP+ I +   ++Y+    +         + K+ +   ++  D SK        + ST     C +  + ++I++ +E   + + V K +R LKK +    ++  L  +     IF G P+   A VRS  H  S+   S   APG   RI+   EQR+SG  V +++  SV +  +L+ IPMA ++G+FLYMGV  +S + L++R+       KH+    Y+K +  W +
Sbjct:  165 DTALEEADLNELRSHRSDDPRALRRHKIHHSSIKLRELPQITISPFTNKKPE-----VDHSPHEIFVQLD--ELTGVGEDREWKETARWIKYEEDVEEGSDRWGKPHVASLSFHSLLNLRRCLETGVVLLDLNEKDLPAVAYRVVEQMVIEDLIDINDKPSVMRSLLLRHRHVNEHQGVLPFTKRKYNS--YTSLQNLSGTDDKKIKIMPAAEIGGSKRSNELKIDMKDDMYS-SSQEDLKKLQNDTILKRIPAGAEATTVLVGAVEFLEQPTIAFVRLSEGVLMPTLTEVPVPVRFMFVLLGPRNFDLDYHEVGRSISTLMANEHFHSIAYKADDRKDLLSAINEFLDDSIVLPPGNWDRHDL----LPFEELKAKKDWIRTRKIKALQ-----VKRDSEM------IKIG---KDEEKA---LLEKQTLGAIGFTIGGGDGGGDGDSDDDNGRKKKKPSPLEKTGRLWGGLRNDLKRRMPMYKSDILDGLNTET----LAATIFMYFACLSTAITFGGLVSAKTNSWIGISETLISCSLVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQHEFDFLSLRVYVGVWLIIIALTVSAFEGSVYVRLLTRFTQEIFSALITLIYIVETFMKLISIYRENPLLSDYNLPPPTLVAHEHAT---NESLLNATASVTTNITQMVMNISTTAMPIGPPPLPKNQPNTALFCTILTLATFVVAYYLKLFRNSHFLGRNARRALGDFGVPISIAIFVLVDYLVPAVY---------TEKLVVPEGLSPSDPSKRGWYIGFDTSSTWIPFACVIPALLVYILIFMESQISELIVDKPDRGLKKGSGLHWDIVLLCLLNCACGIF-GMPWHCAATVRSVTHVSSVTIMSRTHAPGESPRIVDVKEQRLSGFFVCLMIGLSVLMAPLLRLIPMAVLFGVFLYMGVASMSGVQLFERIRLYFMPVKHYPPTSYVKRLRPWKL 1091          
BLAST of slc4a-7 vs. Ensembl Fly
Match: CG8177 (gene:FBgn0036043 transcript:FBtr0331848)

HSP 1 Score: 203.756 bits (517), Expect = 3.791e-53
Identity = 208/893 (23.29%), Postives = 383/893 (42.89%), Query Frame = 3
Query:  339 WTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMH---LSSTIHECPTIHFNEEKQCFETNENYI-----PHIG--RRRNRSSITLNENMHRVQSQKKLSEC--------LPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQ-KHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQK---------------KEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYL----SDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSA---LFTMFKALPYF--YTLYSPA----ENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKI----------NRGIY-----------------------LRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSK------LTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            W E +RWI YEED +    R+  PH+++LS   L   +   + G      + ++   V     E +   +  + ++   +  +L+L H HV  H   L  T  +  +  +   +    T++  I       IG  +R N   I + ++M+   SQ+ L +         +P G+E   + VG +  +E+    F+RL + V    L +   P+R +F++ GP++ + +  EVGR    +++N  F  + Y+A+ + D++SA  +F+++S ++       H++    LP  +  A K      + K LQ      KR+S        I+IG    +++KA   +LE Q                  +                   +L+  L+ + +R +    SD  DG   E         +F YF  LS AITFG L +   +  + I+  L+S     +++  ++ QPL I+G T  + + ++ L             +R ++GV+L I+    + F G++ V    R  +E+++   ++IY++     L ++++  P    Y L  P     E++T   NE         T  +  +++N     + I          N  ++                       L    R+ LG F VP+ I +   ++Y+    +         + K+ +   ++  D SK        + ST     C +  + ++I++ +E   + + V K +R LKK +    ++  L  +     IF G P+   A VRS  H  S+   S   APG   RI+   EQR+SG  V +++  SV +  +L+ IPMA ++G+FLYMGV  +S + L++R+       KH+    Y+K +  W +
Sbjct:  284 WKETARWIKYEEDVEEGSDRWGKPHVASLSFHSLLNLRRCLETGVVLLDLNEKDLPAVAYRVVEQMVIEDLIDINDKPSVMRSLLLRHRHVNEHQGVLPFTKRKYNS--YTSLQNLSGTDDKKIKIMPAAEIGGSKRSNELKIDMKDDMYS-SSQEDLKKLQNDTILKRIPAGAEATTVLVGAVEFLEQPTIAFVRLSEGVLMPTLTEVPVPVRFMFVLLGPRNFDLDYHEVGRSISTLMANEHFHSIAYKADDRKDLLSAINEFLDDSIVLPPGNWDRHDL----LPFEELKAKKDWIRTRKIKALQ-----VKRDSEM------IKIG---KDEEKA---LLEKQTLGAIGFTIGGGDGGGDGDSDDDNGRKKKKPSPLEKTGRLWGGLRNDLKRRMPMYKSDILDGLNTET----LAATIFMYFACLSTAITFGGLVSAKTNSWIGISETLISCSLVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQHEFDFLSLRVYVGVWLIIIALTVSAFEGSVYVRLLTRFTQEIFSALITLIYIVETFMKLISIYRENPLLSDYNLPPPTLVAHEHAT---NESLLNATASVTTNITQMVMNISTTAMPIGPPPLPKNQPNTALFCTILTLATFVVAYYLKLFRNSHFLGRNARRALGDFGVPISIAIFVLVDYLVPAVY---------TEKLVVPEGLSPSDPSKRGWYIGFDTSSTWIPFACVIPALLVYILIFMESQISELIVDKPDRGLKKGSGLHWDIVLLCLLNCACGIF-GMPWHCAATVRSVTHVSSVTIMSRTHAPGESPRIVDVKEQRLSGFFVCLMIGLSVLMAPLLRLIPMAVLFGVFLYMGVASMSGVQLFERIRLYFMPVKHYPPTSYVKRLRPWKL 1135          
BLAST of slc4a-7 vs. Ensembl Fly
Match: CG8177 (gene:FBgn0036043 transcript:FBtr0076325)

HSP 1 Score: 203.756 bits (517), Expect = 4.401e-53
Identity = 225/975 (23.08%), Postives = 410/975 (42.05%), Query Frame = 3
Query:   93 DNPVYEEDENEIKDDQPDSEVAGGELKQWRNSIEQEGDMSFHDQPIYMKKESSATTICQTSVPDLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMH---LSSTIHECPTIHFNEEKQCFETNENYI-----PHIG--RRRNRSSITLNENMHRVQSQKKLSEC--------LPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQ-KHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQK---------------KEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYL----SDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSA---LFTMFKALPYF--YTLYSPA----ENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKI----------NRGIY-----------------------LRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSK------LTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            D  + E D NE++  + D   A    K   +SI+          P   KK          S  ++ ++LD   L        W E +RWI YEED +    R+  PH+++LS   L   +   + G      + ++   V     E +   +  + ++   +  +L+L H HV  H   L  T  +  +  +   +    T++  I       IG  +R N   I + ++M+   SQ+ L +         +P G+E   + VG +  +E+    F+RL + V    L +   P+R +F++ GP++ + +  EVGR    +++N  F  + Y+A+ + D++SA  +F+++S ++       H++    LP  +  A K      + K LQ      KR+S        I+IG    +++KA   +LE Q                  +                   +L+  L+ + +R +    SD  DG   E         +F YF  LS AITFG L +   +  + I+  L+S     +++  ++ QPL I+G T  + + ++ L             +R ++GV+L I+    + F G++ V    R  +E+++   ++IY++     L ++++  P    Y L  P     E++T   NE         T  +  +++N     + I          N  ++                       L    R+ LG F VP+ I +   ++Y+    +         + K+ +   ++  D SK        + ST     C +  + ++I++ +E   + + V K +R LKK +    ++  L  +     IF G P+   A VRS  H  S+   S   APG   RI+   EQR+SG  V +++  SV +  +L+ IPMA ++G+FLYMGV  +S + L++R+       KH+    Y+K +  W +
Sbjct:  200 DTALEEADLNELRSHRSDDPRALRRHKIHHSSIKLRELPQITISPFTNKKPE-----VDHSPHEIFVQLD--ELTGVGEDREWKETARWIKYEEDVEEGSDRWGKPHVASLSFHSLLNLRRCLETGVVLLDLNEKDLPAVAYRVVEQMVIEDLIDINDKPSVMRSLLLRHRHVNEHQGVLPFTKRKYNS--YTSLQNLSGTDDKKIKIMPAAEIGGSKRSNELKIDMKDDMYS-SSQEDLKKLQNDTILKRIPAGAEATTVLVGAVEFLEQPTIAFVRLSEGVLMPTLTEVPVPVRFMFVLLGPRNFDLDYHEVGRSISTLMANEHFHSIAYKADDRKDLLSAINEFLDDSIVLPPGNWDRHDL----LPFEELKAKKDWIRTRKIKALQ-----VKRDSEM------IKIG---KDEEKA---LLEKQTLGAIGFTIGGGDGGGDGDSDDDNGRKKKKPSPLEKTGRLWGGLRNDLKRRMPMYKSDILDGLNTET----LAATIFMYFACLSTAITFGGLVSAKTNSWIGISETLISCSLVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQHEFDFLSLRVYVGVWLIIIALTVSAFEGSVYVRLLTRFTQEIFSALITLIYIVETFMKLISIYRENPLLSDYNLPPPTLVAHEHAT---NESLLNATASVTTNITQMVMNISTTAMPIGPPPLPKNQPNTALFCTILTLATFVVAYYLKLFRNSHFLGRNARRALGDFGVPISIAIFVLVDYLVPAVY---------TEKLVVPEGLSPSDPSKRGWYIGFDTSSTWIPFACVIPALLVYILIFMESQISELIVDKPDRGLKKGSGLHWDIVLLCLLNCACGIF-GMPWHCAATVRSVTHVSSVTIMSRTHAPGESPRIVDVKEQRLSGFFVCLMIGLSVLMAPLLRLIPMAVLFGVFLYMGVASMSGVQLFERIRLYFMPVKHYPPTSYVKRLRPWKL 1126          
BLAST of slc4a-7 vs. Ensembl Fly
Match: CG8177 (gene:FBgn0036043 transcript:FBtr0076324)

HSP 1 Score: 203.756 bits (517), Expect = 4.401e-53
Identity = 225/975 (23.08%), Postives = 410/975 (42.05%), Query Frame = 3
Query:   93 DNPVYEEDENEIKDDQPDSEVAGGELKQWRNSIEQEGDMSFHDQPIYMKKESSATTICQTSVPDLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMH---LSSTIHECPTIHFNEEKQCFETNENYI-----PHIG--RRRNRSSITLNENMHRVQSQKKLSEC--------LPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQ-KHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQK---------------KEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYL----SDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSA---LFTMFKALPYF--YTLYSPA----ENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKI----------NRGIY-----------------------LRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSK------LTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            D  + E D NE++  + D   A    K   +SI+          P   KK          S  ++ ++LD   L        W E +RWI YEED +    R+  PH+++LS   L   +   + G      + ++   V     E +   +  + ++   +  +L+L H HV  H   L  T  +  +  +   +    T++  I       IG  +R N   I + ++M+   SQ+ L +         +P G+E   + VG +  +E+    F+RL + V    L +   P+R +F++ GP++ + +  EVGR    +++N  F  + Y+A+ + D++SA  +F+++S ++       H++    LP  +  A K      + K LQ      KR+S        I+IG    +++KA   +LE Q                  +                   +L+  L+ + +R +    SD  DG   E         +F YF  LS AITFG L +   +  + I+  L+S     +++  ++ QPL I+G T  + + ++ L             +R ++GV+L I+    + F G++ V    R  +E+++   ++IY++     L ++++  P    Y L  P     E++T   NE         T  +  +++N     + I          N  ++                       L    R+ LG F VP+ I +   ++Y+    +         + K+ +   ++  D SK        + ST     C +  + ++I++ +E   + + V K +R LKK +    ++  L  +     IF G P+   A VRS  H  S+   S   APG   RI+   EQR+SG  V +++  SV +  +L+ IPMA ++G+FLYMGV  +S + L++R+       KH+    Y+K +  W +
Sbjct:  200 DTALEEADLNELRSHRSDDPRALRRHKIHHSSIKLRELPQITISPFTNKKPE-----VDHSPHEIFVQLD--ELTGVGEDREWKETARWIKYEEDVEEGSDRWGKPHVASLSFHSLLNLRRCLETGVVLLDLNEKDLPAVAYRVVEQMVIEDLIDINDKPSVMRSLLLRHRHVNEHQGVLPFTKRKYNS--YTSLQNLSGTDDKKIKIMPAAEIGGSKRSNELKIDMKDDMYS-SSQEDLKKLQNDTILKRIPAGAEATTVLVGAVEFLEQPTIAFVRLSEGVLMPTLTEVPVPVRFMFVLLGPRNFDLDYHEVGRSISTLMANEHFHSIAYKADDRKDLLSAINEFLDDSIVLPPGNWDRHDL----LPFEELKAKKDWIRTRKIKALQ-----VKRDSEM------IKIG---KDEEKA---LLEKQTLGAIGFTIGGGDGGGDGDSDDDNGRKKKKPSPLEKTGRLWGGLRNDLKRRMPMYKSDILDGLNTET----LAATIFMYFACLSTAITFGGLVSAKTNSWIGISETLISCSLVGIVFHCLSCQPLVIIGTTGPLLLFDEALMVFCTQHEFDFLSLRVYVGVWLIIIALTVSAFEGSVYVRLLTRFTQEIFSALITLIYIVETFMKLISIYRENPLLSDYNLPPPTLVAHEHAT---NESLLNATASVTTNITQMVMNISTTAMPIGPPPLPKNQPNTALFCTILTLATFVVAYYLKLFRNSHFLGRNARRALGDFGVPISIAIFVLVDYLVPAVY---------TEKLVVPEGLSPSDPSKRGWYIGFDTSSTWIPFACVIPALLVYILIFMESQISELIVDKPDRGLKKGSGLHWDIVLLCLLNCACGIF-GMPWHCAATVRSVTHVSSVTIMSRTHAPGESPRIVDVKEQRLSGFFVCLMIGLSVLMAPLLRLIPMAVLFGVFLYMGVASMSGVQLFERIRLYFMPVKHYPPTSYVKRLRPWKL 1126          
BLAST of slc4a-7 vs. Ensembl Zebrafish
Match: slc4a2a (solute carrier family 4 member 2a [Source:ZFIN;Acc:ZDB-GENE-051101-2])

HSP 1 Score: 257.299 bits (656), Expect = 3.241e-70
Identity = 212/868 (24.42%), Postives = 391/868 (45.05%), Query Frame = 3
Query:  282 DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVG---------MHLSSTIHECPTIHFNEEKQCFETN-ENYIPHIGRRRN---RSSITLNE----------NMHRVQSQK--KLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKAL--PYFYTLYSPAENST-LYINERDKFGIGGTTXXXXXXXXXXXXXXV-----------KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSK--LTSLSTADQ------GYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            ++ +EL+ L ++ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +    + +   E +  S++    +   +  AL+L H H            ++S+T       H++              P IG  RN   RSS+   E           +H+ +S+   KL E +P  +E  ++ VG +  +++    F+RL + V  + +L+   P+R +F++ GP S   +  ++GR    ++S++ F E  Y A+ + D+++A   F++ S +V     +  + L+H + + +          H++H Q +  + K   + D+    I + P    +D    D L    +                   F  +  D++    +Y+SDF+D  +    P     ++F YF  LSPA+TFG L  +     + ++ L++S+    +L+ L+  QPL IVG +  + + E+   S   S  +     R WIG++L I+  +   F G+ +V    R  +E+++   S+I++    F + K        +   P EN+T L     D    G +            L L            K     +     R+ +G F VP+ I  +  L+Y   + +    L++PD         V  PD     +  L +  Q      G C L  + ++I++ +E    ++ V+K ER L K + + L++  ++    I ++F G P+ +GA VRS  H  S+   S   APG   RI    EQR++G +V +LV  S+ +G +L+ +P+A ++G+FLYMGVM ++ + L +R++ L    K+  +H Y++ +
Sbjct:  324 EVFVELNELLMD-KNQEMHWKETARWIKFEEDVEEETERWGKPHVASLSFRSLLELRKTISHGAVLLDLDQKTLPGIAHQVVEQMIISDQIRAHDRANVLRALLLKHSHPSDGKEHSLFNRNISATSLGSLISHYHSTNHIGAPELPATDPLIGGLRNFESRSSVDYVEKNEKDSPQFFGLHKTKSKHELKLLEKIPEDAEATVVLVGCVDFLDQPTMAFVRLKEAVLLESVLEVPIPVRFLFVLLGPPSANIDYHQIGRSISTLMSDKHFHEAAYLADGRQDLLTAINSFLDCS-IVLPPSEVGGDELLHSIARFQKEM------LHKRHEQEVKLQAKEPKSPDD----IALQPPLKPED----DPLRRTGR------------------LFGGVIRDVRRRYPKYISDFKDALS----PQCMATVIFIYFAALSPAVTFGGLLGEKTDGLIGVSELIISTAVQGMLFCLLGAQPLLIVGFSGPLLVFEEAFYSFCKSNDLEYLTGRMWIGMWLIIIVLLTVAFEGSFLVRFVSRFTQEIFSILISLIFIYETFFKLGKIFMDHPLRSCSGPEENATSLSTGSNDSRSTGASQTLNQPNTALLSLVLTSGTFFIAYYLRKFKNSAFFPGRLRRAIGDFGVPIAISTMVLLDYSIKDTYTQ-KLNVPDG------FSVTSPDKRGWFIHPLGSDGQFPIWMMGACILPALLVYILIFMETQITTLIVSKKERMLVKGSGFHLDLLIIVVSGGIAALF-GLPWLTGATVRSVTHANSLTVMSKAVAPGDKPRIQEVKEQRVTGFLVALLVGLSIVIGDLLRQVPIAVLFGIFLYMGVMSLNGIQLTERMMLLFMPPKYHPDHTYVRKV 1145          
BLAST of slc4a-7 vs. Ensembl Zebrafish
Match: slc4a2b (solute carrier family 4 member 2b [Source:ZFIN;Acc:ZDB-GENE-030429-14])

HSP 1 Score: 248.054 bits (632), Expect = 3.262e-67
Identity = 211/898 (23.50%), Postives = 394/898 (43.88%), Query Frame = 3
Query:  237 KKESSATTICQTSVPDLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVG---MHLSS--------------TIHECPTIHFN-EEKQCFE-------TNENYIPHIGRRRNRSSITLNENMHRVQSQK--KLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYI-DLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL---LSALFTMFKALPY--FYTLYSPAENSTL--YINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTF-------------------RKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSKLTSLSTADQGY--------CFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            K+ S+ +     +  ++ +EL+ L ++ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +    + +   E +  S++   ++   +  AL+L H H      H++S              + H+  + H    E    E        +++   HI   +N         MHR +S+   KL E +P  +E  ++ VG +  +E+    F+RL + V  D +L+   P+R +F++ GP S   +  ++GR    ++S+++F E  Y A+ + D+++A   F+ + ++V     +  E L+  +   +    +   EQ                           G     K+  S      Q+KE      K      K     +   I D +    +Y+SDFRD       P     ++F YF  LSPAITFG L  +     + ++ L+V++    +L+ L+  QPL IVG +  + + E+   S      +     R WIG +L I+  +   F G+ +V    R  +E+++F  S+I++    S L  +F+  P      +     NS+L   ++E  +  +  T      ++         +   + +  TF                   R+++G F VP+ I+++  ++Y   + +    LS+P          V  PD            G           L  + +FI++ +E    ++ V+K ER L K + + L++  ++T+    ++F G P+ + A VRS  H  ++   S   APG   RI    EQR++G++V ILV  S+ +G +L+ IP+A ++G+FLYMGVM ++ + + +R++ L+   K+  +H Y++ +
Sbjct:  298 KERSTRSRKLDRTPHEVFVELNELIMD-KNQEMQWRETARWIKFEEDVEEETDRWGKPHVASLSFRSLLELRKTIAHGAVLLDLDQKTLPGISHQVVEQMIISDQIKAEDRANVLRALLLKHSHPSDEKEHITSFPRNISAASLGSLISHHQSSSNHLTIPETSVMEPLMGSSRASQDSTVHIDIDKNEKDSATPIGMHRSKSKHELKLLEKIPENAEATVVLVGSVDFLEQPTMAFVRLQEAVELDSVLEVPVPVRFLFVLLGPPSTNMDYHQIGRSISTLMSDKQFHEAAYLADDRQDLLNAINGFL-DCSIVLPPSELGGEDLLRSVAHFQREMLRKREEQ---------------------------GVALMAKEPKSL-----QEKEALLAPFKPEDDPLKRTGRLFGGLIRDAQRRYPKYISDFRDALN----PQCMAAVIFIYFAALSPAITFGGLLGEKTEGLLGVSELIVATCVQGVLFCLLGAQPLLIVGFSGPILVFEEAFFSFCKGNNMEYLTGRVWIGFWLIIIVVLMVAFEGSFMVRFVSRFTQEIFSFLISLIFIYETFSKLAKIFQEHPLQRCSAVLVDVRNSSLNSSMDEVTESPLAVTNSSSQEMLKVVGEPNTALLSLVLMSGTFLIAFYLRKFKNSAFFPGRLRRVIGDFGVPIAILIMVLVDYSVKDTYTQ-KLSVPRG------FSVTSPDKRGWIVNPLGSDGQFPIWMMFASILPALLVFILIFMETQITTLIVSKKERMLVKGSGFHLDLLLIVTLGGTSALF-GLPWMAAATVRSVTHANALTVMSKAVAPGDKPRIQEVKEQRVTGLLVAILVGLSIVIGDLLRQIPIAVLFGIFLYMGVMSLNGIQMTERILLLLMPPKYHPDHTYVRKV 1149          
BLAST of slc4a-7 vs. Ensembl Zebrafish
Match: slc4a3 (solute carrier family 4 member 3 [Source:ZFIN;Acc:ZDB-GENE-141006-1])

HSP 1 Score: 222.631 bits (566), Expect = 5.281e-60
Identity = 169/693 (24.39%), Postives = 316/693 (45.60%), Query Frame = 3
Query:  756 HRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL---LSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXV----------KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDS--NKINI--SMWVNIPD--------FSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            H      KL   +P  +E  ++ VG +  +E+    F+RL++ +  + +L+   P+R IF++ GP     +  E+GR F  ++S++ F E+ Y A+ + D+++   +F++ S ++  +     ++L       K    K    + +K    +   E      + KD+NIE     +      FDV   ++                   PF  L  D++    RY+SD +D    +        ++F YF  LSP ITFG L  +     M ++ L++S+ T  +L+ L+ GQPL I+G +  + + E+       + G      R WIG +L  +  V     G+ +V       +E++ F  S+I++    S L  +F+  P   +  S A   +   ++R    IG   L      L   + ++          K+    +L    R+++G F +P+ I++   ++ +           IPD+   K+N+     V  PD        F           G   +  + +FI++ +E    ++ V+K ER+L K + + L++  ++T+  I  +F G P+ + A VRS  H  ++   S   APG    I    EQR++GM V ILV  S+ +  +L++IP+A ++G+FLYMG+  ++ + L++R+  ++   KH  +H Y+  +  W +
Sbjct:  112 HAASRSLKLLAKIPKDAEATVVLVGCVEFLEKPAMAFVRLNESILLESILEVPVPIRFIFVLLGPTQTNVDYHEIGRSFSTLMSDKNFHEVAYFADDRQDLLNGINEFLDCSIVIPPSDVEGKDLLKTVASFQKQMLRKRKERELKKCASTVTGAE-----LETKDVNIEEQEEEDQ-----FDVDPLKRS----------------GIPFGGLIHDIRRRYPRYISDLKDALDTQ----CIAAVIFIYFAALSPTITFGGLLGEKTQGMMGVSELIISTATVGVLFSLLAGQPLLIIGFSGPLLVFEEAFYKFCQAQGFEYLTGRVWIGFWLIFIVLVIVAAEGSFLVRYISPFTQEIFAFLISLIFIYETFSKLIKVFQEHPLMMSYTSAAFKHS---DQRGSSVIGEPILNQPNTALLSMVLMMGTFFTAFFLRKLRNSRFLGGKVRRVIGDFGIPISILISVLVDIL-----------IPDTYTQKLNVPSGFSVTSPDKRGWFISPFGDKQPFPVWMMGASVIPALLVFILIFMETQITTLIVSKKERRLMKGSGFHLDLLLIVTLGAICPLF-GLPWLTAATVRSVTHVNALTVMSKATAPGEKPMIQEVKEQRVTGMCVAILVGLSIVMTDVLRHIPLAVLFGIFLYMGITSLTGIQLYERITLMVTPAKHHPDHVYVTKVKTWRM 759          
BLAST of slc4a-7 vs. Ensembl Zebrafish
Match: slc4a4b (solute carrier family 4 member 4b [Source:ZFIN;Acc:ZDB-GENE-091030-1])

HSP 1 Score: 214.157 bits (544), Expect = 2.345e-56
Identity = 208/878 (23.69%), Postives = 367/878 (41.80%), Query Frame = 3
Query:  279 PDLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTI--HFNEEKQCFETNENYIPHIGRRRNRSSITLNE---NMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPY----------FYTLY----SPAE---NSTLYI------------NERDKFG---IGGT----------TXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKIN-------ISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPL 2750
            P L  ELD L L        W E +RWI +EE  +    R++ PH++TLS+  L   K+  + G      D  +   ++   ++S  +S +   D  + +   L+  H H      S +     I    +   + F + EN  P    R N +S +LN+      + Q   K  + +P  +E + + VG +  ++     F+RL Q V   GL +   P R +FI+ GPK + +   E+GR    ++S+  F ++ Y+A  + D+++   +F++             E++V  LP  ++  +               E  K   + D +  N+  G           D             +  ++           L +D+K     + SDF D    ++     + I+F Y   ++ AITFG L          +    V +     ++ L+ GQPL I+  T  V + E++L + +          R WIG++   +  V    + + +V  F R  EE ++   S I++  A   M K   +            T Y    +P E   N+T+Y             +E  ++G   +G T          +  L        + L K     +   T RKL+  F + L I++   ++ +       P L +P   K         ++ +   P +  L S         FL  + + I++ ++    ++ V + E KLKK   Y L++F  +++  ++  FLG P++  A V S AH  S+   +  +APG   + +G  EQR++G++V IL   SVF+  +LK+IPM  +YG+FLYMGV  ++ +    RL  L+   KH  +  YL+ +PL
Sbjct:  142 PQLFTELDEL-LAVDGQELEWKETARWIKFEEKVEKGGERWSKPHVATLSLHSLFQLKNCIEKGTIVLDMDANSLQQIVENITDSQIESGQLKADLRETVIYTLLRKHRH--QTKKSNLRSLADIGKSVSSASRLFSSQENGSPTTAHR-NLTSTSLNDLSDKPEKDQLNNKFMKKIPRDAEASNVLVGEVDFLDAPFVSFVRLQQSVMLGGLTEVPVPTRFLFILLGPKGKAKSYREIGRAIATLMSDEVFHDIAYKARDRSDLLAGIDEFLD-------------EVIV--LPPGEWDPDIR------------IEPPKSVPSADKRKNNLAGGEGSQMNGGTPHDGGSGGGGGHAVGDELKMTGKFCG-----GLVLDIKRKLPFFASDFYDALNIQS----LSAILFIYLGTVTNAITFGGLLGDATENMQGVLESFVGTALTGAVFCLLAGQPLTILSSTGPVLVFERLLFNFSRENAFDYLEFRLWIGLWSGFMCLVLVATDASFLVQYFTRFTEEGFSALISFIFIYDAFKKMLKLAHHNPINSGYDLELVTQYGCHCTPPEGEENTTIYSHHLNATWASLSRSECQEWGGQLVGATCDFVPDITLMSFILFFGTYACSMGLKKFKTSRFFPTTVRKLISDFAIILAILIFCGVDALV--GVDTPKLIVPSEFKPTSPHRGWFVAPFGGNPWWVYLAS---------FLPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLF-WVSILLVVCSFLGLPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGIMVFILTGLSVFMAPVLKFIPMPVLYGVFLYMGVASLNGVQFLDRLELLLMPAKHQPDLIYLRHVPL 967          
BLAST of slc4a-7 vs. Ensembl Zebrafish
Match: slc4a1b (solute carrier family 4 member 1b (Diego blood group) [Source:ZFIN;Acc:ZDB-GENE-110215-2])

HSP 1 Score: 209.149 bits (531), Expect = 1.722e-55
Identity = 191/840 (22.74%), Postives = 347/840 (41.31%), Query Frame = 3
Query:  315 NPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLP-QLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFN------KLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL---LSALFTMFKALPY---FYTLYSPAEN--------STLYINERDKFGIGGTTXXXXXXXXXXXXXXVKIN------------RGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKI-NISM--WVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRK-HWNE 2723
            +P   SY W E  RW  YEE +D+E  R++  H+S L+ + L   +     G      + +    ++    +++         +  ++  AL        MH  S   E   +  N E + F   E        +R  +  T                      E +++ VG L  +ER   +F+RL   V  +  L+   P+R IFI+ GP        E GR    +L+++ F +  ++A+S  ++  A   F++   ++         +L   +P Q K    +      +  L     +  + S    +D     G  F    +                                    D+K   + Y+SD  D    +    +   I+F YF  LSPAITFG L          V   M ++ L++S+    +++ LI  QP+ ++G +  + + E+   +   S GI   + R W+G++L ++        G+ +V    R  +E+++   S+I++    + L  +F+  P    +  L +  E+          ++ N      +  T    A          +                G +L    R+LLG F VP+ I L+ A++    + +    L +P   ++ N SM  W+  P F +  S          +  I +FI++ +E    ++ V+K ERK+ K + + +++  L+++  + S F G P+ S A VRS +H  ++   S    P I K +    EQR+SG++V +LV  S+ +  ILK IP+ +++G+FLYMG+  +S + LW R++ L+  +K H NE
Sbjct:    9 SPNQQSY-WQEMGRWAGYEETYDVEAGRWSPSHISYLTFKSLVQIRRTMNTGVMMLDREEKTLSSIIEKIVDTLVSKKEIQPGDRDKVLQAL--------MHKQSQSVETQPLTSNVEMEKFSVTE--------KRETADKT----------------------EASMVLVGALEFLERPTVVFVRLRDAVVLESALEAPVPVRFIFILIGPTIDGMNYHECGRAMAALLADKVFNQAAFQAQSDRELTDAVGDFMDCCIVIPPTEIQNESLLTSLIPFQKKLLQERLRPSNPKLRLDVKPRKPSKSSGPPPEDPLTRTGVPFGGMIR------------------------------------DMKRRYKHYISDLTDALNAQ----VLAAIIFIYFAALSPAITFGGLLALTFLIADKVDNMMGVSELMISTSLLGIIFCLIAAQPVLVIGFSGPLLVFEEAFFNFCKSQGIEYIVGRVWVGIWLVVIVVGIVALEGSFLVRFISRFTQEIFSILISLIFIYETFAKLLKIFREHPLTLNYEHLNTSVEDPWHSIVSYQKIFDNATGNVSVVRTVEHQAYPNTALLSMCLMFGCFSIAYYLRMFKNGKFLPGKIRRLLGDFGVPIAIFLMAAIDINIEDTYTQ-KLVVPKGLQVSNPSMRGWLINP-FGEHKSFPVWMMFASIVPAILVFILIFLESQITTLIVSKPERKMVKGSGFHMDLLILVSMGGL-SAFFGIPWLSAATVRSVSHANALTVMSKGPKPEIEKVL----EQRVSGVVVALLVGLSILMEPILKMIPITALFGIFLYMGITSLSGIQLWDRMLLLLIPKKYHPNE 762          
BLAST of slc4a-7 vs. Ensembl Xenopus
Match: slc4a3 (solute carrier family 4 (anion exchanger), member 3 [Source:NCBI gene;Acc:100495394])

HSP 1 Score: 236.884 bits (603), Expect = 6.471e-64
Identity = 189/829 (22.80%), Postives = 370/829 (44.63%), Query Frame = 3
Query:  339 WTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHV-----GMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLP-QLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKAL---PYFYTLYSPAE---NSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSK----LTSLSTADQGYCFLI------GITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            W E +RWI +EE+ + E  R+  PH+++LS R L   +    +G      +      ++ T  +++  S +    +   ++ AL+L H H        H  S+       H        E N     H    + +   TLN          KL E +P  +E  ++ VG +  +E+  + F+RLD+ V  + +L+   P+R ++++ GP     +  E+GR    ++S++ F E  Y A  + D+++A  +F++ S ++      + ++L      Q      +   EQ +   +N+    + +S         ++ P+    D++  D LE                       F  L  D++    +Y SD +DG   +         +F YF  LSPAITFG L  +     M ++ L+VS+    +++ L+  QPL IVG +  + + E+          I     R WIG +L     V     G+ +V       +E++ F  S+I++    + ++K     P   T Y P       T  +  R +      +L L +       +L K     +L    R+++G F +P+ I+++  ++Y   + +         + K+N+   +++    K    +  + T+     +++       + +FI++ +E    ++ V++ ER+L+K + + L++  + ++  + ++F G P+ +   VRS  H  ++   S   APG   RI    EQR++ +++  LV  S+ +G +L+ IP+A ++G+FLYMGV  ++ + L++RL+ ++   KH  EH Y+  +  W +
Sbjct:  129 WRETARWIKFEENVEQETSRWGKPHVASLSFRSLLELRKTITNGTLFLDLEQTTMPRIVQTIVDTMVVSEQIGACDRASVQRALLLKHSHPNDGREAHHPRSSTGSSTGNHLENNSPPIE-NSFSKSHDADSKQK---TLNGPEGHRMKHWKLMEKIPENAEATVVLVGCVDFLEQAATAFVRLDEAVLLESVLEVPIPVRFLYVLLGPTQANMDYHEIGRSISTLMSDKVFHEAAYTAAGRQDLLNAINEFLDCSMVLPPCEMQSKDLLRSIAAFQKDLLRKRREREQRRSARENVPPTVQGQSVEAR-----QLKPDDEEDDESQSDPLERSG------------------YLFGGLVRDIRRRYVKYWSDIKDGLNSQ----CLAAALFIYFAALSPAITFGGLLGEKTQGLMGVSELIVSTSVLGVIFALLAAQPLLIVGFSGPLLVFEEAFFKFCQVQEIEYLTGRVWIGFWLIFFILVMVAAEGSFLVRYISPFTQEIFAFLISLIFIHETFYKLYKVFAEHPLLRT-YPPVGAVVGRTAALGPRMQPNTALLSLILMVGTFLIAFFLRKFKNSRFLGGQARRVIGDFGIPISILVMVFIDYAITDTY---------TQKLNVPSGLSVTSPGKRGWFIDPMGTSKPFPLWMMFASAIPALLVFILMFMETQITTLIVSRKERRLQKGSGFHLDLLLIGSLGGVCALF-GLPWLTATTVRSVTHINALTVMS-KTAPGEKPRIAEVKEQRVTAVLISALVGLSIVMGEMLRQIPLAVLFGIFLYMGVTSLTGIQLFERLLLILMHPKHHPEHPYVVKVCTWRM 914          
BLAST of slc4a-7 vs. Ensembl Xenopus
Match: SLC4A1 (solute carrier family 4 member 1 (Diego blood group) [Source:NCBI gene;Acc:100486998])

HSP 1 Score: 231.106 bits (588), Expect = 1.460e-62
Identity = 210/874 (24.03%), Postives = 380/874 (43.48%), Query Frame = 3
Query:  195 QEGDMSFHDQPIYMKKESSAT---TICQTSVP------DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL---LSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSKLTSLSTADQGY-------CFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            Q G      +P   ++E+SA     +    +P      ++ IEL  L ++   N   W E +RW+  EED+  ++R++  P +S L+   L      F+ G        +    + +   + +   +R       E+  AL+L H       S    E   +   E  Q                   S+ +     + Q +  L+E +P  +E +++ VG +  +E+    F+RL + VY D +L+   P+R +F++ GP +      EVGR    M++ R FR  +Y AE + D+I + + F+E S ++        ++L   +P  K    K +  Q +K L  I  E   E   D        G  F                                      L  D++    +YLSD  D       P     ++F YF  LSPAITFG L ++  +  M ++ LLVS+    +++ +   QPL I+G +  + + E+   +   S GI   + R WIG +L ++  +   F G+ +V    R  +E+++F  S+I++    + L T+F   P     Y+      L    +    +    L     ++ F L   K N G +     R+++G F VP+ I+L+   +Y   + +    LS+P    +++S   N   F      +T D  +         +  + +FI++ +E    ++ V+K ERK  K + + L++  ++ +  + ++F G P+ S   VR+  H  ++   S    P I +R+I   EQRISG +V ILV  S+ +  IL  IP+A ++G+FLYMGV  ++ + L+ R++ +++  K+     ++  +  W +
Sbjct:    6 QGGQYRVKQKPFEEEEEASAPDFPPLAPAFIPPRHRTDEVYIELHELTMDAH-NEMRWVEAARWLKVEEDYQDDIRQWGKPQISYLTFHSLLEVHRAFQKGTVLLDLAEKTLPGISSQVIDQMIYEDRLKPQNRDEVLRALLLQH-------SRPDEEIIKVGDPESGQPL---------------LHSLEMKTMPEQEQKKSPLAERVPENAEASIVLVGCVSFLEQPTLAFVRLKEAVYLDTVLEVPLPIRFLFVLLGPDNSNISYHEVGRAVSSMMAERVFRNEMYLAEGRQDLIKSLEDFLEYSIVLPPCDSPDGQLLKDLVPVQKNLLRKRY--QVEKELGRIKPEIPDEPPEDPLR---RTGKIFGG------------------------------------LARDIRRRYPKYLSDITDALN----PQCLAAVIFIYFAALSPAITFGGLMSEKTNRWMGVSELLVSTAVQGVVFCIFGAQPLLILGFSGPLLVFEEAFYNFCESQGIEYIVGRVWIGFWLILIVIIVVAFEGSFLVRFISRFTQEIFSFLISLIFIYETFAKLVTIFSKHP-LQGHYNQTTEIDLAKAPQPNTALLSLVLMFGAFLIAFFLRQFK-NSG-FFPGKLRRIVGDFGVPIAILLMVVADYFIKDTYTQ-KLSLPKG--LSVSRPENRTWFIPPLGFNTVDNPFPIWMMFASVVPALLVFILIFMESQITTLIVSKPERKTIKGSGFHLDLLLIVGMGGVCALF-GMPWLSATTVRTVTHANALTITSKGDKPQI-ERVI---EQRISGFLVAILVGVSILMEPILTLIPLAVLFGIFLYMGVTSLNGIQLFDRILLMLKPPKYHPNVPFVTRVKTWRM 800          
BLAST of slc4a-7 vs. Ensembl Xenopus
Match: SLC4A1 (solute carrier family 4 member 1 (Diego blood group) [Source:NCBI gene;Acc:100486998])

HSP 1 Score: 231.491 bits (589), Expect = 2.007e-62
Identity = 210/874 (24.03%), Postives = 380/874 (43.48%), Query Frame = 3
Query:  195 QEGDMSFHDQPIYMKKESSAT---TICQTSVP------DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL---LSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSKLTSLSTADQGY-------CFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            Q G      +P   ++E+SA     +    +P      ++ IEL  L ++   N   W E +RW+  EED+  ++R++  P +S L+   L      F+ G        +    + +   + +   +R       E+  AL+L H       S    E   +   E  Q                   S+ +     + Q +  L+E +P  +E +++ VG +  +E+    F+RL + VY D +L+   P+R +F++ GP +      EVGR    M++ R FR  +Y AE + D+I + + F+E S ++        ++L   +P  K    K +  Q +K L  I  E   E   D        G  F                                      L  D++    +YLSD  D       P     ++F YF  LSPAITFG L ++  +  M ++ LLVS+    +++ +   QPL I+G +  + + E+   +   S GI   + R WIG +L ++  +   F G+ +V    R  +E+++F  S+I++    + L T+F   P     Y+      L    +    +    L     ++ F L   K N G +     R+++G F VP+ I+L+   +Y   + +    LS+P    +++S   N   F      +T D  +         +  + +FI++ +E    ++ V+K ERK  K + + L++  ++ +  + ++F G P+ S   VR+  H  ++   S    P I +R+I   EQRISG +V ILV  S+ +  IL  IP+A ++G+FLYMGV  ++ + L+ R++ +++  K+     ++  +  W +
Sbjct:   42 QGGQYRVKQKPFEEEEEASAPDFPPLAPAFIPPRHRTDEVYIELHELTMDAH-NEMRWVEAARWLKVEEDYQDDIRQWGKPQISYLTFHSLLEVHRAFQKGTVLLDLAEKTLPGISSQVIDQMIYEDRLKPQNRDEVLRALLLQH-------SRPDEEIIKVGDPESGQPL---------------LHSLEMKTMPEQEQKKSPLAERVPENAEASIVLVGCVSFLEQPTLAFVRLKEAVYLDTVLEVPLPIRFLFVLLGPDNSNISYHEVGRAVSSMMAERVFRNEMYLAEGRQDLIKSLEDFLEYSIVLPPCDSPDGQLLKDLVPVQKNLLRKRY--QVEKELGRIKPEIPDEPPEDPLR---RTGKIFGG------------------------------------LARDIRRRYPKYLSDITDALN----PQCLAAVIFIYFAALSPAITFGGLMSEKTNRWMGVSELLVSTAVQGVVFCIFGAQPLLILGFSGPLLVFEEAFYNFCESQGIEYIVGRVWIGFWLILIVIIVVAFEGSFLVRFISRFTQEIFSFLISLIFIYETFAKLVTIFSKHP-LQGHYNQTTEIDLAKAPQPNTALLSLVLMFGAFLIAFFLRQFK-NSG-FFPGKLRRIVGDFGVPIAILLMVVADYFIKDTYTQ-KLSLPKG--LSVSRPENRTWFIPPLGFNTVDNPFPIWMMFASVVPALLVFILIFMESQITTLIVSKPERKTIKGSGFHLDLLLIVGMGGVCALF-GMPWLSATTVRTVTHANALTITSKGDKPQI-ERVI---EQRISGFLVAILVGVSILMEPILTLIPLAVLFGIFLYMGVTSLNGIQLFDRILLMLKPPKYHPNVPFVTRVKTWRM 836          
BLAST of slc4a-7 vs. Ensembl Xenopus
Match: SLC4A1 (solute carrier family 4 member 1 (Diego blood group) [Source:NCBI gene;Acc:100486998])

HSP 1 Score: 228.794 bits (582), Expect = 1.108e-61
Identity = 203/836 (24.28%), Postives = 367/836 (43.90%), Query Frame = 3
Query:  282 DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL---LSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSKLTSLSTADQGY-------CFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            ++ IEL  L ++   N   W E +RW+  EED+  ++R++  P +S L+   L      F+ G        +    + +   + +   +R       E+  AL+L H       S    E   +   E  Q                   S+ +     + Q +  L+E +P  +E +++ VG +  +E+    F+RL + VY D +L+   P+R +F++ GP +      EVGR    M++ R FR  +Y AE + D+I + + F+E S ++        ++L   +P  K    K +  Q +K L  I  E   E   D        G  F                                      L  D++    +YLSD  D       P     ++F YF  LSPAITFG L ++  +  M ++ LLVS+    +++ +   QPL I+G +  + + E+   +   S GI   + R WIG +L ++  +   F G+ +V    R  +E+++F  S+I++    + L T+F   P     Y+      L    +    +    L     ++ F L   K N G +     R+++G F VP+ I+L+   +Y   + +    LS+P    +++S   N   F      +T D  +         +  + +FI++ +E    ++ V+K ERK  K + + L++  ++ +  + ++F G P+ S   VR+  H  ++   S    P I +R+I   EQRISG +V ILV  S+ +  IL  IP+A ++G+FLYMGV  ++ + L+ R++ +++  K+     ++  +  W +
Sbjct:   62 EVYIELHELTMDAH-NEMRWVEAARWLKVEEDYQDDIRQWGKPQISYLTFHSLLEVHRAFQKGTVLLDLAEKTLPGISSQVIDQMIYEDRLKPQNRDEVLRALLLQH-------SRPDEEIIKVGDPESGQPL---------------LHSLEMKTMPEQEQKKSPLAERVPENAEASIVLVGCVSFLEQPTLAFVRLKEAVYLDTVLEVPLPIRFLFVLLGPDNSNISYHEVGRAVSSMMAERVFRNEMYLAEGRQDLIKSLEDFLEYSIVLPPCDSPDGQLLKDLVPVQKNLLRKRY--QVEKELGRIKPEIPDEPPEDPLR---RTGKIFGG------------------------------------LARDIRRRYPKYLSDITDALN----PQCLAAVIFIYFAALSPAITFGGLMSEKTNRWMGVSELLVSTAVQGVVFCIFGAQPLLILGFSGPLLVFEEAFYNFCESQGIEYIVGRVWIGFWLILIVIIVVAFEGSFLVRFISRFTQEIFSFLISLIFIYETFAKLVTIFSKHP-LQGHYNQTTEIDLAKAPQPNTALLSLVLMFGAFLIAFFLRQFK-NSG-FFPGKLRRIVGDFGVPIAILLMVVADYFIKDTYTQ-KLSLPKG--LSVSRPENRTWFIPPLGFNTVDNPFPIWMMFASVVPALLVFILIFMESQITTLIVSKPERKTIKGSGFHLDLLLIVGMGGVCALF-GMPWLSATTVRTVTHANALTITSKGDKPQI-ERVI---EQRISGFLVAILVGVSILMEPILTLIPLAVLFGIFLYMGVTSLNGIQLFDRILLMLKPPKYHPNVPFVTRVKTWRM 818          
BLAST of slc4a-7 vs. Ensembl Xenopus
Match: slc4a3 (solute carrier family 4 (anion exchanger), member 3 [Source:NCBI gene;Acc:100495394])

HSP 1 Score: 224.557 bits (571), Expect = 2.086e-60
Identity = 184/823 (22.36%), Postives = 359/823 (43.62%), Query Frame = 3
Query:  339 WTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKAL---PYFYTLYSPAE---NSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSK----LTSLSTADQGYCFLI------GITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            W E +RWI +EE+ + E  R+  PH+++LS R L   +    +G      +      ++ T  +++  S +    +   ++ AL+L H + G                                               HR++   KL E +P  +E  ++ VG +  +E+  + F+RLD+ V  + +L+   P+R ++++ GP     +  E+GR    ++S++ F E  Y A  + D+++A  +F++ S            +L  C  Q K           QK L     E ++  +     +  ++ P+    D++  D LE                       F  L  D++    +Y SD +DG   +         +F YF  LSPAITFG L  +     M ++ L+VS+    +++ L+  QPL IVG +  + + E+          I     R WIG +L     V     G+ +V       +E++ F  S+I++    + ++K     P   T Y P       T  +  R +      +L L +       +L K     +L    R+++G F +P+ I+++  ++Y   + +         + K+N+   +++    K    +  + T+     +++       + +FI++ +E    ++ V++ ER+L+K + + L++  + ++  + ++F G P+ +   VRS  H  ++   S   APG   RI    EQR++ +++  LV  S+ +G +L+ IP+A ++G+FLYMGV  ++ + L++RL+ ++   KH  EH Y+  +  W +
Sbjct:   58 WRETARWIKFEENVEQETSRWGKPHVASLSFRSLLELRKTITNGTLFLDLEQTTMPRIVQTIVDTMVVSEQIGACDRASVQRALLLKHRYHG---------------------------------------------EGHRMK-HWKLMEKIPENAEATVVLVGCVDFLEQAATAFVRLDEAVLLESVLEVPIPVRFLYVLLGPTQANMDYHEIGRSISTLMSDKVFHEAAYTAAGRQDLLNAINEFLDCSM-----------VLPPCEMQSKDLLRS--IAAFQKDLLRKRREREQRRSLLPLKMARQLKPDDEEDDESQSDPLERSG------------------YLFGGLVRDIRRRYVKYWSDIKDGLNSQ----CLAAALFIYFAALSPAITFGGLLGEKTQGLMGVSELIVSTSVLGVIFALLAAQPLLIVGFSGPLLVFEEAFFKFCQVQEIEYLTGRVWIGFWLIFFILVMVAAEGSFLVRYISPFTQEIFAFLISLIFIHETFYKLYKVFAEHPLLRT-YPPVGAVVGRTAALGPRMQPNTALLSLILMVGTFLIAFFLRKFKNSRFLGGQARRVIGDFGIPISILVMVFIDYAITDTY---------TQKLNVPSGLSVTSPGKRGWFIDPMGTSKPFPLWMMFASAIPALLVFILMFMETQITTLIVSRKERRLQKGSGFHLDLLLIGSLGGVCALF-GLPWLTATTVRSVTHINALTVMS-KTAPGEKPRIAEVKEQRVTAVLISALVGLSIVMGEMLRQIPLAVLFGIFLYMGVTSLTGIQLFERLLLILMHPKHHPEHPYVVKVCTWRM 787          
BLAST of slc4a-7 vs. Ensembl Mouse
Match: Slc4a2 (solute carrier family 4 (anion exchanger), member 2 [Source:MGI Symbol;Acc:MGI:109351])

HSP 1 Score: 222.631 bits (566), Expect = 6.516e-59
Identity = 209/898 (23.27%), Postives = 393/898 (43.76%), Query Frame = 3
Query:  240 KESSATTICQTSVP----DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH---------------------VGMHLSSTIHECPTIHFNE-------EKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSA---LFTMFKALP---------------------YFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXV----KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINIS---MWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            +E   T   +   P    ++ +EL+ L L+ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +    V +   E +  S++   ++   +  AL+L H H                     +G H +      P  H  E       E +     E  +P        + IT +++ H +    KL E +P  +E  ++ VG +  + R    F+RL + V  D +L+   P+R +F++ GP S   +  E+GR    ++S+++F E  Y A+ + D+++A   F++ S ++  +  +  E L+  +   +    K   EQ +        E K                  + +DKA   ++E     E    ++              L  D++     YLSDFRD       P     ++F YF  LSPAITFG L  +     + ++ L++S+    +++ L+  QPL ++G +  + + E+   S   S  +   + R WIG +L  L  +     G+ +V    R  +E++ F  S+I++      L  +F+  P                     +  T+  P  +S    + ++K      T  L+L+++    ++     K     +     R+++G F VP+ I+++  ++Y   + +    LS+P    +       WV  P   + T           L  + +FI++ +E    ++ ++K ER L+K + + L++  ++ +  I ++F G P+ + A VRS  H  ++   S   APG   +I    EQR++G++V +LV  S+ +G +L+ IP+A ++G+FLYMGV  ++ +  ++RL  L+   KH  +  Y+K +
Sbjct:  286 REPGPTPRARPRAPHKPHEVFVELNELLLD-KNQEPQWRETARWIKFEEDVEEETERWGKPHVASLSFRSLLELRRTLAHGAVLLDLDQQTLPGVAHQVVEQMVISDQIKAEDRANVLRALLLKHSHPSDEKEFSFPRNISAGSLGSLLGHHHAQGTESDP--HVTEPLIGGVPETRLEVDRERELPPPA---PPAGITRSKSKHEL----KLLEKIPENAEATVVLVGCVEFLSRPTMAFVRLREAVELDAVLEVPVPVRFLFLLLGPSSANMDYHEIGRSISTLMSDKQFHEAAYLADERDDLLTAINAFLDCSVVLPPSE-VQGEELLRSVAHFQRQMLKKREEQGRLLPPGAGLEPK------------------SAQDKALLQMVEVAGAAEDDPLRRTGRPFGG-------LIRDVRRRYPHYLSDFRDALD----PQCLAAVIFIYFAALSPAITFGGLLGEKTKDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSSNELEYLVGRVWIGFWLVFLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETFYKLIKIFQEHPLHGCSGSNDSEAGSSSSSNMTWATTILVPDNSSASGQSGQEKPRGQPNTALLSLVLMAGTFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLVDYSIEDTYTQ-KLSVPSGFSVTAPDKRGWVINP-LGEKTPFPVWMMVASLLPAVLVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALF-GLPWLAAATVRSVTHANALTVMSKAVAPGDKPKIQEVKEQRVTGLLVALLVGLSMVIGDLLRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKV 1140          
BLAST of slc4a-7 vs. Ensembl Mouse
Match: Slc4a2 (solute carrier family 4 (anion exchanger), member 2 [Source:MGI Symbol;Acc:MGI:109351])

HSP 1 Score: 222.246 bits (565), Expect = 8.160e-59
Identity = 209/898 (23.27%), Postives = 393/898 (43.76%), Query Frame = 3
Query:  240 KESSATTICQTSVP----DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH---------------------VGMHLSSTIHECPTIHFNE-------EKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSA---LFTMFKALP---------------------YFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXV----KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINIS---MWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            +E   T   +   P    ++ +EL+ L L+ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +    V +   E +  S++   ++   +  AL+L H H                     +G H +      P  H  E       E +     E  +P        + IT +++ H +    KL E +P  +E  ++ VG +  + R    F+RL + V  D +L+   P+R +F++ GP S   +  E+GR    ++S+++F E  Y A+ + D+++A   F++ S ++  +  +  E L+  +   +    K   EQ +        E K                  + +DKA   ++E     E    ++              L  D++     YLSDFRD       P     ++F YF  LSPAITFG L  +     + ++ L++S+    +++ L+  QPL ++G +  + + E+   S   S  +   + R WIG +L  L  +     G+ +V    R  +E++ F  S+I++      L  +F+  P                     +  T+  P  +S    + ++K      T  L+L+++    ++     K     +     R+++G F VP+ I+++  ++Y   + +    LS+P    +       WV  P   + T           L  + +FI++ +E    ++ ++K ER L+K + + L++  ++ +  I ++F G P+ + A VRS  H  ++   S   APG   +I    EQR++G++V +LV  S+ +G +L+ IP+A ++G+FLYMGV  ++ +  ++RL  L+   KH  +  Y+K +
Sbjct:  291 REPGPTPRARPRAPHKPHEVFVELNELLLD-KNQEPQWRETARWIKFEEDVEEETERWGKPHVASLSFRSLLELRRTLAHGAVLLDLDQQTLPGVAHQVVEQMVISDQIKAEDRANVLRALLLKHSHPSDEKEFSFPRNISAGSLGSLLGHHHAQGTESDP--HVTEPLIGGVPETRLEVDRERELPPPA---PPAGITRSKSKHEL----KLLEKIPENAEATVVLVGCVEFLSRPTMAFVRLREAVELDAVLEVPVPVRFLFLLLGPSSANMDYHEIGRSISTLMSDKQFHEAAYLADERDDLLTAINAFLDCSVVLPPSE-VQGEELLRSVAHFQRQMLKKREEQGRLLPPGAGLEPK------------------SAQDKALLQMVEVAGAAEDDPLRRTGRPFGG-------LIRDVRRRYPHYLSDFRDALD----PQCLAAVIFIYFAALSPAITFGGLLGEKTKDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSSNELEYLVGRVWIGFWLVFLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETFYKLIKIFQEHPLHGCSGSNDSEAGSSSSSNMTWATTILVPDNSSASGQSGQEKPRGQPNTALLSLVLMAGTFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLVDYSIEDTYTQ-KLSVPSGFSVTAPDKRGWVINP-LGEKTPFPVWMMVASLLPAVLVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALF-GLPWLAAATVRSVTHANALTVMSKAVAPGDKPKIQEVKEQRVTGLLVALLVGLSMVIGDLLRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKV 1145          
BLAST of slc4a-7 vs. Ensembl Mouse
Match: Slc4a2 (solute carrier family 4 (anion exchanger), member 2 [Source:MGI Symbol;Acc:MGI:109351])

HSP 1 Score: 221.861 bits (564), Expect = 1.087e-58
Identity = 209/898 (23.27%), Postives = 393/898 (43.76%), Query Frame = 3
Query:  240 KESSATTICQTSVP----DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH---------------------VGMHLSSTIHECPTIHFNE-------EKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSA---LFTMFKALP---------------------YFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXV----KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINIS---MWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            +E   T   +   P    ++ +EL+ L L+ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +    V +   E +  S++   ++   +  AL+L H H                     +G H +      P  H  E       E +     E  +P        + IT +++ H +    KL E +P  +E  ++ VG +  + R    F+RL + V  D +L+   P+R +F++ GP S   +  E+GR    ++S+++F E  Y A+ + D+++A   F++ S ++  +  +  E L+  +   +    K   EQ +        E K                  + +DKA   ++E     E    ++              L  D++     YLSDFRD       P     ++F YF  LSPAITFG L  +     + ++ L++S+    +++ L+  QPL ++G +  + + E+   S   S  +   + R WIG +L  L  +     G+ +V    R  +E++ F  S+I++      L  +F+  P                     +  T+  P  +S    + ++K      T  L+L+++    ++     K     +     R+++G F VP+ I+++  ++Y   + +    LS+P    +       WV  P   + T           L  + +FI++ +E    ++ ++K ER L+K + + L++  ++ +  I ++F G P+ + A VRS  H  ++   S   APG   +I    EQR++G++V +LV  S+ +G +L+ IP+A ++G+FLYMGV  ++ +  ++RL  L+   KH  +  Y+K +
Sbjct:  300 REPGPTPRARPRAPHKPHEVFVELNELLLD-KNQEPQWRETARWIKFEEDVEEETERWGKPHVASLSFRSLLELRRTLAHGAVLLDLDQQTLPGVAHQVVEQMVISDQIKAEDRANVLRALLLKHSHPSDEKEFSFPRNISAGSLGSLLGHHHAQGTESDP--HVTEPLIGGVPETRLEVDRERELPPPA---PPAGITRSKSKHEL----KLLEKIPENAEATVVLVGCVEFLSRPTMAFVRLREAVELDAVLEVPVPVRFLFLLLGPSSANMDYHEIGRSISTLMSDKQFHEAAYLADERDDLLTAINAFLDCSVVLPPSE-VQGEELLRSVAHFQRQMLKKREEQGRLLPPGAGLEPK------------------SAQDKALLQMVEVAGAAEDDPLRRTGRPFGG-------LIRDVRRRYPHYLSDFRDALD----PQCLAAVIFIYFAALSPAITFGGLLGEKTKDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSSNELEYLVGRVWIGFWLVFLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETFYKLIKIFQEHPLHGCSGSNDSEAGSSSSSNMTWATTILVPDNSSASGQSGQEKPRGQPNTALLSLVLMAGTFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLVDYSIEDTYTQ-KLSVPSGFSVTAPDKRGWVINP-LGEKTPFPVWMMVASLLPAVLVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALF-GLPWLAAATVRSVTHANALTVMSKAVAPGDKPKIQEVKEQRVTGLLVALLVGLSMVIGDLLRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKV 1154          
BLAST of slc4a-7 vs. Ensembl Mouse
Match: Slc4a3 (solute carrier family 4 (anion exchanger), member 3 [Source:MGI Symbol;Acc:MGI:109350])

HSP 1 Score: 210.69 bits (535), Expect = 3.923e-55
Identity = 196/875 (22.40%), Postives = 383/875 (43.77%), Query Frame = 3
Query:  282 DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH----------------------VGMHLSSTIH----ECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL------LSALFTMFKALPYFYTLYSPAE---------NSTLYINE-----RDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINIS---MWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            ++ +EL+ L L+ R+    W E +RWI +EED + E  R+  PH+++LS R L   +     G A    +      + +   E++  S++   ++   +   L+L H H                      +G H  +  H      PT+  ++ +          PH    + +       + HR +S K L E +P  +E  ++ VG +P +E+  + F+RL + V  + +L+   P+R +F++ GP     +  E+GR    ++S++ F E  Y+A+ + D++ A  +F++ S ++  +  +    L+  +   +    +   E+ Q  ++      +       K++++E+G    ++  +  D L+                       F  L  D+K     Y SD RD    +        ++F YF  LSPAITFG L  +     M ++ L+VS+    +L+ L+  QPL +VG +  + + E+       +  +     R W+G++L +         G+ +V       +E++ F  S+I++      L  +FT    LP+    Y P E         +S L   E     R++      +L L L       +L K     +L    R+++G F +P+ I+++  ++Y   + +    L++P    +       W  IP                 +  + + I++ +E    ++ V++  R+L K + + L++  + ++   +    G P+ + A VRS  H  ++       APG   +I    EQR++G+++  LV  S+ +G++L+ IP+A ++G+FLYMGV  +S + L +RL+ +    KH  E  Y+  +  W +
Sbjct:  319 EVFVELNELMLD-RSQEPHWRETARWIKFEEDVEEETERWGKPHVASLSFRSLLELRRTIAQGAALLDLEQTTLPGIAHLVVETMIVSDQIRPEDRASVLRTLLLKHSHPNDDKDSGFFPRNPSSSSVNSVLGNHHPTPSHGPDGAVPTMADDQGEPA-----PLWPHDPDAKEKPLHMPGGDGHRGKSLKLL-EKIPEDAEATVVLVGCVPFLEQPAAAFVRLSEAVLLESVLEVPVPVRFLFVMLGPSHTSTDYHELGRSIATLMSDKLFHEAAYQADDRQDLLGAISEFLDGSIVIPPSE-VEGRDLLRSVAAFQRELLRKRREREQTKVEMTT---RGGYAAPGKELSLEMG---GSEATSEDDPLQRTGS------------------VFGGLVRDVKRRYPHYPSDLRDALHSQ----CVAAVLFIYFAALSPAITFGGLLGEKTEGLMGVSELIVSTAVLGVLFSLLGAQPLLVVGFSGPLLVFEEAFFKFCRAQDLEYLTGRVWVGLWLVVFVLALVAAEGSFLVRYISPFTQEIFAFLISLIFIYETFHKLYKVFTEHPLLPF----YPPDEALETGLELNSSALPPTEGPPGPRNQPNTALLSLILMLGTFLIAFFLRKFRNSRFLGGKARRIIGDFGIPISILVMVLVDYSITDTYTQ-KLTVPTGLSVTSPHKRTWF-IPPLGSARPFPPWMMVAAAVPALLVLILIFMETQITALIVSQKARRLLKGSGFHLDLLLIGSLG-GLCGLFGLPWLTAATVRSVTHVNALTVMRTAIAPGDKPQIQEVREQRVTGVLIASLVGLSIVMGAVLRRIPLAVLFGIFLYMGVTSLSGIQLSQRLLLIFMPAKHHPEQPYVTKVKTWRM 1150          
BLAST of slc4a-7 vs. Ensembl Mouse
Match: Slc4a1 (solute carrier family 4 (anion exchanger), member 1 [Source:MGI Symbol;Acc:MGI:109393])

HSP 1 Score: 187.578 bits (475), Expect = 3.329e-48
Identity = 164/662 (24.77%), Postives = 309/662 (46.68%), Query Frame = 3
Query:  804 SEGALIQVGILPTIERTHSLFMRLDQPV-YEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL---LSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXV---KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISM---WVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            SE  L+ VG    +E+    F+RL + V  ED +L    P+  + ++ GP++   +  ++GR    +++ R FR     A ++ +++ + + F++ S ++      + + L++ +P  K    + +     K   N+Y         +  D+N   G   +  D                        +++    F  L  D++     YLSD  D  +    P +   ++F YF  LSPA+TFG L  +     M ++ LL+S+    +L+ L+  QPL ++G +  + + E+   S   S  +   + R WIG +L +L  +   F G+ +V    R  +E+++F  S+I++    S L  +F+  P   T Y+P     + +  + +  +  T LF  +LM    L  +   K     Y     R+++G F VP+ I+++  ++  F        LS+PD  K++ S    WV  P         T       L  + +FI++ +E    ++ V+K ERK+ K + + L++  ++ +  + ++F G P+ S   VRS  H  ++      + PG   +I    EQRISG++V +LV  S+ +  IL  IP+A ++G+FLYMGV  +S + L+ R++ L +  K+  +  ++K +  W +
Sbjct:  237 SETTLVLVGRANFLEKPVLGFVRLKEAVPLEDLVLPE--PVGFLLVLLGPEAPHVDYTQLGRAAATLMTERVFRITASMAHNREELLRSLESFLDCSLVLPPTDAPSEKALLNLVPVQKELLRRRYLPSPAKPDPNLY---------NTLDLNGGKGGPGDEDDP-----------------------LRRTGRIFGGLIRDIRRRYPYYLSDITDALS----PQVLAAVIFIYFAALSPAVTFGGLLGEKTRNLMGVSELLISTAVQGILFALLGAQPLLVLGFSGPLLVFEEAFFSFCESNNLEYIVGRAWIGFWLILLVMLVVAFEGSFLVQYISRYTQEIFSFLISLIFIYETFSKLIKIFQDYPLQQT-YAP-----VVMKPKPQGPVPNTALFSLVLMAGTFLLAMTLRKFKNSTYFPGKLRRVIGDFGVPISILIMVLVDS-FIKGTYTQKLSVPDGLKVSNSSARGWVIHP-LGLYRLFPTWMMFASVLPALLVFILIFLESQITTLIVSKPERKMIKGSGFHLDLLLVVGMGGVAALF-GMPWLSATTVRSVTHANALTVMGKASGPGAAAQIQEVKEQRISGLLVSVLVGLSILMEPILSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPFVKRVKTWRM 851          
BLAST of slc4a-7 vs. UniProt/SwissProt
Match: sp|P04920|B3A2_HUMAN (Anion exchange protein 2 OS=Homo sapiens OX=9606 GN=SLC4A2 PE=1 SV=4)

HSP 1 Score: 226.868 bits (577), Expect = 2.126e-59
Identity = 208/898 (23.16%), Postives = 382/898 (42.54%), Query Frame = 3
Query:  240 KESSATTICQTSVP----DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH---------------------VGMHLSSTIHECPTIHFNE-------EKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENST--------LYINERDKFGIGGTTXXXXXXXXXXXXXX--------------------VKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISM---WVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            +E   T   +   P    ++ +EL+ L L+ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +    V +   E +  S++   ++   +  AL+L H H                     +G H        P  H  E       E +     E  +P        + IT +++ H +    KL E +P  +E  ++ VG +  + R    F+RL + V  D +L+   P+R +F++ GP S   +  E+GR    ++S+++F E  Y A+ + D+++A   F++ S ++  +     E+L                   Q+ +    EE+ R   T        + P  + +DKA   ++E     E    ++              L  D++     YLSDFRD       P     ++F YF  LSPAITFG L  +     + ++ L++S+    +++ L+  QPL ++G +  + + E+   S   S  +   + R WIG +L  L  +     G+ +V    R  +E++ F  S+I++    + + K           A NS+         +   R   G G  +L                                  K     +     R+++G F VP+ I+++  ++Y   + +    LS+P    +       WV  P   + +           L  I +FI++ +E    ++ ++K ER L+K + + L++  ++ +  I ++F G P+ + A VRS  H  ++   S   APG   +I    EQR++G++V +LV  S+ +G +L+ IP+A ++G+FLYMGV  ++ +  ++RL  L+   KH  +  Y+K +
Sbjct:  304 REPGPTPRARPRAPHKPHEVFVELNELLLD-KNQEPQWRETARWIKFEEDVEEETERWGKPHVASLSFRSLLELRRTLAHGAVLLDLDQQTLPGVAHQVVEQMVISDQIKAEDRANVLRALLLKHSHPSDEKDFSFPRNISAGSLGSLLGHHHGQGAESDP--HVTEPLMGGVPETRLEVERERELPPPA---PPAGITRSKSKHEL----KLLEKIPENAEATVVLVGCVEFLSRPTMAFVRLREAVELDAVLEVPVPVRFLFLLLGPSSANMDYHEIGRSISTLMSDKQFHEAAYLADEREDLLTAINAFLDCSVVLPPSEVQGEELL-------------RSVAHFQRQMLKKREEQGRLLPT-----GAGLEPK-SAQDKALLQMVEAAGAAEDDPLRRTGRPFGG-------LIRDVRRRYPHYLSDFRDALD----PQCLAAVIFIYFAALSPAITFGGLLGEKTQDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSSNHLEYLVGRVWIGFWLVFLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETFYKLVKIFQEHPLHGCSASNSSEVDGGENMTWAGARPTLGPGNRSLAGQSGQGKPRGQPNTALLSLVLMAGTFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLVDYSIEDTYTQ-KLSVPSGFSVTAPEKRGWVINP-LGEKSPFPVWMMVASLLPAILVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALF-GLPWLAAATVRSVTHANALTVMSKAVAPGDKPKIQEVKEQRVTGLLVALLVGLSIVIGDLLRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKV 1158          
BLAST of slc4a-7 vs. UniProt/SwissProt
Match: sp|Q6SJP2|B3A2_HORSE (Anion exchange protein 2 OS=Equus caballus OX=9796 GN=SLC4A2 PE=2 SV=1)

HSP 1 Score: 224.942 bits (572), Expect = 9.124e-59
Identity = 211/890 (23.71%), Postives = 394/890 (44.27%), Query Frame = 3
Query:  240 KESSATTICQTSVP----DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH------VGMHLSSTIHECPTIHFNEEKQCFETNENYI-PHIG----------RRRNRSSITLNENMHRVQSQK--KLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTM---FKALPYFYTLYS------PAENSTLYINERDKFGIG-GTTXXXXXXXXXXXXXXV-------------------KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISM---WVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            +E   T   +   P    ++ +EL+ L L+ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +    V +   E +  S++   ++  ++  AL+L H H           + +     ++  +   Q  E++ +   P IG          R R  S       + R +S+   KL E +P  +E  ++ VG +  + R    F+RL + V  D +L+   P+R +F++ GP S   +  E+GR    ++S+++F E  Y A+ + D+++A   F++ S ++  +     E+L                   Q+ +    EE+ R   T        + P  + +DKA   ++E     E    ++              L  D++     YLSDFRD       P     ++F YF  LSPAITFG L  +     + ++ L++S+    +++ L+  QPL ++G +  + + E+   S   S  +   + R WIG +L +L  +     G+ +V    R  +E++ F  S+I++    + +   F+  P      S        +N+T +   R   G+G G++   A                              K   G +     R+++G F VP+ I+++  ++Y   + +    LS+P    +       WV  P   + +S          L  I +FI++ +E    ++ ++K ER L+K + + L++  ++ +  I ++F G P+ + A VRS  H  ++   S   APG   +I    EQR++G++V +LV  S+ +G +L+ IP+A ++G+FLYMGV  ++ +  ++RL  L+   KH  +  Y+K +
Sbjct:  300 REPGPTPRARPRAPHKPHEVFVELNELLLD-KNQEPQWRETARWIKFEEDVEEETERWGKPHVASLSFRSLLELRRTLAHGAVLLDLDQQTLPGVAHQVVEQMVISDQIKAEDRADVLRALLLKHSHPSDEKDFSFPRNISAGSLGSLLGHHHGQGAESDPHVTEPLIGGVPETRLEVERERELSPPAPPAGITRSKSKHELKLLEKIPENAEATVVLVGCVEFLSRPTMAFVRLREAVELDAVLEVPVPVRFLFLLLGPSSANMDYHEIGRSISTLMSDKQFHEAAYLADEREDLLTAINAFLDCSVVLPPSEVQGEELL-------------RSVAHFQRQMLKKREEQGRLLPT-----GAGLEPK-SAQDKALLQMVEAAGAVEDDPLRRTGRPFGG-------LIRDVRRRYPHYLSDFRDALD----PQCLAAVIFIYFAALSPAITFGGLLGEKTQDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSSNDLEYLVGRVWIGFWLVLLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETFYKLVKIFQEHPLHGCSVSNSSEADSGDNAT-WAGTRVTLGLGNGSSAGPAGQGRPRGQPNTALLSLVLMAGTFFIAFFLRKFKNGRFFPGRVRRVIGDFGVPIAILIMVLVDYSIEDTYTQ-KLSVPSGFSVTAPEKRGWVINP-LGEKSSFPVWMMVASLLPAILVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALF-GLPWLAAATVRSVTHANALTVMSKAVAPGDKPKIQEVKEQRVTGLLVALLVGLSIVIGDLLRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKV 1154          
BLAST of slc4a-7 vs. UniProt/SwissProt
Match: sp|P23562|B3AT_RAT (Band 3 anion transport protein OS=Rattus norvegicus OX=10116 GN=Slc4a1 PE=1 SV=3)

HSP 1 Score: 221.476 bits (563), Expect = 2.048e-58
Identity = 200/847 (23.61%), Postives = 375/847 (44.27%), Query Frame = 3
Query:  291 IELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTG-------SEGALIQVGILPTIERTHSLFMRLDQPV-YEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYE--EEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL---LSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXV---KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISM---WVNIP-----DFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            +EL  L ++ R     W E + WI  EE+   E   +  PHLS L+   L   + +F  G         +   V N   +S    ++    +  E+  AL+L   H     +  + +   +      +    +E  +PH          +L   ++  Q++    E  P+G       SE  L+ VG    + +    F+RL + V  ED +L    P+  + ++ GP++   +  ++GR    +++ R FR     A+S+ +++S+   F++ S ++      + + L++ +P  K    K +  +  K   N+YE  +  +E   D  D     G  F                                      L  D++     YLSD  D  +    P +   ++F YF  LSPA+TFG L  +     M ++ LL+S+    +L+ L+  QPL ++G +  + + E+   S   S  +   + R WIG +L +L  +   F G+ +V    R  +E+++F  S+I++    S L  +F+  P   + Y+P     + +  + +  +  T L   +LM+   L  +   K     Y     R+++G F VP+ I+++  ++    N +    LS+PD  K++ S    WV  P      F K    ++       L  + +FI++ +E    ++ V+K ERK+ K + + L++  ++ +  + ++F G P+ S   VRS  H  ++      + PG   +I    EQRISG++V +LV  S+ +  IL  IP+A ++G+FLYMG+  +S + L+ R++ L +  K+  +  ++K +  W +
Sbjct:   73 VELQELMMDQRNQELQWVEAAHWIGLEENLR-EDGVWGRPHLSYLTFWSLLELQKVFSKGTFLLDLAETSLAGVANKLLDSFIYEDQIRPQDRDELLRALLLKRSH-----AEDLKDLEGVKPAVLTRSGAPSEPLLPH--------QPSLETKLYCAQAEGGSEEPSPSGILKIPPNSETTLVLVGRASFLVKPVLGFVRLKEAVPLEDLVLPE--PVSFLLVLLGPEAPHIDYTQLGRAAATLMTERVFRVTASLAQSRGELLSSLDSFLDCSLVLPPTEAPSEKALLNLVPVQKELLRKRYLPRPAKPDPNLYEALDGGKEGPGDEDDPLRRTGRIFGG------------------------------------LIRDIRRRYPYYLSDITDALS----PQVLAAVIFIYFAALSPAVTFGGLLGEKTRNLMGVSELLISTAVQGILFALLGAQPLLVLGFSGPLLVFEEAFYSFCESNNLEYIVGRAWIGFWLILLVVLVVAFEGSFLVQYISRYTQEIFSFLISLIFIYETFSKLIKIFQDYPLQES-YAP-----VVMKPKPQGPVPNTALLSLVLMVGTFLLAMMLRKFKNSTYFPGKLRRVIGDFGVPISILIMVLVDTFIKNTYTQ-KLSVPDGLKVSNSSARGWVIHPLGLYNHFPKWMMFASV------LPALLVFILIFLESQITTLIVSKPERKMIKGSGFHLDLLLVVGMGGVAALF-GMPWLSATTVRSVTHANALTVMGKASGPGAAAQIQEVKEQRISGLLVSVLVGLSILMEPILSRIPLAVLFGIFLYMGITSLSGIQLFDRILLLFKPPKYHPDVPFVKRVKTWRM 849          
BLAST of slc4a-7 vs. UniProt/SwissProt
Match: sp|P13808|B3A2_MOUSE (Anion exchange protein 2 OS=Mus musculus OX=10090 GN=Slc4a2 PE=1 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 7.948e-58
Identity = 209/898 (23.27%), Postives = 393/898 (43.76%), Query Frame = 3
Query:  240 KESSATTICQTSVP----DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH---------------------VGMHLSSTIHECPTIHFNE-------EKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSA---LFTMFKALP---------------------YFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXV----KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINIS---MWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            +E   T   +   P    ++ +EL+ L L+ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +    V +   E +  S++   ++   +  AL+L H H                     +G H +      P  H  E       E +     E  +P        + IT +++ H +    KL E +P  +E  ++ VG +  + R    F+RL + V  D +L+   P+R +F++ GP S   +  E+GR    ++S+++F E  Y A+ + D+++A   F++ S ++  +  +  E L+  +   +    K   EQ +        E K                  + +DKA   ++E     E    ++              L  D++     YLSDFRD       P     ++F YF  LSPAITFG L  +     + ++ L++S+    +++ L+  QPL ++G +  + + E+   S   S  +   + R WIG +L  L  +     G+ +V    R  +E++ F  S+I++      L  +F+  P                     +  T+  P  +S    + ++K      T  L+L+++    ++     K     +     R+++G F VP+ I+++  ++Y   + +    LS+P    +       WV  P   + T           L  + +FI++ +E    ++ ++K ER L+K + + L++  ++ +  I ++F G P+ + A VRS  H  ++   S   APG   +I    EQR++G++V +LV  S+ +G +L+ IP+A ++G+FLYMGV  ++ +  ++RL  L+   KH  +  Y+K +
Sbjct:  300 REPGPTPRARPRAPHKPHEVFVELNELLLD-KNQEPQWRETARWIKFEEDVEEETERWGKPHVASLSFRSLLELRRTLAHGAVLLDLDQQTLPGVAHQVVEQMVISDQIKAEDRANVLRALLLKHSHPSDEKEFSFPRNISAGSLGSLLGHHHAQGTESDP--HVTEPLIGGVPETRLEVDRERELPPPA---PPAGITRSKSKHEL----KLLEKIPENAEATVVLVGCVEFLSRPTMAFVRLREAVELDAVLEVPVPVRFLFLLLGPSSANMDYHEIGRSISTLMSDKQFHEAAYLADERDDLLTAINAFLDCSVVLPPSE-VQGEELLRSVAHFQRQMLKKREEQGRLLPPGAGLEPK------------------SAQDKALLQMVEVAGAAEDDPLRRTGRPFGG-------LIRDVRRRYPHYLSDFRDALD----PQCLAAVIFIYFAALSPAITFGGLLGEKTKDLIGVSELIMSTALQGVVFCLLGAQPLLVIGFSGPLLVFEEAFFSFCSSNELEYLVGRVWIGFWLVFLALLMVALEGSFLVRFVSRFTQEIFAFLISLIFIYETFYKLIKIFQEHPLHGCSGSNDSEAGSSSSSNMTWATTILVPDNSSASGQSGQEKPRGQPNTALLSLVLMAGTFFIAFFLRKFKNSRFFPGRIRRVIGDFGVPIAILIMVLVDYSIEDTYTQ-KLSVPSGFSVTAPDKRGWVINP-LGEKTPFPVWMMVASLLPAVLVFILIFMETQITTLIISKKERMLQKGSGFHLDLLLIVAMGGICALF-GLPWLAAATVRSVTHANALTVMSKAVAPGDKPKIQEVKEQRVTGLLVALLVGLSMVIGDLLRQIPLAVLFGIFLYMGVTSLNGIQFYERLHLLLMPPKHHPDVTYVKKV 1154          
BLAST of slc4a-7 vs. UniProt/SwissProt
Match: sp|P15575|B3AT_CHICK (Band 3 anion transport protein OS=Gallus gallus OX=9031 GN=SLC4A1 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.180e-57
Identity = 202/848 (23.82%), Postives = 359/848 (42.33%), Query Frame = 3
Query:  291 IELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNE------NMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFD---VLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL---LSALFTMFKALPYFYTLYS--------PAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKIN---ISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRT 2765
            +EL  L L+ R +  CW E  RW+  EE   ME       HL  L+   L      F  G         +   V +   + +    +       ++  AL+L H H     + ++   P        QC +  +         R++ ++ + E      +  R Q   +L + LP  +E  L+ V     +E+     +RL  P   D +L    P+R +  + GP S      E+ R    ++++R FR   Y    + +++   + F+E S +V   + +  E  +H L  L+ +A +    +  +H   +       +  D  D           K +A  D   +L T++                    F  L  D++    +YLSD RD       P     ++F YF  LSPAITFG L  +     M ++ LL+S+    LL+ L++ QPL +VG +  + + E+         G+   + R WIG +L +L  +     G ++V    R  +E+++F  S+I++    + L T+F+A P   +  +        P  N+ L             +L L        L+L +    ++L    R+L+G F VP+ I  V AL   F        L +P   ++       W   P     T           +  + +FI++ +E    ++ V+K ERKL K + + L++  ++ +  + ++F G P+ S   VR+  H  ++     +A PG    I+   EQR+SG++V +L+  S+ +  ILKYIP+A ++G+FLYMGV  +  + L+ R++ L+   K+  +  Y+  +  W I +
Sbjct:   63 VELHELVLDSRKDP-CWMEAGRWLHLEES--MEPGGAWGSHLPLLTYHSLLELHRAFAKGVVLLDVAANSLAAVAHVLLDQLIYEGQLKPQHRDDVLRALLLRHKHPSE--AESVWTLPAAQL----QCSDGEQKDADERALLRDQRAVEMRELHGAGQSPSRAQLGPQLHQQLPEDTEATLVLVACAAFLEQPLLALVRLGAPC-PDAVLAVPLPVRFVLTVLGPDSPRLSYHEIRRAAATVMADRVFRRDAYLCGGRAELLGGLQGFLEAS-IVLPPQEVPSEQHLHALIPLQRHAVR----RRYQHPDTVRSPGGPTAPKDTGD-----------KGQAPQDDDPLLRTRRP-------------------FGGLVRDIRRRYPKYLSDIRDALN----PQCLAAVIFIYFAALSPAITFGGLLGEKTRGMMGVSELLLSTSVQCLLFSLLSAQPLLVVGFSGPLLVFEEAFFRFCEDHGLEYIVGRVWIGFWLILLVLLVVACEGTVLVRYLSRYTQEIFSFLISLIFIYETFAKLVTIFEAHPLQQSYDTDVSTEPSVPKPNTALL------------SLVLMAGTFFLALFLRQFKNSVFLPGKVRRLIGDFGVPISI-FVMALADFFIKDTYTQKLKVPRGLEVTNGTARGWFIHP-MGSATPFPIWMMFASPVPALLVFILIFLETQITTLIVSKPERKLVKGSGFHLDLLLIVAMGGLAALF-GMPWLSATTVRTITHANALTVVGKSAVPGERAHIVEVKEQRLSGLLVAVLIGVSILMEPILKYIPLAVLFGIFLYMGVTSLFGIQLFDRILLLLMPPKYHPKEPYVTRVKTWRITS 846          
BLAST of slc4a-7 vs. TrEMBL
Match: A0A0H3YF42 (Slc4a-7 OS=Schmidtea mediterranea OX=79327 GN=slc4a-7 PE=2 SV=1)

HSP 1 Score: 1927.14 bits (4991), Expect = 0.000e+0
Identity = 1004/1004 (100.00%), Postives = 1004/1004 (100.00%), Query Frame = 3
Query:   69 MHHQKISADNPVYEEDENEIKDDQPDSEVAGGELKQWRNSIEQEGDMSFHDQPIYMKKESSATTICQTSVPDLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRTXXXXXXXXXXXXXXXXXXSQFTTYVWTLFLFPIFVGIYAMIRGYALPRWPRLNTHLSKMDKKHFVKLYDGKKVKSEAEIVQDNQAFDPXXXXXXXXXXXXXXGIY 3080
            MHHQKISADNPVYEEDENEIKDDQPDSEVAGGELKQWRNSIEQEGDMSFHDQPIYMKKESSATTICQTSVPDLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEPSCSKKVVSTVKKFFPPFYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTLFLALLMLNFCLYLVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRTLVIIQLFFVIILIIIYVLSQFTTYVWTLFLFPIFVGIYAMIRGYALPRWPRLNTHLSKMDKKHFVKLYDGKKVKSEAEIVQDNQAFDPENNEDSSNSSEEESGIY
Sbjct:    1 MHHQKISADNPVYEEDENEIKDDQPDSEVAGGELKQWRNSIEQEGDMSFHDQPIYMKKESSATTICQTSVPDLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEPSCSKKVVSTVKKFFPPFYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTLFLALLMLNFCLYLVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRTLVIIQLFFVIILIIIYVLSQFTTYVWTLFLFPIFVGIYAMIRGYALPRWPRLNTHLSKMDKKHFVKLYDGKKVKSEAEIVQDNQAFDPENNEDSSNSSEEESGIY 1004          
BLAST of slc4a-7 vs. TrEMBL
Match: A0A4S2LWF6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004566 PE=4 SV=1)

HSP 1 Score: 502.671 bits (1293), Expect = 2.694e-157
Identity = 320/958 (33.40%), Postives = 515/958 (53.76%), Query Frame = 3
Query:  207 MSFHDQPIYMKKESSATTICQTSVPDLLIEL-------DILYLNP--RTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILN---HFHVGMHLSSTI--------HECPTIHFNEEKQCFETNENYIPHIGRRRN--RSSITLNENMHRVQSQ------KKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGP-NFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQL---YIDL-KGNK---ERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTL-YINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSKLTSLSTAD-----QGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRTXXXXXXXXXXXXXXXXXXSQFTTYVWTLFLFPIFVGIYAMIRGYALPRWPRLNTHLSKMDKKH 2954
            MS   Q  ++K E+ +T      V +L+  +       D ++ NP        W E +RW+ +E+++D   +RFN  H+S +    L  F +  K      + D     + L   ++    SN     E  ++  A++L+   H  V   +S +         HE   + F  +    +T E  +    + R   R S+    N+H   +       + L++CL  G+E   +  G L  + +     +R  + +    + +   P+R IF   GP S E +  ++GRVF +M+SN  FR  VY A++  D+I +   F+ ++ ++ L R    E L   + Q++ Y  +    +  + L+      KR S     D   ++G   F+  D A+ +   TQ       S      V             Y+D  +G +    R+ SDF+D   K+N  I+F  ++F YFV L+PAITF AL N  V    T+++ LVS+G + +++ L  GQPL  +G+T  +FI+E  LAS+A + G+PL  +RFW  +Y +I GF F   N +++  Q RRSVEEV+N + +  +LL ALFTMF+ +P+     SP+       ++ + +  I G TLFLA + L FCL L +I  G Y R   RKLLGA NVPLG++L+  LN IFF  F +P ++IP SN+IN+S WVN P++  L +L T +      G  F IG TM I++  E A N I  T ++ K  K  ++ +++F L  +FP++S  +GWPF SGA VR+ ++ +++ K     APG+P R+IG  EQR+SGM+VG+LVF SVFLGS+L++IP+A++YGMFLYMGVMG+ D+  ++R + LM+RRKHW + + ++G+P  +I    +IQ   + IL+++ ++S+FT   +   +FP+ V +YA++R    P+W  L   L ++D+K+
Sbjct:    1 MSNLGQVKWVKSETESTAPMFIEVQELVARVYGGMQFTDEIFANPVLAHTRVLWLETARWVNFEQNYDEVEQRFNEAHVSPMKFTRLAQFTEEIKRHCVIIETDASTLGEALTELADHARASNCVTSREQYDVLRAILLSERWHPEVKGRISDSAEFEQYWNAHEIVNLGFVPDD---DTIEKPVAMTSQSRGSIRPSLGAVLNLHNQPAHPYHRFNQALTDCLEAGAEACTVLCGTLNFLTKPLIALIRSKRTISNSCISEVNVPVRFIFSYLGPPSNEFKYTKLGRVFAVMMSNSIFRAAVYDAKTTSDLIKSVDLFMTDALVMPLARHPHPEALAGMVRQIEAYKREGAYGKEPERLERSTSMSKRPS---QPDFPFDVGSRKFSALDIATQEGALTQMDATQRGSISATERVPTRQRCLNDFCPPYVDFARGIRPWINRFSSDFKDAVKKDNVGIVFGSVLFLYFVNLAPAITFAALLNSQVDKGFTVSVTLVSTGVYLIVFTLFAGQPLAFIGITGPMFILETSLASIAKTAGVPLMQIRFWTSIYCAICGFFFITLNASVLANQIRRSVEEVFNAFIAFFFLLKALFTMFRLIPF----ESPSSTDVASQLSYKTRMAIAGATLFLAFIKLQFCLILARIKGGNYFRRIIRKLLGALNVPLGMVLIAVLNQIFFLGFELPMVNIPPSNQINVSRWVNFPNYD-LLNLYTGNTVGLVHGVGFAIGFTMSIIVFTEAALNGI--TAMKNKAVKPNVFVIDLFLLTIIFPLVSGLMGWPFVSGATVRTMSNLVALVKLDHAPAPGMPHRVIGTVEQRVSGMLVGLLVFLSVFLGSVLRFIPVAALYGMFLYMGVMGLRDLQFFRRFLALMKRRKHWEDWECVRGLPSKHILVFAVIQAVVIGILVVLNIISEFTAASYVGIVFPLVVLLYALLRELVFPKWRWLAPFLHQLDRKY 945          
BLAST of slc4a-7 vs. TrEMBL
Match: A0A4S2LVH0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004566 PE=4 SV=1)

HSP 1 Score: 500.745 bits (1288), Expect = 2.208e-156
Identity = 312/920 (33.91%), Postives = 500/920 (54.35%), Query Frame = 3
Query:  300 DILYLNP--RTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILN---HFHVGMHLSSTI--------HECPTIHFNEEKQCFETNENYIPHIGRRRN--RSSITLNENMHRVQSQ------KKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGP-NFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQL---YIDL-KGNK---ERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTL-YINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSKLTSLSTAD-----QGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRTXXXXXXXXXXXXXXXXXXSQFTTYVWTLFLFPIFVGIYAMIRGYALPRWPRLNTHLSKMDKKH 2954
            D ++ NP        W E +RW+ +E+++D   +RFN  H+S +    L  F +  K      + D     + L   ++    SN     E  ++  A++L+   H  V   +S +         HE   + F  +    +T E  +    + R   R S+    N+H   +       + L++CL  G+E   +  G L  + +     +R  + +    + +   P+R IF   GP S E +  ++GRVF +M+SN  FR  VY A++  D+I +   F+ ++ ++ L R    E L   + Q++ Y  +    +  + L+      KR S     D   ++G   F+  D A+ +   TQ       S      V             Y+D  +G +    R+ SDF+D   K+N  I+F  ++F YFV L+PAITF AL N  V    T+++ LVS+G + +++ L  GQPL  +G+T  +FI+E  LAS+A + G+PL  +RFW  +Y +I GF F   N +++  Q RRSVEEV+N + +  +LL ALFTMF+ +P+     SP+       ++ + +  I G TLFLA + L FCL L +I  G Y R   RKLLGA NVPLG++L+  LN IFF  F +P ++IP SN+IN+S WVN P++  L +L T +      G  F IG TM I++  E A N I  T ++ K  K  ++ +++F L  +FP++S  +GWPF SGA VR+ ++ +++ K     APG+P R+IG  EQR+SGM+VG+LVF SVFLGS+L++IP+A++YGMFLYMGVMG+ D+  ++R + LM+RRKHW + + ++G+P  +I    +IQ   + IL+++ ++S+FT   +   +FP+ V +YA++R    P+W  L   L ++D+K+
Sbjct:   59 DEIFANPVLAHTRVLWLETARWVNFEQNYDEVEQRFNEAHVSPMKFTRLAQFTEEIKRHCVIIETDASTLGEALTELADHARASNCVTSREQYDVLRAILLSERWHPEVKGRISDSAEFEQYWNAHEIVNLGFVPDD---DTIEKPVAMTSQSRGSIRPSLGAVLNLHNQPAHPYHRFNQALTDCLEAGAEACTVLCGTLNFLTKPLIALIRSKRTISNSCISEVNVPVRFIFSYLGPPSNEFKYTKLGRVFAVMMSNSIFRAAVYDAKTTSDLIKSVDLFMTDALVMPLARHPHPEALAGMVRQIEAYKREGAYGKEPERLERSTSMSKRPS---QPDFPFDVGSRKFSALDIATQEGALTQMDATQRGSISATERVPTRQRCLNDFCPPYVDFARGIRPWINRFSSDFKDAVKKDNVGIVFGSVLFLYFVNLAPAITFAALLNSQVDKGFTVSVTLVSTGVYLIVFTLFAGQPLAFIGITGPMFILETSLASIAKTAGVPLMQIRFWTSIYCAICGFFFITLNASVLANQIRRSVEEVFNAFIAFFFLLKALFTMFRLIPF----ESPSSTDVASQLSYKTRMAIAGATLFLAFIKLQFCLILARIKGGNYFRRIIRKLLGALNVPLGMVLIAVLNQIFFLGFELPMVNIPPSNQINVSRWVNFPNYD-LLNLYTGNTVGLVHGVGFAIGFTMSIIVFTEAALNGI--TAMKNKAVKPNVFVIDLFLLTIIFPLVSGLMGWPFVSGATVRTMSNLVALVKLDHAPAPGMPHRVIGTVEQRVSGMLVGLLVFLSVFLGSVLRFIPVAALYGMFLYMGVMGLRDLQFFRRFLALMKRRKHWEDWECVRGLPSKHILVFAVIQAVVIGILVVLNIISEFTAASYVGIVFPLVVLLYALLRELVFPKWRWLAPFLHQLDRKY 965          
BLAST of slc4a-7 vs. TrEMBL
Match: A0A3R7CGM7 (Band 3 anion transport protein (Fragment) OS=Clonorchis sinensis OX=79923 GN=SLC4A1 PE=4 SV=1)

HSP 1 Score: 490.73 bits (1262), Expect = 1.135e-152
Identity = 306/919 (33.30%), Postives = 495/919 (53.86%), Query Frame = 3
Query:  300 DILYLNP--RTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILN---HFHVGMHLSSTI--------HECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITL-------NENMHRVQS-QKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGP-NFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQL---YIDL-KGNK---ERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTL-YINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSKLT----SLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRTXXXXXXXXXXXXXXXXXXSQFTTYVWTLFLFPIFVGIYAMIRGYALPRWPRLNTHLSKMDKKH 2954
            D ++ NP        W E +RW+ +E+++D   +RFN  H+S +    L  F +  K      + D       L   ++    +N     E  ++  A++L+   H  V   +S +         HE   + F  +    +T E  +    + R     TL       N+  H      + L++CL   +E   +  G +  + +     +R  + +    + +   P+R IF   GP S E +  ++GRVF +M+SN  FR  VY A++  D+I +   F+ ++ ++ L R    E L   + Q++ Y  +    +  + L+      KR S     D   + G   F+  D A+ +   TQ       S      V             Y+D  +G +    R+ SDF+D   K+N  I+F  ++F YFV L+PAITF A+ N  V    T+++ LVS+G + +++ L+ GQPL  +G+T  +FI+E  LAS+A + G+PL  +RFW  +Y ++ GF F   N +++  Q RRSVEEV+N + +  +LL ALFTMF+ +PY     SP+    +  ++ + +  I G TLFLA + L FCL L +I  G Y R   RKLLGA NVPLG++L+  LN IFF  F +P ++IP SN+IN+S WVN P++  L     +      G  F IG TM I++  E A N I  T ++ K  K  ++ +++F L  +FP++S  +GWPF SGA VR+ ++ +++ K     APG+P R+IG  EQR+SGM+VG+LVF SVFLGS+L++IP+A++YGMFLYMGVMG+ D+  ++R + LM+RRKHW + + ++G+P  +I    +IQ   + IL+++ ++S+FT   +   +FP+ V +YA++R    P+W  L  +L ++D+K+
Sbjct:   51 DEIFANPVLAHTRVLWLETARWVNFEQNYDEVEQRFNEAHVSPMKFTRLAQFTEEIKRHCVIIETDASTLGGALTELADHAHATNCVTSREQYDVLRAILLSERWHPEVKGRISDSAEFEQYWNAHEIVNLGFVPDD---DTIEKPVAMTSQPRASIRPTLGAVLSLHNQPAHPYHRFNQALTDCLEADAEACTVLCGTINFLTKPLIALIRSKRTITNSCISEVNVPVRFIFSYLGPPSNEFKYTKLGRVFAVMMSNSIFRAAVYDAKTTSDLIKSVDLFMTDALVMPLARHPHPEALAGMVRQIEAYKREGAYGREPERLERSTSMSKRPS---QPDFPFDAGSRKFSALDMATQEGALTQMDATQRGSISAKERVPTRKRCLNDFCPPYVDFARGFRPWFNRFPSDFKDAVKKDNVGIVFGSVLFLYFVNLAPAITFAAILNSQVDKGFTVSVTLVSTGVYLIVFTLLAGQPLAFIGITGPMFILETSLASIAKTAGLPLMQLRFWTSIYCAVCGFFFIALNASVLANQIRRSVEEVFNAFIAFFFLLKALFTMFRLIPY----ESPSSTDVVSQLSYKTRMAIAGATLFLAFIKLQFCLILARIKGGNYFRRIIRKLLGALNVPLGMVLIAVLNQIFFLGFELPMVNIPPSNQINVSRWVNFPNYDLLNLYPGNAVGLVHGVGFAIGFTMSIIVFTEAALNGI--TAMKNKAVKPNVFVIDLFLLTIIFPLVSGLMGWPFVSGATVRTMSNLVALVKLDHAPAPGMPHRVIGTVEQRVSGMLVGLLVFLSVFLGSVLRFIPVAALYGMFLYMGVMGLRDLQFFRRFLALMKRRKHWEDWECVRGLPSKHILVFAVIQAVVIGILVVLNIISEFTAASYVGIVFPLVVLLYALLRELVFPKWRWLAPYLHQLDRKY 957          
BLAST of slc4a-7 vs. TrEMBL
Match: A0A5K4F3N9 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 473.781 bits (1218), Expect = 6.930e-146
Identity = 303/924 (32.79%), Postives = 492/924 (53.25%), Query Frame = 3
Query:  339 WTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILN---HFHVGMHLSST--------------IHECPTI-------------HFNEEKQCFETNENYIPHIG---RRRNRSSITL-----NENMHRVQS-QKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQH-QKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKE--------EXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSKLTSLSTAD----QGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRTXXXXXXXXXXXXXXXXXXSQFTTYVWTLFLFPIFVGIYAMIRGYALPRWPRLNTHLSKMDKKH 2954
            W E +RW+ +EE+F+   +RF   H+  +    +  F+D  +      + D       L+  ++     N    +E  ++  A++     H  V  H+S                I+  P               H +  +    TN+ + P +    R +  SS+T      NE  H      + L+ CL +GSE   +  G++  ++    + +RL++ +    + +   P+R IFI  GP++ E    E+ R+F +M++N  FR  VY + S  D+I     F+++S ++ L+R      L     Q++ Y  ++  E+   +  +  +   K    + N  +N    P+  N  + + ++++    +        +     K    ++ F PPF +L   ++   +R   D++D   KEN  I+F  ++F YFV LSP+ITF AL N  V P+ T+T+ L++ G F +++ +++GQPL I+G++  ++IVE  L S++ S G+  + +RFW   Y SI GF+F   N + I    RRSVEEVYN +    +LL ALFTMF  +P      +P      Y     K  + G TLFLA +ML FCL L ++ RG Y R   RKLLGA NVPLG++L+T L  IFF  + +PT++IP SN++N S WVN PDFS+L   S A      G    IG+ + I++  E A N +  T ++ K  K  ++ +++  L  +FPIIS   GWPF SG  VR+ ++ +++ K   + APG+P +I+G  EQR+SG+ VGILV  S+FLGSIL  IP+A++YGMFLYMGVMG+ D+    R+ +LM+RRKHW + + ++G+P  +I    +IQ   V+IL+ + ++S FT   +   +FPI + IY +IR +ALP+W  L  +L ++D+K+
Sbjct:   71 WLETARWVNFEENFNEVEQRFTEAHVPPMKFSCINSFRDKLQQNLKIIQTDALTLGQALDEVAKYALSQNCIQGNEQYDVLRAILFAERWHPEVKGHISDAAEFDQYWAGTLPEGINPKPAFLQRASVAAIGAKKHISMTRASASTND-FKPKLSLGSREQGSSSLTKALSIHNECQHPYHRYNQPLTNCLSSGSEACTVICGLIEFLKSPILVLLRLNKTIQRSCISEVDIPVRFIFIYIGPQNDELNYAELARIFAVMMTNDTFRLCVYDSLSVDDIIKGIDNFMQDSFVMPLSRHYNANALAGMTRQIEAYRKETVCERDGDRRPKGSFAVRKLTEQSQNNLVNGSYVPSSLNLKQQTDNIIKPDSDKLPIPSNEIDTPKISKRKIFLRDFCPPFIELSRGIRPWIKRMPGDYKDAIRKENFSIVFGSVLFIYFVNLSPSITFAALLNTQVDPSYTVTLTLLAVGVFLIIFTVLSGQPLAIIGISAPMYIVESSLVSVSRSTGVDFKQLRFWSAFYCSIFGFIFVGCNISGIAKHIRRSVEEVYNSFIGFFFLLKALFTMFLLIPAKPKDNTPMSRMAYY----QKLAVAGVTLFLAFIMLQFCLILAQLKRGNYFRRNIRKLLGALNVPLGMLLITGLERIFFRGYNLPTVNIPPSNQVNASTWVNPPDFSRLQDYSKAAPTLIHGTSIAIGVALAIIIFTEAALNGL--TAMKNKAVKPNIFVMDLVLLQIIFPIISGITGWPFMSGTTVRTLSNLVALVKMDQSPAPGMPHKIVGTVEQRVSGVFVGILVALSIFLGSILSNIPLAALYGMFLYMGVMGLRDLTFVLRICSLMKRRKHWEDWECVRGLPSRHILVFSLIQAAVVLILVSLNIISDFTVANYVGLIFPIVILIYGLIREFALPKWEWLALYLHQLDRKY 987          
BLAST of slc4a-7 vs. Ensembl Cavefish
Match: slc4a2a (anion exchange protein 2-like [Source:NCBI gene;Acc:103040576])

HSP 1 Score: 258.84 bits (660), Expect = 1.018e-70
Identity = 209/866 (24.13%), Postives = 394/866 (45.50%), Query Frame = 3
Query:  282 DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH---------------VGMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNEN---------MHRVQSQK--KLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL---LSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINR----GIYLRH---------TFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKI---NISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            ++ +EL+ L ++ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D R    + +   E +  S++   ++   +  AL+L H H                G   S   H     H    +      +  I   G   + + + + +N         MHR +S+   KL E +P  +E  ++ VG +  +++    F+RL + V  + +L+   P+R +F++ GP     +  ++GR    ++S++ F E  Y A+ + D+++A   F++ S +V     +  + L+H + + +    +      ++H Q +  + K   + +++     + P F    K   D L+   +                   F     D +    +YLSDF+D       P     I+F YF  LSPAITFG L  +     + ++ L++++    L++ ++  QPL +VG +  + + E+   S   + G+     R WIG +L I+  +   F G+ +V    R  +E+++F  S+I++    S L  +FK  P      S +EN T  +   +      T + +        L LV ++       YLR            R+++G F VP+ I ++  ++    + +    LS+PD   +   +   WV  P  S   +         FL  + +FI++ +E    ++ V+K ER L K + + L++  ++ V  + ++F G P+ + A VRS  H  ++   S   APG   RI    EQR++G +V +LV  S+ +G +L+ IP+A ++G+FLYMGVM ++ + L +R++ L+   K+  +H Y++ +
Sbjct:  335 EVFVELNELVMD-KNQEMQWRETARWIKFEEDVEEETDRWGKPHVASLSFRSLLELRRTISHGAVLLDLDQRTLPGIAHQVVEQMIISDQIRAEDRSNVLRALLLKHSHPSDGKEHTSFHRNISAGSLASLMTHHHSNNHIAPPEPS--ATDPLIAGSGDSESHTRVDIEKNEKDIPPALGMHRSKSKHELKLLEKIPENAEATVVLVGSVDFLDQPSMAFVRLQEAVLLESVLEVPIPVRFLFVLLGPPIANMDYHQIGRSISTLMSDKHFHEAAYLADERQDLLTAINSFLDCS-IVLPPSEVGGDELLHSVARFQREMLR------KRHEQEVKLQAKEPKSPEDE----ALLPPF----KPRADPLQRTGR------------------LFGGAIRDARNRYPKYLSDFKDALN----PQCMAAIIFIYFAALSPAITFGGLLGEKTGGLIGVSELIIATSMQGLVFCVLGAQPLLVVGFSGPLLVFEEAFFSFCTAYGLEYLTGRVWIGFWLIIIVVLMVAFEGSFLVRFVSRFTQEIFSFLISLIFIYETFSKLGKIFKDHP-LTPCNSTSENDTTSLLLSNSSRSADTPVKVLNQPNTALLSLVLMSGTFFIAFYLRKFKNSAFFPGNLRRVIGDFGVPIAIFIMVLVDNSIKDTYTQ-KLSVPDGFSVTSPDKRGWVIHPLGSD-GNFPIWMMAASFLPALLVFILIFMETQITTLIVSKKERMLVKGSGFHLDLLIIVAVGGMSALF-GLPWLAAATVRSVTHTNALTVMSKAVAPGDKPRIQEVKEQRVTGFLVALLVGLSIVIGDVLRQIPIAVLFGIFLYMGVMSLNGIQLTERMMLLLMPPKYHPDHTYVRKV 1156          
BLAST of slc4a-7 vs. Ensembl Cavefish
Match: slc4a2a (anion exchange protein 2-like [Source:NCBI gene;Acc:103040576])

HSP 1 Score: 258.455 bits (659), Expect = 1.495e-70
Identity = 209/865 (24.16%), Postives = 393/865 (45.43%), Query Frame = 3
Query:  285 LLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH---------------VGMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNEN---------MHRVQSQK--KLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL---LSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINR----GIYLRH---------TFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKI---NISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            + +EL+ L ++ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D R    + +   E +  S++   ++   +  AL+L H H                G   S   H     H    +      +  I   G   + + + + +N         MHR +S+   KL E +P  +E  ++ VG +  +++    F+RL + V  + +L+   P+R +F++ GP     +  ++GR    ++S++ F E  Y A+ + D+++A   F++ S +V     +  + L+H + + +    +      ++H Q +  + K   + +++     + P F    K   D L+   +                   F     D +    +YLSDF+D       P     I+F YF  LSPAITFG L  +     + ++ L++++    L++ ++  QPL +VG +  + + E+   S   + G+     R WIG +L I+  +   F G+ +V    R  +E+++F  S+I++    S L  +FK  P      S +EN T  +   +      T + +        L LV ++       YLR            R+++G F VP+ I ++  ++    + +    LS+PD   +   +   WV  P  S   +         FL  + +FI++ +E    ++ V+K ER L K + + L++  ++ V  + ++F G P+ + A VRS  H  ++   S   APG   RI    EQR++G +V +LV  S+ +G +L+ IP+A ++G+FLYMGVM ++ + L +R++ L+   K+  +H Y++ +
Sbjct:  357 VFVELNELVMD-KNQEMQWRETARWIKFEEDVEEETDRWGKPHVASLSFRSLLELRRTISHGAVLLDLDQRTLPGIAHQVVEQMIISDQIRAEDRSNVLRALLLKHSHPSDGKEHTSFHRNISAGSLASLMTHHHSNNHIAPPEPS--ATDPLIAGSGDSESHTRVDIEKNEKDIPPALGMHRSKSKHELKLLEKIPENAEATVVLVGSVDFLDQPSMAFVRLQEAVLLESVLEVPIPVRFLFVLLGPPIANMDYHQIGRSISTLMSDKHFHEAAYLADERQDLLTAINSFLDCS-IVLPPSEVGGDELLHSVARFQREMLR------KRHEQEVKLQAKEPKSPEDE----ALLPPF----KPRADPLQRTGR------------------LFGGAIRDARNRYPKYLSDFKDALN----PQCMAAIIFIYFAALSPAITFGGLLGEKTGGLIGVSELIIATSMQGLVFCVLGAQPLLVVGFSGPLLVFEEAFFSFCTAYGLEYLTGRVWIGFWLIIIVVLMVAFEGSFLVRFVSRFTQEIFSFLISLIFIYETFSKLGKIFKDHP-LTPCNSTSENDTTSLLLSNSSRSADTPVKVLNQPNTALLSLVLMSGTFFIAFYLRKFKNSAFFPGNLRRVIGDFGVPIAIFIMVLVDNSIKDTYTQ-KLSVPDGFSVTSPDKRGWVIHPLGSD-GNFPIWMMAASFLPALLVFILIFMETQITTLIVSKKERMLVKGSGFHLDLLIIVAVGGMSALF-GLPWLAAATVRSVTHTNALTVMSKAVAPGDKPRIQEVKEQRVTGFLVALLVGLSIVIGDVLRQIPIAVLFGIFLYMGVMSLNGIQLTERMMLLLMPPKYHPDHTYVRKV 1177          
BLAST of slc4a-7 vs. Ensembl Cavefish
Match: slc4a2b (anion exchange protein 2-like [Source:NCBI gene;Acc:103041005])

HSP 1 Score: 254.218 bits (648), Expect = 2.450e-69
Identity = 213/879 (24.23%), Postives = 393/879 (44.71%), Query Frame = 3
Query:  282 DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFET---------------NENYI--PHIGRRRNRSSITL------NE-------NMHRVQSQK--KLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL---LSALFTMFKALPYFYTLY-----------SPAEN---STLYINERDKFGIGGTTXXXXXXXXXXXXXXV------KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKI---NISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            ++ +EL+ L ++ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +N   + +   E +  S++   ++   +  AL+L H H      S   E PT   N       +                E  +  P +G    ++   L      NE        +HR +S+   KL E +P  +E  ++ VG +  +E+    F+RL + V  D +L+   P+R +F++ GP S   +  ++GR    ++S++ F E  Y A+ + D+++A   F++ S ++  +     E+L       +  A+       ++  Q +    K   + + K+  +     F  +D    D L+   +                   F  +  D++    +YLSDF+D       P     ++F YF  LSPAITFG L  +     + ++ L+V++    +++ L+  QPL +VG +  + + E+   S   S G+     R WIG +L I+  V   F G+ +V    R  +E+++F  S+I++    S L  +F+  P     +           SP EN   S+   N      I G      L ++             K     +     R+++G F VP+ I+++  ++Y     +    LS+P    +   +   W+  P  S++            L  + +FI++ +E    ++ V+K ER L K + + L++  ++ +  I ++F G P+ + A VRS  H  ++   S   APG   RI    EQR++G++V ILV  S+ +G +L+ IP+A ++G+FLYMGVM ++ + L +R+  L+   K+  +H Y++ +
Sbjct:  273 EVFVELNELIVD-KNQELQWRETARWIKFEEDVEEETDRWGKPHVASLSFRSLLELRKTISHGAVLLDLDQKNLPGIAHQVVEQMIISDQIKAEDRANVLRALLLKHSH-----PSDEKEHPTFPRNISAASLGSLMAHHHHHSNSTSSQAEPSVMQPLMGSETAKTDTVLQMETERNEKEGASVVGIHRSKSKHELKLLEKIPENAEATVVLVGSVDFLEQPTMAFVRLQEAVELDSVLEVPVPVRFLFVLLGPPSTNMDYHQIGRSISTLMSDKSFHEAAYLADERQDLLNAINSFLDCSIVLPPSEMGGEELL-------RSVAHFQREMLRKREEQEVSLLAKEPKSLEEKEALLT---PFKPED----DPLQRTGRP------------------FGGMIRDIRRRYPKYLSDFKDALN----PQCMAAVIFIYFAALSPAITFGGLLGEKTEGLIGVSELIVATCIQGVVFCLLGAQPLLVVGFSGPLLVFEEAFYSFCKSNGLEYLTGRVWIGFWLIIIVVVMVAFEGSFLVRFVSRFTQEIFSFLISLIFIYETFSKLAKIFQQHPLQRCSFVNVSVLNESEISPMENFTWSSEATNSSSTIVIKGEPNTALLSLVLMSGTFFIAFYLRKFKNSAFFPGRLRRVIGDFGVPIAILIMVLVDYSIQETYTQ-KLSVPSGFSVTSPDKRGWIVNPLGSEV-QFPVWMMAASVLPALLVFILIFMETQITTLIVSKKERMLIKGSGFHLDLLVIVAMGGICALF-GLPWMAAATVRSVTHVNALTVMSKAVAPGDKPRIQEVKEQRVTGLLVAILVGLSIVIGDLLRQIPIAVLFGIFLYMGVMSLNGIQLTERMQLLLMPPKYHPDHTYVRKV 1106          
BLAST of slc4a-7 vs. Ensembl Cavefish
Match: slc4a2b (anion exchange protein 2-like [Source:NCBI gene;Acc:103041005])

HSP 1 Score: 254.218 bits (648), Expect = 2.855e-69
Identity = 213/879 (24.23%), Postives = 393/879 (44.71%), Query Frame = 3
Query:  282 DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFET---------------NENYI--PHIGRRRNRSSITL------NE-------NMHRVQSQK--KLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL---LSALFTMFKALPYFYTLY-----------SPAEN---STLYINERDKFGIGGTTXXXXXXXXXXXXXXV------KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKI---NISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            ++ +EL+ L ++ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +N   + +   E +  S++   ++   +  AL+L H H      S   E PT   N       +                E  +  P +G    ++   L      NE        +HR +S+   KL E +P  +E  ++ VG +  +E+    F+RL + V  D +L+   P+R +F++ GP S   +  ++GR    ++S++ F E  Y A+ + D+++A   F++ S ++  +     E+L       +  A+       ++  Q +    K   + + K+  +     F  +D    D L+   +                   F  +  D++    +YLSDF+D       P     ++F YF  LSPAITFG L  +     + ++ L+V++    +++ L+  QPL +VG +  + + E+   S   S G+     R WIG +L I+  V   F G+ +V    R  +E+++F  S+I++    S L  +F+  P     +           SP EN   S+   N      I G      L ++             K     +     R+++G F VP+ I+++  ++Y     +    LS+P    +   +   W+  P  S++            L  + +FI++ +E    ++ V+K ER L K + + L++  ++ +  I ++F G P+ + A VRS  H  ++   S   APG   RI    EQR++G++V ILV  S+ +G +L+ IP+A ++G+FLYMGVM ++ + L +R+  L+   K+  +H Y++ +
Sbjct:  285 EVFVELNELIVD-KNQELQWRETARWIKFEEDVEEETDRWGKPHVASLSFRSLLELRKTISHGAVLLDLDQKNLPGIAHQVVEQMIISDQIKAEDRANVLRALLLKHSH-----PSDEKEHPTFPRNISAASLGSLMAHHHHHSNSTSSQAEPSVMQPLMGSETAKTDTVLQMETERNEKEGASVVGIHRSKSKHELKLLEKIPENAEATVVLVGSVDFLEQPTMAFVRLQEAVELDSVLEVPVPVRFLFVLLGPPSTNMDYHQIGRSISTLMSDKSFHEAAYLADERQDLLNAINSFLDCSIVLPPSEMGGEELL-------RSVAHFQREMLRKREEQEVSLLAKEPKSLEEKEALLT---PFKPED----DPLQRTGRP------------------FGGMIRDIRRRYPKYLSDFKDALN----PQCMAAVIFIYFAALSPAITFGGLLGEKTEGLIGVSELIVATCIQGVVFCLLGAQPLLVVGFSGPLLVFEEAFYSFCKSNGLEYLTGRVWIGFWLIIIVVVMVAFEGSFLVRFVSRFTQEIFSFLISLIFIYETFSKLAKIFQQHPLQRCSFVNVSVLNESEISPMENFTWSSEATNSSSTIVIKGEPNTALLSLVLMSGTFFIAFYLRKFKNSAFFPGRLRRVIGDFGVPIAILIMVLVDYSIQETYTQ-KLSVPSGFSVTSPDKRGWIVNPLGSEV-QFPVWMMAASVLPALLVFILIFMETQITTLIVSKKERMLIKGSGFHLDLLVIVAMGGICALF-GLPWMAAATVRSVTHVNALTVMSKAVAPGDKPRIQEVKEQRVTGLLVAILVGLSIVIGDLLRQIPIAVLFGIFLYMGVMSLNGIQLTERMQLLLMPPKYHPDHTYVRKV 1118          
BLAST of slc4a-7 vs. Ensembl Cavefish
Match: slc4a2b (anion exchange protein 2-like [Source:NCBI gene;Acc:103041005])

HSP 1 Score: 253.447 bits (646), Expect = 4.072e-69
Identity = 213/883 (24.12%), Postives = 386/883 (43.71%), Query Frame = 3
Query:  282 DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFET---------------NENYI--PHIGRRRNRSSITL------NE--------NMHRVQSQK--KLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQN---IYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL---LSALFTMFKALPYFYTLY-----------SPAEN---STLYINERDKFGIGGTTXXXXXXXXXXXXXXV------KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKI---NISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            ++ +EL+ L ++ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +N   + +   E +  S++   ++   +  AL+L H H      S   E PT   N       +                E  +  P +G    ++   L      NE         +HR +S+   KL E +P  +E  ++ VG +  +E+    F+RL + V  D +L+   P+R +F++ GP S   +  ++GR    ++S++ F E  Y A+ + D+++A   F++ S +V     +  E L+  +   +    +   EQ    L       EE+ + +     D     G  F                                      +  D++    +YLSDF+D       P     ++F YF  LSPAITFG L  +     + ++ L+V++    +++ L+  QPL +VG +  + + E+   S   S G+     R WIG +L I+  V   F G+ +V    R  +E+++F  S+I++    S L  +F+  P     +           SP EN   S+   N      I G      L ++             K     +     R+++G F VP+ I+++  ++Y     +    LS+P    +   +   W+  P  S++            L  + +FI++ +E    ++ V+K ER L K + + L++  ++ +  I ++F G P+ + A VRS  H  ++   S   APG   RI    EQR++G++V ILV  S+ +G +L+ IP+A ++G+FLYMGVM ++ + L +R+  L+   K+  +H Y++ +
Sbjct:  266 EVFVELNELIVD-KNQELQWRETARWIKFEEDVEEETDRWGKPHVASLSFRSLLELRKTISHGAVLLDLDQKNLPGIAHQVVEQMIISDQIKAEDRANVLRALLLKHSH-----PSDEKEHPTFPRNISAASLGSLMAHHHHHSNSTSSQAEPSVMQPLMGSETAKTDTVLQMETERNEVRICASVVGIHRSKSKHELKLLEKIPENAEATVVLVGSVDFLEQPTMAFVRLQEAVELDSVLEVPVPVRFLFVLLGPPSTNMDYHQIGRSISTLMSDKSFHEAAYLADERQDLLNAINSFLDCS-IVLPPSEMGGEELLRSVAHFQREMLRKREEQEVSLLAKEPKSLEEKGQLADCPEDDPLQRTGRPFGG------------------------------------MIRDIRRRYPKYLSDFKDALN----PQCMAAVIFIYFAALSPAITFGGLLGEKTEGLIGVSELIVATCIQGVVFCLLGAQPLLVVGFSGPLLVFEEAFYSFCKSNGLEYLTGRVWIGFWLIIIVVVMVAFEGSFLVRFVSRFTQEIFSFLISLIFIYETFSKLAKIFQQHPLQRCSFVNVSVLNESEISPMENFTWSSEATNSSSTIVIKGEPNTALLSLVLMSGTFFIAFYLRKFKNSAFFPGRLRRVIGDFGVPIAILIMVLVDYSIQETYTQ-KLSVPSGFSVTSPDKRGWIVNPLGSEV-QFPVWMMAASVLPALLVFILIFMETQITTLIVSKKERMLIKGSGFHLDLLVIVAMGGICALF-GLPWMAAATVRSVTHVNALTVMSKAVAPGDKPRIQEVKEQRVTGLLVAILVGLSIVIGDLLRQIPIAVLFGIFLYMGVMSLNGIQLTERMQLLLMPPKYHPDHTYVRKV 1098          
BLAST of slc4a-7 vs. Ensembl Sea Lamprey
Match: SLC4A2 (solute carrier family 4 member 2 [Source:HGNC Symbol;Acc:HGNC:11028])

HSP 1 Score: 261.922 bits (668), Expect = 2.808e-73
Identity = 216/877 (24.63%), Postives = 398/877 (45.38%), Query Frame = 3
Query:  282 DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH--------VGMHLSSTIHECPT----------------------------IHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQK--KLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL---LSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXV----------------KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISM---WVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDY 2732
            ++ +EL+ L ++P      W E +RWI +EED + E  R+  PH+++L+ R L   +     G      + +    + +   E +  S++  +++   +  AL+L H H        VG  L   I                                 I   E     ET+E+   H   R N    +L  + HR++ +K  KL   +P G+E  ++ VG +  +E+    F+RL + V  + +L+   P+R +F++ GP     +  E+GR    ++S+++F E  Y A+ + D+++A  +F++ S ++  +      +L            +S     +  LQ      KR    ++K +NI +  +   K  A    + +Q+KE+      +  + + F      L  D +     YLSD RD       P     ++F YF  LSPAITFG L ++     M ++ L++S+    +L+ L+  QPL I+G +  + + E+   S   S G+     R WIG ++ ++  +   F G+ +V    R  +E+++   S+I++    S L+ +F+  P   T Y    N T   +  +   + GTT     ++      L+                K     +L    R+++G F VP+ I+++  +++   N +    L++PD   +       WV  P  ++ T         C + G+ +FI++ +E    ++ V+K ER L K + + L++  ++ +  I +IF G P+ + A VRS  H  ++   S   APG   RI    EQRI+G++V I+V  S+ LG +L+ IP+A ++G+FLYMGV  ++ +  + RL+ +    K+  +  Y
Sbjct:   94 EVFVELNELVMDPARQERQWKETARWIKFEEDVEAETDRWGKPHVASLTFRSLLELRKAISHGTVLLDLEQKTLPTIAHQVVEQLIISDQIREEDRANVLRALLLRHRHPNDMKEVPVGSFLPRNISATSLGSLLAGSGGNGGAAGDPVSSQPLVGNVLIEMGEAGD-HETSEH--AHSLTRDN----SLTGDSHRIKPKKEGKLLGKIPQGAEATVVLVGCVDFLEQPAMAFVRLSEGVLLESVLEVPVPVRFLFVLLGPSEAHMDYHEIGRSISTLMSDKDFHEAAYVADERQDLLNAMTEFLDVSIVLPPSELTDDGLL------------RSVAAFQRDMLQ------KRRQEDESKKLNI-VPTSAELKQTA----VPSQRKEDDDPDDPLRRSGRLFG----GLVRDARRRYPHYLSDLRDALN----PQCLAAVIFIYFAALSPAITFGGLLSEKTQGLMGVSELIISTCLQGILFALLGAQPLLIIGFSGPLLVFEEAFFSFCSSQGVEYLTGRVWIGFWMVLIVLLLVAFEGSFMVRFISRFTQEIFSILISLIFIYETFSKLYKVFQDHPLLST-YPVISNMTTNSDTSNSSIVNGTTAATPKVLNQPNTALLSLLLMSGTFFIAFFLRKFKNSRFLAGKVRRVIGDFGVPIAILVMVLVDFGVPNTYTQ-KLNVPDGFSVTSPSKRGWVINPLGAEGT-FPVWLMFACVIPGLLVFILIFMESQITTLIVSKKERMLLKGSGFHLDLLLIVVMGAICTIF-GLPWLTAATVRSVTHVNALTVMSKATAPGDKPRIECVKEQRITGLLVAIIVGLSMVLGQVLRQIPLAVLFGIFLYMGVTSLNGIQFYDRLMLVFMPAKYHPDTAY 928          
BLAST of slc4a-7 vs. Ensembl Sea Lamprey
Match: SLC4A2 (solute carrier family 4 member 2 [Source:HGNC Symbol;Acc:HGNC:11028])

HSP 1 Score: 239.965 bits (611), Expect = 2.740e-65
Identity = 204/885 (23.05%), Postives = 382/885 (43.16%), Query Frame = 3
Query:  264 CQTSVPDLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH---VGMHLSSTIHECPTI----------HFNEEKQCFE--TNENYIPHIGRRRNRSSI-TLNENMHRVQSQK--KLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFY------YSIIYLLSALFTMFKALPYFYTLY---SPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGI-----------------------YLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKI---NISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            C      + +EL+ L ++P      W E +RWI +EED + E  R+  PH+++L+ R L   +     G      + ++   + +   E +  S++  + E   +  AL+L H H        SS +H   +           H   E    +    +  I     +  + S+ T ++ + R +S+   KL E +P G+E  ++ VG +  +++    F+RL + V  + +L+   P+R +F++ GP+    +  E+GR    ++S+++F E  Y A+ + D+++A  +F++ S +V     +T E L+  +   +           +  LQ   EE+ R    +   +    G       +  +DV +  ++                  PF  +  D +     Y SD +D       P     ++F YF  LSPAITFG L  +     + ++ L++S+    + + L++ QPL IVG +  + + E+   S   S  +     R WIG +L ++  +   F G+ +V    R  +E+++        Y   Y    LF +FK  P   T     +    S ++ N      IG  T               + N  +                       +L    R+++G F VP+ I+++  ++    + +    L++PD   +   +   W+  P     ++        C +    +FI++ +E    ++ V+K ER+L K + + L++  LI +    S  LG P+ + A VRS  H  ++   S   APG   RI    EQR +G++V +L+  SV LG +L+ IP+A ++G+FLYMGV  ++ + ++ RL+      KH  +  Y   +  W +
Sbjct:  314 CTKGFHSVFVELNELVMDPARQELQWKETARWIKFEEDVEAETDRWGKPHVASLTFRSLLELRKAIAHGTVLLDLEQKSLAGITHQVVEQMIISDQITEQERASVLRALLLRHRHPNDAKETTSSFLHRNVSAASLSSLLSGNHAGGEPSVTQPLVGDGAIEMSDLQEQKDSVSTGSDPLSRNKSRPDLKLLEKIPHGAEATIVLVGCVDFLQQPAMAFVRLSEGVVLESVLEVPVPVRFLFVLLGPQQASVDYHEIGRSISTLMSDKDFHEAAYLADERQDLLTAITEFLDCS-IVLPPSELTDEGLLRSVAAFQ-----------RDMLQKRREEDGRRHPREEPPVQSTRGALVGGGVRL-YDVEDPLQR---------------TGRPFGGVVRDARRRYPFYPSDIKDAVD----PQCLAAVIFIYFAALSPAITFGGLLGEKTQGLIGVSELIISTSIQSIFFALLSAQPLLIVGFSGPLLVFEEAFFSFCWSQDVEYLTGRLWIGFWLILIVLLTVAFEGSFLVRYISRFTQEIFSILISIIFIYETFY---KLFKVFKEHPLLKTYTIGGTDLAGSGVWGNA--SMVIGSATAAARNDTDAPTKMPSQPNTSLLSLVLMSGTFFIAFFLRKLKNSRFLAGKVRRVIGDFGVPIAILIMVLVDSAIPDTYTQ-KLAVPDGFSVTSPDQRSWLVNP-LGVRSTFPVWMMFACVVPAALVFILIFMETQITTLIVSKSERRLVKGSGFHLDLL-LIVLMGGASALLGVPWLTAATVRSVTHVNALTVMSKATAPGEKPRIECVKEQRATGLLVAVLIGLSVVLGEVLRRIPLAVLFGIFLYMGVTSVNGIQMYDRLLLAFMPAKHHPDSAYASKVKTWRM 1158          
BLAST of slc4a-7 vs. Ensembl Sea Lamprey
Match: SLC4A4 (solute carrier family 4 member 4 [Source:HGNC Symbol;Acc:HGNC:11030])

HSP 1 Score: 103.605 bits (257), Expect = 2.053e-23
Identity = 112/453 (24.72%), Postives = 191/453 (42.16%), Query Frame = 3
Query: 1395 LYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKAL----------PYFYTLYS----------------PAENSTLYINERDKFGIGGT---------------TXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISM--WVNIPDFSKLTSLSTADQGYCFLI----GITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIP 2612
            L+ D+K     + SD  D  + ++     +  +F Y   ++ AITFG L          +    + +     ++ L  GQPL I+  T  V + E++L + +          R WIG++ + +  +    + + +V  F R  EE ++   S I++  A+  M              P + TLYS                   N+ LY N+++    GG+               +L L +      + L +   G Y   T RKL+  F++ L I     L+ +       P L +P   K   +   W  +P F         +  + +L+     I + I++ ++    +I V + E KLKK + Y L++F +  +    S FLG P++  A V S AH  S+   +  +APG   + +G  EQRI+G++V +L   SVFL  ILK IP
Sbjct:    6 LFKDIKRKLPFFCSDIYDALSIQS----LSATLFIYLATITNAITFGGLLGDATDNMQGVLESFLGTALSGAVFCLFAGQPLIILSSTGPVLVFERLLFNFSKENDFDYLEFRLWIGLWSAFMSLILVATDASYLVQYFTRFTEEGFSALISFIFIYDAIKKMLGLFNYYPINLDYKPDYITLYSCTCQAPDPEWGKKLNTAVINAALY-NKKECSKYGGSLSGKACKFVPDVALVSLLLFMGTYYTTMALKRFKTGRYFPTTIRKLISDFSIILSIFTFVGLDILI--GLETPKLVVPTEFKPTSAKRGWF-VPPFG-------GNPWWVYLVSAVPAILITILVFMDQQITAIIVNRKENKLKKGSGYHLDLFWVAVLMATCS-FLGLPWYVAATVLSIAHIDSLKMETETSAPGEQPKFLGVREQRITGVLVFVLTGVSVFLAPILKKIP 442          
BLAST of slc4a-7 vs. Ensembl Sea Lamprey
Match: SLC4A4 (solute carrier family 4 member 4 [Source:HGNC Symbol;Acc:HGNC:11030])

HSP 1 Score: 100.908 bits (250), Expect = 1.286e-22
Identity = 111/455 (24.40%), Postives = 188/455 (41.32%), Query Frame = 3
Query: 1395 LYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKAL----------PYFYTLYSPA--------------------ENSTLYINERDKFG-------------IGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISM--WVNIPDFSKLTSLSTADQGYCFLI----GITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIP 2612
            L+ D+K     + SD  D  + ++     +  +F Y   ++ AITFG L          +    + +     ++ L  GQPL I+  T  V + E++L + +          R WIG++ + +  +    + + +V  F R  EE ++   S I++  A+  M              P + TLYS                      + S L   E  K+G             +   +L L +      + L +   G Y   T RKL+  F++ L I     L+ +       P L +P   K   +   W  +P F         +  + +L+     I + I++ ++    +I V + E KLKK + Y L++F +  +    S FLG P++  A V S AH  S+   +  +APG   + +G  EQRI+G++V +L   SVFL  ILK IP
Sbjct:    6 LFKDIKRKLPFFCSDIYDALSIQS----LSATLFIYLATITNAITFGGLLGDATDNMQGVLESFLGTALSGAVFCLFAGQPLIILSSTGPVLVFERLLFNFSKENDFDYLEFRLWIGLWSAFMSLILVATDASYLVQYFTRFTEEGFSALISFIFIYDAIKKMLGLFNYYPINLDYKPDYITLYSCTCQAPDPVLMIKPDLGNATGPDWSALSKKECSKYGGSLSGKACKFVPDVALVSLLLFMGTYYTTMALKRFKTGRYFPTTIRKLISDFSIILSIFTFVGLDILI--GLETPKLVVPTEFKPTSAKRGWF-VPPFG-------GNPWWVYLVSAVPAILITILVFMDQQITAIIVNRKENKLKKGSGYHLDLFWVAVLMATCS-FLGLPWYVAATVLSIAHIDSLKMETETSAPGEQPKFLGVREQRITGVLVFVLTGVSVFLAPILKKIP 445          
BLAST of slc4a-7 vs. Ensembl Sea Lamprey
Match: slc4a7 (solute carrier family 4 member 7 [Source:ZFIN;Acc:ZDB-GENE-140106-104])

HSP 1 Score: 101.293 bits (251), Expect = 5.877e-22
Identity = 78/377 (20.69%), Postives = 152/377 (40.32%), Query Frame = 3
Query:  744 NENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSAL 1874
            N NM   +        +P G+E + + VG +  +ER    F+RL   V   G+ +   P R +F + GP  + ++  E+GR    ++++  F ++ Y+A+ + D+++   +F++   ++               P ++    KS   Q ++ + N+       +  +++   +  GP      +                              F  L +D+K     Y SD+RD  + +         +F Y   +SP ITFG L  +     ++    L  +    + + L  GQPL I+G T  V + E++L       G+    +R  IG++ + L  +    + + +V    R  EE +     II++  AL
Sbjct:  401 NSNMDFSKVDLNFMRKIPPGAEASNVLVGEVDFLERPLIAFVRLSPAVLLTGITEVPIPTRFLFFLLGPPGKAQQYHEIGRSIATLMADEIFHDVAYKAKDRNDLLAGIDEFLDQVTVLPPGEWD---------PSIRIEPPKSVPSQEKRKMPNVPNGGAPGAEPEHEGHGM--GPELQRTGR-----------------------------LFGGLVVDIKRKLPWYWSDYRDALSLQ----CVASFLFLYCACMSPVITFGGLLGEATENRISAIESLFGASMTGIAFSLFAGQPLTILGSTGPVLVFEKILYKFCKDYGLSYLSLRASIGLWTAFLCLLLVATDASSLVCYITRFTEEAFASLICIIFIYEAL 733          
BLAST of slc4a-7 vs. Ensembl Yeast
Match: BOR1 (Boron efflux transporter of the plasma membrane; binds HCO3-, I-, Br-, NO3- and Cl-; has similarity to the characterized boron efflux transporter A. thaliana BOR1 [Source:SGD;Acc:S000005219])

HSP 1 Score: 51.2174 bits (121), Expect = 7.993e-7
Identity = 39/156 (25.00%), Postives = 67/156 (42.95%), Query Frame = 3
Query: 1395 LYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL 1862
            +++DLK     Y SD+ D F     P     IV  YF  L PAI F          +  +  +L+SS    +++ ++ GQPL IVGVT  + I    +  +   L        FWI ++  I   V    N   ++        +++  + +++Y+
Sbjct:   62 IWLDLKDRIPYYKSDWVDAFNYRVIP----SIVDTYFNNLLPAIAFAQDMFDRTDNSYGVNEVLLSSAMAGIVFGVLGGQPLCIVGVTGPISIFNYTVYEIIKPLNTSYFGFMFWICMWSMIFHLVLAFTNAVCLLQYVTTFPCDIFGLFINVVYI 213          
BLAST of slc4a-7 vs. Ensembl Nematostella
Match: EDO45844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRK7])

HSP 1 Score: 199.519 bits (506), Expect = 1.457e-52
Identity = 181/836 (21.65%), Postives = 363/836 (43.42%), Query Frame = 3
Query:  339 WTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHV-----GMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRR-------NRSSITLNENMH---RVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSA---LFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXV-----KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSKLTSLSTADQ---GYCFLIGITMF---IMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            W E +RWI +EED + +  R++ PH+++LS   L   +   + G      +  +   +     +++  +++  K++   + +AL++ H H       +    + +   T   N  ++  E ++N +  +  ++       +   + +++N+        +  +   +P  +E   + VG L  ++   + F+RL +  Y   + +   P+R +F++ GP+++ +   E+GR    ++S++ F ++ Y +ES+ D++ A  +F++++ ++         ++   L Q K  A +    +  K +  I  +   E     K      G                                         L  D+K   + Y+SDF+DGF  +   +     VF YF V +P + FG L  +     + ++ ++ +S    LL+ L +GQPL I+G T  V + EQ +        I     R WIG ++ ++ F+   F G  +V  F R  EE++    S+I++  A   L+ +FK  P      +   N   YI E      G     L   +L F  Y V     K     +     R+L+  F + + +I +  ++    +    P +SI D  K+     +       +  +   D    G+ F   I      I+L +E     + + K E  L+K+  Y +++  L+ V  +I    G P+   A VRS +H  +++ WS + APG    ++   EQRI+ +++ +L   S+ L  +L ++P+  ++G+ LY+G+  +S++ L  RL+ ++   KH  +  Y++ +P   I
Sbjct:   71 WKETARWIKFEEDVE-DSNRWSKPHVASLSFHSLLELRKGLERGTVLLDLEQFDLQSIAEAIVDNMVITDQLCKEDSDRVLSALLVKHKHQYQEAGNLPRRPSFYNLKTFTPNLSRRNNEEDKNSVKMVVTQKVPVDEETDMIRLKIDDNIDVGSHTNQESDVKARVPEDAEATNVLVGTLDCLKNPVTAFVRLAKGCYLGNVTEVAIPVRFLFVMLGPETQSDTYHEIGRSIATLMSDQVFHDLAYYSESREDILMAINEFLDDTVVLPPGEWDKQLLIPVLLSQSKTMAKR---RKQAKEINAIATQAAEEEDNPLKRTGRFCG----------------------------------------GLIQDIKHRSKTYISDFKDGFNWQCLLVT----VFLYFAVFAPNVAFGGLLAEKTDQWLGVSEVIFASCFCGLLFALFSGQPLIIIGATGPVMVFEQTIFKFCEQSNIEFLPWRCWIGFWVLVILFLVVAFEGCFLVRYFTRFTEELFACLISLIFIYEAINFLYKVFKKNPLSRDPVTNLTNIDPYIKENIVPVTGEPNTALLCAILMFGTYFVAFYMRKFRNSHFFGKKARRLVSDFGIAIAMITMVIIDVAIRDTVITPKISIGDVTKVGFHPTLKTKRGWFINPMGLVDSMKAGWVFAAIIPALFVGILLFMETELTGVLINKKENCLQKRPGYNMDLL-LMGVITLICSLFGLPWMCPATVRSVSHFNALSVWSTSHAPGEKPYLVEVREQRITNILIHVLTGMSILLAPVLHHVPVPVLFGVLLYLGLSSLSNLQLINRLIMMLMPPKHHPDVRYVRKVPTAKI 857          
BLAST of slc4a-7 vs. Ensembl Nematostella
Match: EDO31793 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWX4])

HSP 1 Score: 187.963 bits (476), Expect = 5.135e-49
Identity = 173/838 (20.64%), Postives = 346/838 (41.29%), Query Frame = 3
Query:  312 LNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSST--IHECPTIHFNEEKQCFETNEN--------YIPHI--------GRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQH------QKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKI---NISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            L+   +   W E +RWI +EED +    R+  PH+  L     +  + +F++G      D      +    +  +    + ++ E     + L+  H H      S   I +  TIH   ++Q   TN+N         IPH+           R + S+ ++   ++V S   +   +P  +E   + VG    +      F+RL +      L +   P+R +FI+ GP  +  +  EVGR    ++S+R F +  Y AE   D+  A   F+ ++ ++         +L   LP L     K+   +       Q+H  ++  +E    + + +D  ++    F                                      L  D+K     Y SD  D F            +  Y   L+PAI+FG L  K     M +  ++VS+    +++ L  GQPL I+G T  + + E  + +L+ S        R W+G+++ ++ +      G  ++  F R  EE++    S+I++   +    K +   + LY     +T  ++ +D       T  L          +  +    +L HT R+++  F V + I+ +  L  +   +  +  L++PD   +   ++  W   P  ++    + A  G   +  I + I++ +EV   ++ + K + +LKK   Y L++F +  +  + S+ LG P+     V + +H  ++   S N APG   +++   EQR++ +I+ +L+  ++ L  +++  P+  ++G+F+++G   +S +   +R   L     H  +  Y++ +
Sbjct:   22 LSCSDDKLIWKETARWIKFEEDVEKNANRWGKPHIPCLGFHSCQEVRTVFQNGCLLLDLDEDQLPSIAEAVASKLISDGKLSEKEHDAFLSILLTPHEHQFQKQRSGGGIRKLSTIHPIGKEQGRNTNQNDFFSILFSSIPHVEIATKPGGNTSRAQDSLAVDTIDNKVSS---IDARIPKDAEATTVLVGGHKHLSAPEGAFVRLARGCRLRNLAEVNIPVRFLFILLGPDDKSIDYHEVGRCVATLMSDRLFLDCAYDAEELQDLYDAMDSFLSDTVIIPPGEW-DRNVLAQSLPSLAKETKKTALRRRGALLRKQRHFSDLETQETVTESLELEDDPLKRTGLFCGG-----------------------------------LLRDVKRRFPYYKSDMTDSFNWR----CVMATILVYVACLAPAISFGGLLYKKTKGWMGVAEMIVSTALSGVIFALFAGQPLIIIGATGPLLLFETNVFNLSESFDFEYMPWRAWVGIWVMLICWALVAMEGCFLIRYFTRFTEEIFACMISLIFIYDGI----KYIYDIFGLYPLTSGTTENVDGKDVSNTALFTTILFFGTFFVAHIIRDVRHSRFLNHTLRRVISDFGVLIAIVAMI-LVELSAQSIYVQRLNVPDGFDVTSPHLRGWYVNPMGTERRLGADAIFG-ALVPAILVSILVFMEVEFCNVILDKKDNQLKKGPGYNLDLFVVGFLMGMCSV-LGLPWMCATPVHTVSHLHALMVHSTNHAPGEHPQLLEVKEQRVTNIIIHVLIGLTMLLAPVIRLTPVVVLFGVFVHLGFSSLSHLQFVERFKLLFVSPNHHPDRRYVRSV 809          
BLAST of slc4a-7 vs. Ensembl Nematostella
Match: EDO40610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6T5])

HSP 1 Score: 59.6918 bits (143), Expect = 2.199e-9
Identity = 54/240 (22.50%), Postives = 110/240 (45.83%), Query Frame = 3
Query: 2034 NRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPG-IPKRIIGHCEQRISGMIVGILVFCSVF-LGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIP 2747
             +  +L    R+ L  + +P+ ++  + +   FF+   + T           S  V +   S     + A  G C L G  + ++  ++   +S  V     +LKK + + L++  +  +  I+S F G P+  GA+  S  H  ++A        G +   I+   E R++ +I  IL+  S+  L + L YIP A + G+FL++ V  + D  +++RL+  +  +  +  + Y++ +P
Sbjct:   30 KKSPFLDANKREALADYALPVAVLFFSFIGTYFFSGESLHTF--------KSSGAVTLKPSSLSLLSAGAVFGACGL-GFCLSLLFFMDQNISSAMVNNPGNRLKKGSAFHLDLLVVAIINGILSAF-GLPWIHGALPHSPLHVRALADVEERVDQGHVFDIIVKVRETRLTTLIAHILIGLSLLMLPTPLDYIPTAVLDGLFLFVAVTSLDDNQMFERLLLFVTEQSAYPPNHYIRRVP 259          
BLAST of slc4a-7 vs. Ensembl Nematostella
Match: EDO27089 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TA82])

HSP 1 Score: 51.2174 bits (121), Expect = 8.588e-8
Identity = 24/96 (25.00%), Postives = 49/96 (51.04%), Query Frame = 3
Query: 1608 LLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKAL 1895
            +L+ L +GQPL I+G T  + + E+++ +    +G+     R WIG++  +   +  + + + ++  F R  EE +    +IIY+      +F  L
Sbjct:   13 ILFALFSGQPLIILGATGPMLVFEEIVYTFCERVGLEYLSFRLWIGIWTMLFCLILVVTDASAMICYFTRFTEETFATLIAIIYIYEGFKKLFHIL 108          
BLAST of slc4a-7 vs. Ensembl Medaka
Match: slc4a2b (anion exchange protein 2 [Source:NCBI gene;Acc:101165429])

HSP 1 Score: 239.965 bits (611), Expect = 1.266e-64
Identity = 209/892 (23.43%), Postives = 397/892 (44.51%), Query Frame = 3
Query:  240 KESSATTICQTSVP-DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH---------------VGMHLSSTI-HECPTIHFNE-EKQCFETNENYIPHIGRRRNRSSITLNE---------NMHRVQSQK--KLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEV----------YNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRH---------TFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISM---WVNIPDFSKLTSLSTADQG------YCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            KES+  +  Q   P ++ +EL+ L ++ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +    + +   E +  S++   ++   +  AL+L H H                 + L+S + H   + H N+ E    +     +   G   +R  +  N+          MH+ +S+   KL E +P  +E  ++ VG +  +E+    F+RL + V  D +L+   P+R +F++ GP +   +  ++GR    ++S+++F E  Y A+ + D+++A   F++ S ++  +     E+L   + + +    +   EQ    + N+  +E +         ++E         K S D LE   +                   F  L  D++    +YLSDF+D    +        ++F YF  LSPAITFG L  +     + ++ L+VS+    + + L+  QPL +VG +  + + E+   +      I     R WIG +L I+  V     G+ +V    R  +E+          Y  ++ ++ +         +L       S  EN +  ++     G    +      +L+  L         YLR            R+++G F VP+ I+++  ++Y   + +    LS+P    +       W+  P       L +  Q        C L  + +FI++ +E    ++ V+K ER L K + + L++  ++ +   ++IF G P+ +GA VRS  H  ++   S   APG   RI    EQR++G++V ++V  S+ +G +L+ IP+A ++G+FLYMGVM ++ + L +R++ L+   K+  +H Y++ +
Sbjct:  283 KESATRSRKQDRTPHEVFVELNELTID-KNQEMQWKETARWIKFEEDVEEETDRWGKPHVASLSFRSLLELRRTISHGAVLLDLDQKTLPGIAHQVVEQMIISDQIKAEDRANVLRALLLKHSHPSDEKEHASHFPRNISSVSLTSLLTHHHSSNHINQQEPSVTDPLMGNLNSTGDSDSRIDMDKNDLQKESLFVSGMHKSKSKHELKLLEKIPENAEATVVLVGCVDFLEQPTMAFVRLQEAVELDSVLEVPVPVRFLFVLLGPPTTSMDYHQIGRSISTLMSDKQFHEAAYLADGRQDLLNAINSFLDCSIVLPPSEMGDDELL-RSVARFQREMLRKREEQ----VTNLMAKEPK---------SLEEKEALLAPSKKSSDPLERTGRP------------------FGGLIRDVRRRYPKYLSDFKDALDSQ----CMAAVIFIYFAALSPAITFGGLLGEKTEGLIGVSELIVSTAVQGIFFSLLGAQPLLVVGFSGPLLVFEEAFFNFCKGNDIEYLTGRTWIGFWLIIIVVVIVALEGSFLVRFVSRFTQEIFSFIISFIFIYETFFKLVMIFRDHPLKRCSLSNNSDEISSVENGSFLLSNGTLAGKVSVSGEPNTALLSLVLMAGTFFIAFYLRKFKNSAFFPGKLRRIIGDFGVPIAILIMVLVDYSVEDTYTQ-KLSVPKGFSVTSPEKRGWIINP-------LGSNGQFPIWMMFACCLPALLVFILIFMETQITTLIVSKKERMLVKGSGFHLDLLLIVVLGGTLAIF-GLPWLAGATVRSVTHVNALTVMSKAVAPGDKPRIQEVKEQRVTGLLVAVMVGMSIVIGELLRQIPLAVLFGIFLYMGVMSLNGIQLTERMMLLLMPPKYHPDHTYVRKV 1128          
BLAST of slc4a-7 vs. Ensembl Medaka
Match: slc4a3 (solute carrier family 4 member 3 [Source:NCBI gene;Acc:101164449])

HSP 1 Score: 239.965 bits (611), Expect = 1.328e-64
Identity = 206/859 (23.98%), Postives = 391/859 (45.52%), Query Frame = 3
Query:  282 DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVG-------MHLSS-TIHEC-PTIHFNEEKQCFETNENYIPH-----IGRRRNRSSITLNENMHRVQSQK--------KLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPN-FNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYL---LSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXV----KINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKI---NISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNI 2759
            +L +EL+ L +  +     W E++RWI +EED + E  R+  PH+++LS R L   +     G      +      + +   E++  S++   ++   +  AL+L H H          H SS ++H      H  +  Q     E+   H     +   +    ++L +++H + ++         KL   +P  +E  ++ VG +  +E+    F+RL++    + +L+   P+R IF++ GP     +  E+GR F  ++S++ F E+ Y A+ + D+++   +F++ S ++  +     ++L       K    K    + +KH   +  E+      DNKD+     PN    ++    D L                   +   PF  L  D++     Y+SDF+D    +        ++F YF  LSP ITFG L  +     M +T L+VS+ T  +L+ L  GQPL I+G +  + + E+       +        R WIG +L  +  V     G+ +V       +E++ F  S+I++    S LF +FK  P      +    +T + NE +       T  L+L+++    ++     K     +L    R+++G F +P+ I++   ++Y   + +    L++P    +   +   W   P F       T   G   +  + +FI++ +E    S+ V+K ER+L K + + L++  ++ +  I  +F G P+ + A VRS  H  ++   S   APG    I    EQR++G++V +LV  S+ +  +L+ IP+A ++G+FLYMGV  ++ + L++R+  ++   KH  +H Y+  +  W +
Sbjct:  342 ELFVELNELIVE-KEQEMRWKERARWIKFEEDVEEETERWGKPHVASLSFRSLLELRRTITHGAILLDLEQNTLPGIAHLVVETMIISDQIRAEDRPSVLRALLLKHSHPSDMKHRFHRHQSSGSLHASFNHNHSQDTSQPLVAEESEEHHEIKGPVYDPKQDVFVSLFKSLHPLPAESHHGAARSMKLLSKIPKDAEAVIVLVGCVDFLEQPAMAFVRLNEASLLESVLEVPVPVRFIFVLLGPSQSNVDYHEIGRSFATLMSDKNFHEVAYFADDRQDLLNGINKFLDCSIVIPPSDIEGKDLLKTVADFQKQILRKRREREGKKHHPMLGAEQ------DNKDVT----PNEEEEEEDHEVDPL------------------TRSGIPFGGLIHDIRRRYPLYISDFKDALDMQ----CIAAVIFIYFAALSPTITFGGLLGEKTEGMMGVTELIVSTATLGVLFSLFAGQPLLIIGFSGPLLVFEEAYYKFCQAYKFEYLTGRVWIGFWLIGIVLVIVAAEGSFLVRYISPFTQEIFAFLISLIFIYETFSKLFKVFKEHPLMAVYPTDTTAATGFPNEDNLIFNQPNTALLSLVLMMGTFFIAFFLRKFRNSRFLGGKARRIIGDFGIPISILVSVLVDYSITDTYTQ-KLNVPSGFSVTSPDKRGWFISP-FGDKQPFPTWMMGASVVPALLVFILIFMETQITSLIVSKKERRLIKGSGFHLDLLLIVILGAICPLF-GLPWLTAATVRSVTHVNALTVMSKATAPGEKPMIQEVKEQRLTGLLVAVLVGMSIVMTDVLRLIPLAVLFGIFLYMGVTSLTGIQLYERITLMVTPAKHHPDHIYVTKVKTWRM 1164          
BLAST of slc4a-7 vs. Ensembl Medaka
Match: slc4a2b (anion exchange protein 2 [Source:NCBI gene;Acc:101165429])

HSP 1 Score: 240.35 bits (612), Expect = 1.337e-64
Identity = 209/892 (23.43%), Postives = 397/892 (44.51%), Query Frame = 3
Query:  240 KESSATTICQTSVP-DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH---------------VGMHLSSTI-HECPTIHFNE-EKQCFETNENYIPHIGRRRNRSSITLNE---------NMHRVQSQK--KLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEV----------YNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRH---------TFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISM---WVNIPDFSKLTSLSTADQG------YCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            KES+  +  Q   P ++ +EL+ L ++ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +    + +   E +  S++   ++   +  AL+L H H                 + L+S + H   + H N+ E    +     +   G   +R  +  N+          MH+ +S+   KL E +P  +E  ++ VG +  +E+    F+RL + V  D +L+   P+R +F++ GP +   +  ++GR    ++S+++F E  Y A+ + D+++A   F++ S ++  +     E+L   + + +    +   EQ    + N+  +E +         ++E         K S D LE   +                   F  L  D++    +YLSDF+D    +        ++F YF  LSPAITFG L  +     + ++ L+VS+    + + L+  QPL +VG +  + + E+   +      I     R WIG +L I+  V     G+ +V    R  +E+          Y  ++ ++ +         +L       S  EN +  ++     G    +      +L+  L         YLR            R+++G F VP+ I+++  ++Y   + +    LS+P    +       W+  P       L +  Q        C L  + +FI++ +E    ++ V+K ER L K + + L++  ++ +   ++IF G P+ +GA VRS  H  ++   S   APG   RI    EQR++G++V ++V  S+ +G +L+ IP+A ++G+FLYMGVM ++ + L +R++ L+   K+  +H Y++ +
Sbjct:  283 KESATRSRKQDRTPHEVFVELNELTID-KNQEMQWKETARWIKFEEDVEEETDRWGKPHVASLSFRSLLELRRTISHGAVLLDLDQKTLPGIAHQVVEQMIISDQIKAEDRANVLRALLLKHSHPSDEKEHASHFPRNISSVSLTSLLTHHHSSNHINQQEPSVTDPLMGNLNSTGDSDSRIDMDKNDLQKESLFVSGMHKSKSKHELKLLEKIPENAEATVVLVGCVDFLEQPTMAFVRLQEAVELDSVLEVPVPVRFLFVLLGPPTTSMDYHQIGRSISTLMSDKQFHEAAYLADGRQDLLNAINSFLDCSIVLPPSEMGDDELL-RSVARFQREMLRKREEQ----VTNLMAKEPK---------SLEEKEALLAPSKKSSDPLERTGRP------------------FGGLIRDVRRRYPKYLSDFKDALDSQ----CMAAVIFIYFAALSPAITFGGLLGEKTEGLIGVSELIVSTAVQGIFFSLLGAQPLLVVGFSGPLLVFEEAFFNFCKGNDIEYLTGRTWIGFWLIIIVVVIVALEGSFLVRFVSRFTQEIFSFIISFIFIYETFFKLVMIFRDHPLKRCSLSNNSDEISSVENGSFLLSNGTLAGKVSVSGEPNTALLSLVLMAGTFFIAFYLRKFKNSAFFPGKLRRIIGDFGVPIAILIMVLVDYSVEDTYTQ-KLSVPKGFSVTSPEKRGWIINP-------LGSNGQFPIWMMFACCLPALLVFILIFMETQITTLIVSKKERMLVKGSGFHLDLLLIVVLGGTLAIF-GLPWLAGATVRSVTHVNALTVMSKAVAPGDKPRIQEVKEQRVTGLLVAVMVGMSIVIGELLRQIPLAVLFGIFLYMGVMSLNGIQLTERMMLLLMPPKYHPDHTYVRKV 1128          
BLAST of slc4a-7 vs. Ensembl Medaka
Match: slc4a2b (anion exchange protein 2 [Source:NCBI gene;Acc:101165429])

HSP 1 Score: 239.58 bits (610), Expect = 2.286e-64
Identity = 209/892 (23.43%), Postives = 397/892 (44.51%), Query Frame = 3
Query:  240 KESSATTICQTSVP-DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH---------------VGMHLSSTI-HECPTIHFNE-EKQCFETNENYIPHIGRRRNRSSITLNE---------NMHRVQSQK--KLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEV----------YNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRH---------TFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISM---WVNIPDFSKLTSLSTADQG------YCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            KES+  +  Q   P ++ +EL+ L ++ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +    + +   E +  S++   ++   +  AL+L H H                 + L+S + H   + H N+ E    +     +   G   +R  +  N+          MH+ +S+   KL E +P  +E  ++ VG +  +E+    F+RL + V  D +L+   P+R +F++ GP +   +  ++GR    ++S+++F E  Y A+ + D+++A   F++ S ++  +     E+L   + + +    +   EQ    + N+  +E +         ++E         K S D LE   +                   F  L  D++    +YLSDF+D    +        ++F YF  LSPAITFG L  +     + ++ L+VS+    + + L+  QPL +VG +  + + E+   +      I     R WIG +L I+  V     G+ +V    R  +E+          Y  ++ ++ +         +L       S  EN +  ++     G    +      +L+  L         YLR            R+++G F VP+ I+++  ++Y   + +    LS+P    +       W+  P       L +  Q        C L  + +FI++ +E    ++ V+K ER L K + + L++  ++ +   ++IF G P+ +GA VRS  H  ++   S   APG   RI    EQR++G++V ++V  S+ +G +L+ IP+A ++G+FLYMGVM ++ + L +R++ L+   K+  +H Y++ +
Sbjct:  292 KESATRSRKQDRTPHEVFVELNELTID-KNQEMQWKETARWIKFEEDVEEETDRWGKPHVASLSFRSLLELRRTISHGAVLLDLDQKTLPGIAHQVVEQMIISDQIKAEDRANVLRALLLKHSHPSDEKEHASHFPRNISSVSLTSLLTHHHSSNHINQQEPSVTDPLMGNLNSTGDSDSRIDMDKNDLQKESLFVSGMHKSKSKHELKLLEKIPENAEATVVLVGCVDFLEQPTMAFVRLQEAVELDSVLEVPVPVRFLFVLLGPPTTSMDYHQIGRSISTLMSDKQFHEAAYLADGRQDLLNAINSFLDCSIVLPPSEMGDDELL-RSVARFQREMLRKREEQ----VTNLMAKEPK---------SLEEKEALLAPSKKSSDPLERTGRP------------------FGGLIRDVRRRYPKYLSDFKDALDSQ----CMAAVIFIYFAALSPAITFGGLLGEKTEGLIGVSELIVSTAVQGIFFSLLGAQPLLVVGFSGPLLVFEEAFFNFCKGNDIEYLTGRTWIGFWLIIIVVVIVALEGSFLVRFVSRFTQEIFSFIISFIFIYETFFKLVMIFRDHPLKRCSLSNNSDEISSVENGSFLLSNGTLAGKVSVSGEPNTALLSLVLMAGTFFIAFYLRKFKNSAFFPGKLRRIIGDFGVPIAILIMVLVDYSVEDTYTQ-KLSVPKGFSVTSPEKRGWIINP-------LGSNGQFPIWMMFACCLPALLVFILIFMETQITTLIVSKKERMLVKGSGFHLDLLLIVVLGGTLAIF-GLPWLAGATVRSVTHVNALTVMSKAVAPGDKPRIQEVKEQRVTGLLVAVMVGMSIVIGELLRQIPLAVLFGIFLYMGVMSLNGIQLTERMMLLLMPPKYHPDHTYVRKV 1137          
BLAST of slc4a-7 vs. Ensembl Medaka
Match: slc4a2b (anion exchange protein 2 [Source:NCBI gene;Acc:101165429])

HSP 1 Score: 239.58 bits (610), Expect = 2.286e-64
Identity = 209/892 (23.43%), Postives = 397/892 (44.51%), Query Frame = 3
Query:  240 KESSATTICQTSVP-DLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFH---------------VGMHLSSTI-HECPTIHFNE-EKQCFETNENYIPHIGRRRNRSSITLNE---------NMHRVQSQK--KLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEV----------YNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRH---------TFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISM---WVNIPDFSKLTSLSTADQG------YCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGI 2744
            KES+  +  Q   P ++ +EL+ L ++ +     W E +RWI +EED + E  R+  PH+++LS R L   +     G      D +    + +   E +  S++   ++   +  AL+L H H                 + L+S + H   + H N+ E    +     +   G   +R  +  N+          MH+ +S+   KL E +P  +E  ++ VG +  +E+    F+RL + V  D +L+   P+R +F++ GP +   +  ++GR    ++S+++F E  Y A+ + D+++A   F++ S ++  +     E+L   + + +    +   EQ    + N+  +E +         ++E         K S D LE   +                   F  L  D++    +YLSDF+D    +        ++F YF  LSPAITFG L  +     + ++ L+VS+    + + L+  QPL +VG +  + + E+   +      I     R WIG +L I+  V     G+ +V    R  +E+          Y  ++ ++ +         +L       S  EN +  ++     G    +      +L+  L         YLR            R+++G F VP+ I+++  ++Y   + +    LS+P    +       W+  P       L +  Q        C L  + +FI++ +E    ++ V+K ER L K + + L++  ++ +   ++IF G P+ +GA VRS  H  ++   S   APG   RI    EQR++G++V ++V  S+ +G +L+ IP+A ++G+FLYMGVM ++ + L +R++ L+   K+  +H Y++ +
Sbjct:  292 KESATRSRKQDRTPHEVFVELNELTID-KNQEMQWKETARWIKFEEDVEEETDRWGKPHVASLSFRSLLELRRTISHGAVLLDLDQKTLPGIAHQVVEQMIISDQIKAEDRANVLRALLLKHSHPSDEKEHASHFPRNISSVSLTSLLTHHHSSNHINQQEPSVTDPLMGNLNSTGDSDSRIDMDKNDLQKESLFVSGMHKSKSKHELKLLEKIPENAEATVVLVGCVDFLEQPTMAFVRLQEAVELDSVLEVPVPVRFLFVLLGPPTTSMDYHQIGRSISTLMSDKQFHEAAYLADGRQDLLNAINSFLDCSIVLPPSEMGDDELL-RSVARFQREMLRKREEQ----VTNLMAKEPK---------SLEEKEALLAPSKKSSDPLERTGRP------------------FGGLIRDVRRRYPKYLSDFKDALDSQ----CMAAVIFIYFAALSPAITFGGLLGEKTEGLIGVSELIVSTAVQGIFFSLLGAQPLLVVGFSGPLLVFEEAFFNFCKGNDIEYLTGRTWIGFWLIIIVVVIVALEGSFLVRFVSRFTQEIFSFIISFIFIYETFFKLVMIFRDHPLKRCSLSNNSDEISSVENGSFLLSNGTLAGKVSVSGEPNTALLSLVLMAGTFFIAFYLRKFKNSAFFPGKLRRIIGDFGVPIAILIMVLVDYSVEDTYTQ-KLSVPKGFSVTSPEKRGWIINP-------LGSNGQFPIWMMFACCLPALLVFILIFMETQITTLIVSKKERMLVKGSGFHLDLLLIVVLGGTLAIF-GLPWLAGATVRSVTHVNALTVMSKAVAPGDKPRIQEVKEQRVTGLLVAVMVGMSIVIGELLRQIPLAVLFGIFLYMGVMSLNGIQLTERMMLLLMPPKYHPDHTYVRKV 1137          
BLAST of slc4a-7 vs. Planmine SMEST
Match: SMESG000063821.1 (SMESG000063821.1)

HSP 1 Score: 1922.52 bits (4979), Expect = 0.000e+0
Identity = 1001/1004 (99.70%), Postives = 1002/1004 (99.80%), Query Frame = 3
Query:   69 MHHQKISADNPVYEEDENEIKDDQPDSEVAGGELKQWRNSIEQEGDMSFHDQPIYMKKESSATTICQTSVPDLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRTXXXXXXXXXXXXXXXXXXSQFTTYVWTLFLFPIFVGIYAMIRGYALPRWPRLNTHLSKMDKKHFVKLYDGKKVKSEAEIVQDNQAFDPXXXXXXXXXXXXXXGIY 3080
            MHHQKISADNPVYEEDENEIKDDQPDSEVAGGELKQWRNSIEQEGDMSFHDQPIYMKKESSATTICQ SVPDLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSV GLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFG+MLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEPSCSKKVVSTVKKFFPPFYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTLFLALLMLNFCLYLVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRTLVIIQLFFVIILIIIYVLSQFTTYVWTLFLFPIFVGIYAMIRGYALPRWPRLNTHLSKMDKKHFVKLYDGKKVKSEAEIVQDNQAFDPENNEDSSNSSEEESGIY
Sbjct:    1 MHHQKISADNPVYEEDENEIKDDQPDSEVAGGELKQWRNSIEQEGDMSFHDQPIYMKKESSATTICQMSVPDLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVSGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGVMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEIGPNFNNKDKASFDVLETQKKEEPSCSKKVVSTVKKFFPPFYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTLFLALLMLNFCLYLVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRTLVIIQLFFVIILIIIYVLSQFTTYVWTLFLFPIFVGIYAMIRGYALPRWPRLNTHLSKMDKKHFVKLYDGKKVKSEAEIVQDNQAFDPENNEDSSNSSEEESGIY 1004          
BLAST of slc4a-7 vs. Planmine SMEST
Match: SMESG000020434.1 (SMESG000020434.1)

HSP 1 Score: 912.909 bits (2358), Expect = 0.000e+0
Identity = 484/935 (51.76%), Postives = 647/935 (69.20%), Query Frame = 3
Query:  270 TSVPDLLIELDILYLNPRTNSYCWTEKSRWIIYEEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLNTYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEEKQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRITHEILVHCLPQLKYYANKSHTEQHQKHLQN----IYEEEKRESTTDNKD-INIEIGPN--------FNNKD-KASFDVLETQKKEEXXXXXXXXXXXXXXXXXXYQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKALPYFYTLYSPA--ENSTLYINERDKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIPDSNKINISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRTXXXXXXXXXXXXXXXXXXSQFTTYVWTLFLFPIFVGIYAMIRGYALPRWPRLNTHLSKMDKKHFVKLYDGKKVKSEAEIVQDNQAFD 3026
            + +P L +E D L +NP TN+YCW EKSRW+ YEED+DM+L+RFN+PHLS +S+ GL  F+  FK G A   C      D+L T S+ + +S  F   E+ +IRNAL+L H+H G  L ST  +     ++ E+Q FE NE     I  R+  S  ++ E   R  S+ +L + L   +E   +QVG L + +   SLF+RLD P+  +GL +  CPLR I+I+FGPK+ E+EL+EVGRVF IM++N EFRE+ Y AE+K +++ A+K F+++S +V + + IT++ L   LPQLK+YAN    EQ+QK L +    IY + +       KD +N +I  N         N  D KAS  +  +  K E +  +      +   P   Q+ +D+KG KERY+SDF+D F  EN   +F G++F YFVVLSPAITFGALFN L+S  M+++M LVSSG FQL Y L++GQPLE+VG+T  V++VE+VL  L+  L I LE+MRFWIG+Y+SILGF+F+M NG II+  FRRSVEEVYNF+  II++LSALFTMFKALPY Y   +     N TL   ER +F  GGTTLF+A LMLNFCL LV+I RG + R   R LLG+FNVPLGIIL+ A+  IFF AF+MPTLS+P SN+IN S+W+N P F  + + S +   +CF I +++F +L+VEV+TNSISVTK ERKL K ++++LN F ++ VFP+IS FLGWP+ SGAMVRSNAHC++MAKWS N  PG+  ++IG  EQR+SG++VG LV  SVFLGS L+YIPMA+MYGMFLYMGVMG+ D+V+ +RL NL QRRKHW++HD+LK  P +N+  LV IQ FF+ ILI++  LS+FT Y WT  +FP F+G+YA IRGY LP WPRLNT+LSKMDKKH VKLYDGKK   +  I++DN   +
Sbjct:  214 SRIPQLFVEFDCLQVNPLTNTYCWIEKSRWLRYEEDYDMDLKRFNSPHLSAMSLIGLTNFRKFFKQGEAILNCQSEKYTDILKTLSDQITKSGNFTIQEIADIRNALVLRHYHAGDQLRSTASDTSMFKYDYERQIFEVNE--AAQITNRK-WSMASMYEGGPRKLSRTRLVDRLDPNTEALSVQVGALDSFKHIFSLFVRLDPPIRAEGLNEVNCPLRFIYILFGPKALEDELMEVGRVFSIMMANPEFREIGYSAETKEEILEATKTFLQHSVIVPITKMITNDALSAMLPQLKHYANYFLNEQNQKTLDDFKKEIYNKNQEIVINQCKDGVNRKISVNTSAINQAHLNEMDGKASLAISTSPIKPEKTSVRIKKCCFQFCPPFK-QMILDVKGLKERYVSDFKDAFLAENISTVFIGMIFIYFVVLSPAITFGALFNTLISKKMSVSMCLVSSGFFQLFYTLMSGQPLEVVGITGPVYVVEKVLGLLSTDLKIELEVMRFWIGIYVSILGFIFSMCNGVIIIKHFRRSVEEVYNFFVGIIFILSALFTMFKALPYQYIPINEVYMSNITLIEKERFRFARGGTTLFMAFLMLNFCLMLVQIKRGSFFRRQIRNLLGSFNVPLGIILIVAIERIFFQAFQMPTLSVPPSNQINTSIWINPPRFESVANASRSAHLFCFAISLSLFFILIVEVSTNSISVTKSERKLAKASMFSLNFFYILVVFPLISAFLGWPYVSGAMVRSNAHCIAMAKWSLNNLPGVSPKVIGAAEQRVSGILVGTLVLLSVFLGSALRYIPMAAMYGMFLYMGVMGVRDLVVTRRLKNLFQRRKHWHQHDFLKDYPTFNLLILVAIQGFFIAILIVLNCLSEFTKYSWTPLIFPFFIGLYAFIRGYILPLWPRLNTYLSKMDKKHPVKLYDGKKPAEQIIIIKDNTGVN 1144          
BLAST of slc4a-7 vs. Planmine SMEST
Match: SMESG000049796.1 (SMESG000049796.1)

HSP 1 Score: 372.859 bits (956), Expect = 1.988e-108
Identity = 244/781 (31.24%), Postives = 412/781 (52.75%), Query Frame = 3
Query:  792 LPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALV-----HLNRRITHEILVH--------CLPQLKYYANKS-----HT-------EQHQKHLQNIYEEEKRESTTDNKDI---------NIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXX--------YQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKAL----PY-FYTLYSPAE-NSTLYINER-----DKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFN--AFRMPTLSIPDSNKINISMWVNIPDFSKLT-SLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRTXXXXXXXXXXXXXXXXXXSQFTTYVWTLFLFPIFVGIYAMIRGYALPRWPRLNTHLSKMDKKHFVKL 2966
            LP  +EG  +QVG LP +++     +R   P+  + + +   P+R + +  GP  R +   E+GRV   M+ N++FR M+YRA  K ++I    ++++   ++     H  R I H ++ H        C       +NK      H+       EQH + ++ I  ++ R+   D             + +   + N  D    +++ T K +E   S K+          F          L +DL   ++R+LSDF DG  K+N  I+  G+++ YFV LSPA+TFGAL  +LVS   ++ ++L S G   +L+ L+ G PL ++G+T  +F++E V+  +A++  IP+ + RF + +Y S++G +    N   I+ + RRSVEE +N +  + ++  ++ T+ +      PY F T  S  E NST  IN+      ++  IG  +L +A  M   C+ L  + RG +     RK++  FNV +GI++++ +N +F N     +PTL    +N    + W+ +P   + T S+        FL+   +  +   E A   I+VT+ +RKL K  L+A + F  + V P+IS   GWPF SGA VRS++H ++M KW     PG+  +I+G  EQR++ +IVG LV  +V +  +L YIP ++M GMFLYMGVMGI D+V+ +RL+ + +R+KHW +H+YL+ IP   ++   I+QL  +I++  +  +++F    W  FL P  + ++A+ R   LPR      HL K+D +H + +
Sbjct:  910 LPNNTEGVTVQVGELPALKKPFLGIIRFKTPLLMEKVSELNLPIRFMIVCLGPVGRVK-YEELGRVIATMMINKDFRRMIYRATDKYEIIEGLYKYLDTCFVLSYSGPHPARNI-HTMVDHINDFSKLQCNVTPLRTSNKETESIKHSASVNWADEQHSQLIRRIDHQKSRDLNFDGDHQISCKKLEYDDDKTASSCNKSDAFLVNMVFTDKLDEYDSSTKLKKIPLVNASVFDCVTFFLFRLLKLDLISFQQRFLSDFYDGMKKDNIVIVLCGLLYLYFVCLSPALTFGALLGELVSDKFSVQLVLASQGALLILFSLLGGNPLLVIGITGPMFLMESVIGKMAVNFDIPILIYRFIVAMYCSLIGLISLAINITWIMQKVRRSVEECFNAFVGLYFIFKSILTILRIFTIPDPYLFATNVSSLELNSTEIINKSHYLYMNRIPIGLASLVMAYSMYQICIALNGVKRGRFFTRKIRKMIDYFNVAIGILVLSMVNLLFLNMLGVSLPTLKAEGNN----TDWIKLPHLMEYTPSIPVTAHMIAFLLAFALLSLAFTETAIAGITVTRQDRKLTKPNLFAQDQFLCLCVIPLISGLFGWPFVSGAAVRSSSHVIAMTKWDQKVIPGVRHKILGVVEQRLTLLIVGGLVLATVLVEPLLNYIPTSAMLGMFLYMGVMGIRDLVVTRRLIAMFKRQKHWKDHEYLRDIPPPVLKAFEILQLGMIILMFSMNCITEFAGVSWCSFLIPALLLLFAVCREIVLPRIVWFKNHLDKLDPRHVIHI 1684          
BLAST of slc4a-7 vs. Planmine SMEST
Match: SMESG000049796.1 (SMESG000049796.1)

HSP 1 Score: 363.999 bits (933), Expect = 2.039e-105
Identity = 244/794 (30.73%), Postives = 413/794 (52.02%), Query Frame = 3
Query:  792 LPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALV-----HLNRRITHEILVH--------CLPQLKYYANKS-----HT-------EQHQKHLQNIYEEEKRESTTDNKDI---------NIEIGPNFNNKDKASFDVLETQKKEEXXXXXXXXXXXXXXXXXX--------YQLYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKAL----PY-FYTLYSPAE-NSTLYINER-----DKFGIGGTTXXXXXXXXXXXXXXVKINRGIYL-------------RHTFRKLLGAFNVPLGIILVTALNYIFFN--AFRMPTLSIPDSNKINISMWVNIPDFSKLT-SLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRTXXXXXXXXXXXXXXXXXXSQFTTYVWTLFLFPIFVGIYAMIRGYALPRWPRLNTHLSKMDKKHFVKL 2966
            LP  +EG  +QVG LP +++     +R   P+  + + +   P+R + +  GP  R +   E+GRV   M+ N++FR M+YRA  K ++I    ++++   ++     H  R I H ++ H        C       +NK      H+       EQH + ++ I  ++ R+   D             + +   + N  D    +++ T K +E   S K+          F          L +DL   ++R+LSDF DG  K+N  I+  G+++ YFV LSPA+TFGAL  +LVS   ++ ++L S G   +L+ L+ G PL ++G+T  +F++E V+  +A++  IP+ + RF + +Y S++G +    N   I+ + RRSVEE +N +  + ++  ++ T+ +      PY F T  S  E NST  IN+      ++  IG  +L +A  M   C+ L  + RG +              +   RK++  FNV +GI++++ +N +F N     +PTL    +N    + W+ +P   + T S+        FL+   +  +   E A   I+VT+ +RKL K  L+A + F  + V P+IS   GWPF SGA VRS++H ++M KW     PG+  +I+G  EQR++ +IVG LV  +V +  +L YIP ++M GMFLYMGVMGI D+V+ +RL+ + +R+KHW +H+YL+ IP   ++   I+QL  +I++  +  +++F    W  FL P  + ++A+ R   LPR      HL K+D +H + +
Sbjct:  910 LPNNTEGVTVQVGELPALKKPFLGIIRFKTPLLMEKVSELNLPIRFMIVCLGPVGRVK-YEELGRVIATMMINKDFRRMIYRATDKYEIIEGLYKYLDTCFVLSYSGPHPARNI-HTMVDHINDFSKLQCNVTPLRTSNKETESIKHSASVNWADEQHSQLIRRIDHQKSRDLNFDGDHQISCKKLEYDDDKTASSCNKSDAFLVNMVFTDKLDEYDSSTKLKKIPLVNASVFDCVTFFLFRLLKLDLISFQQRFLSDFYDGMKKDNIVIVLCGLLYLYFVCLSPALTFGALLGELVSDKFSVQLVLASQGALLILFSLLGGNPLLVIGITGPMFLMESVIGKMAVNFDIPILIYRFIVAMYCSLIGLISLAINITWIMQKVRRSVEECFNAFVGLYFIFKSILTILRIFTIPDPYLFATNVSSLELNSTEIINKSHYLYMNRIPIGLASLVMAYSMYQICIALNGVKRGRFFTRKRLIETIERISQAMIRKMIDYFNVAIGILVLSMVNLLFLNMLGVSLPTLKAEGNN----TDWIKLPHLMEYTPSIPVTAHMIAFLLAFALLSLAFTETAIAGITVTRQDRKLTKPNLFAQDQFLCLCVIPLISGLFGWPFVSGAAVRSSSHVIAMTKWDQKVIPGVRHKILGVVEQRLTLLIVGGLVLATVLVEPLLNYIPTSAMLGMFLYMGVMGIRDLVVTRRLIAMFKRQKHWKDHEYLRDIPPPVLKAFEILQLGMIILMFSMNCITEFAGVSWCSFLIPALLLLFAVCREIVLPRIVWFKNHLDKLDPRHVIHI 1697          
BLAST of slc4a-7 vs. Planmine SMEST
Match: SMESG000049796.1 (SMESG000049796.1)

HSP 1 Score: 337.806 bits (865), Expect = 1.495e-96
Identity = 191/538 (35.50%), Postives = 314/538 (58.36%), Query Frame = 3
Query: 1395 LYIDLKGNKERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNMTITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIPLELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLSALFTMFKAL----PY-FYTLYSPAE-NSTLYINER-----DKFGIGGTTXXXXXXXXXXXXXXVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFN--AFRMPTLSIPDSNKINISMWVNIPDFSKLT-SLSTADQGYCFLIGITMFIMLVVEVATNSISVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCLSMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMASMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRTXXXXXXXXXXXXXXXXXXSQFTTYVWTLFLFPIFVGIYAMIRGYALPRWPRLNTHLSKMDKKHFVKL 2966
            L +DL   ++R+LSDF DG  K+N  I+  G+++ YFV LSPA+TFGAL  +LVS   ++ ++L S G   +L+ L+ G PL ++G+T  +F++E V+  +A++  IP+ + RF + +Y S++G +    N   I+ + RRSVEE +N +  + ++  ++ T+ +      PY F T  S  E NST  IN+      ++  IG  +L +A  M   C+ L  + RG +     RK++  FNV +GI++++ +N +F N     +PTL    +N    + W+ +P   + T S+        FL+   +  +   E A   I+VT+ +RKL K  L+A + F  + V P+IS   GWPF SGA VRS++H ++M KW     PG+  +I+G  EQR++ +IVG LV  +V +  +L YIP ++M GMFLYMGVMGI D+V+ +RL+ + +R+KHW +H+YL+ IP   ++   I+QL  +I++  +  +++F    W  FL P  + ++A+ R   LPR      HL K+D +H + +
Sbjct: 1183 LKLDLISFQQRFLSDFYDGMKKDNIVIVLCGLLYLYFVCLSPALTFGALLGELVSDKFSVQLVLASQGALLILFSLLGGNPLLVIGITGPMFLMESVIGKMAVNFDIPILIYRFIVAMYCSLIGLISLAINITWIMQKVRRSVEECFNAFVGLYFIFKSILTILRIFTIPDPYLFATNVSSLELNSTEIINKSHYLYMNRIPIGLASLVMAYSMYQICIALNGVKRGRFFTRKIRKMIDYFNVAIGILVLSMVNLLFLNMLGVSLPTLKAEGNN----TDWIKLPHLMEYTPSIPVTAHMIAFLLAFALLSLAFTETAIAGITVTRQDRKLTKPNLFAQDQFLCLCVIPLISGLFGWPFVSGAAVRSSSHVIAMTKWDQKVIPGVRHKILGVVEQRLTLLIVGGLVLATVLVEPLLNYIPTSAMLGMFLYMGVMGIRDLVVTRRLIAMFKRQKHWKDHEYLRDIPPPVLKAFEILQLGMIILMFSMNCITEFAGVSWCSFLIPALLLLFAVCREIVLPRIVWFKNHLDKLDPRHVIHI 1716          

HSP 2 Score: 64.3142 bits (155), Expect = 6.125e-10
Identity = 30/98 (30.61%), Postives = 55/98 (56.12%), Query Frame = 3
Query:  792 LPTGSEGALIQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEELLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVE 1085
            LP  +EG  +QVG LP +++     +R   P+  + + +   P+R + +  GP  R +   E+GRV   M+ N++FR M+YRA  K ++I    ++++
Sbjct:  910 LPNNTEGVTVQVGELPALKKPFLGIIRFKTPLLMEKVSELNLPIRFMIVCLGPVGRVK-YEELGRVIATMMINKDFRRMIYRATDKYEIIEGLYKYLD 1006          
The following BLAST results are available for this feature:
BLAST of slc4a-7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC4A11.059e-6123.96solute carrier family 4 member 1 (Diego blood grou... [more]
SLC4A23.214e-6023.16solute carrier family 4 member 2 [Source:HGNC Symb... [more]
SLC4A24.290e-6023.16solute carrier family 4 member 2 [Source:HGNC Symb... [more]
SLC4A24.427e-6023.16solute carrier family 4 member 2 [Source:HGNC Symb... [more]
SLC4A24.427e-6023.16solute carrier family 4 member 2 [Source:HGNC Symb... [more]
back to top
BLAST of slc4a-7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abts-12.528e-3021.22Anion exchange protein [Source:UniProtKB/TrEMBL;A... [more]
abts-13.073e-3021.22Anion exchange protein [Source:UniProtKB/TrEMBL;A... [more]
abts-47.646e-2921.50Anion/Bicarbonate TranSporter family [Source:UniP... [more]
abts-49.932e-2821.47Anion/Bicarbonate TranSporter family [Source:UniP... [more]
abts-41.322e-2721.47Anion/Bicarbonate TranSporter family [Source:UniP... [more]
back to top
BLAST of slc4a-7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG81772.447e-5323.08gene:FBgn0036043 transcript:FBtr0076322[more]
CG81773.613e-5323.08gene:FBgn0036043 transcript:FBtr0076326[more]
CG81773.791e-5323.29gene:FBgn0036043 transcript:FBtr0331848[more]
CG81774.401e-5323.08gene:FBgn0036043 transcript:FBtr0076325[more]
CG81774.401e-5323.08gene:FBgn0036043 transcript:FBtr0076324[more]
back to top
BLAST of slc4a-7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc4a2a3.241e-7024.42solute carrier family 4 member 2a [Source:ZFIN;Acc... [more]
slc4a2b3.262e-6723.50solute carrier family 4 member 2b [Source:ZFIN;Acc... [more]
slc4a35.281e-6024.39solute carrier family 4 member 3 [Source:ZFIN;Acc:... [more]
slc4a4b2.345e-5623.69solute carrier family 4 member 4b [Source:ZFIN;Acc... [more]
slc4a1b1.722e-5522.74solute carrier family 4 member 1b (Diego blood gro... [more]
back to top
BLAST of slc4a-7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc4a36.471e-6422.80solute carrier family 4 (anion exchanger), member ... [more]
SLC4A11.460e-6224.03solute carrier family 4 member 1 (Diego blood grou... [more]
SLC4A12.007e-6224.03solute carrier family 4 member 1 (Diego blood grou... [more]
SLC4A11.108e-6124.28solute carrier family 4 member 1 (Diego blood grou... [more]
slc4a32.086e-6022.36solute carrier family 4 (anion exchanger), member ... [more]
back to top
BLAST of slc4a-7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc4a26.516e-5923.27solute carrier family 4 (anion exchanger), member ... [more]
Slc4a28.160e-5923.27solute carrier family 4 (anion exchanger), member ... [more]
Slc4a21.087e-5823.27solute carrier family 4 (anion exchanger), member ... [more]
Slc4a33.923e-5522.40solute carrier family 4 (anion exchanger), member ... [more]
Slc4a13.329e-4824.77solute carrier family 4 (anion exchanger), member ... [more]
back to top
BLAST of slc4a-7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P04920|B3A2_HUMAN2.126e-5923.16Anion exchange protein 2 OS=Homo sapiens OX=9606 G... [more]
sp|Q6SJP2|B3A2_HORSE9.124e-5923.71Anion exchange protein 2 OS=Equus caballus OX=9796... [more]
sp|P23562|B3AT_RAT2.048e-5823.61Band 3 anion transport protein OS=Rattus norvegicu... [more]
sp|P13808|B3A2_MOUSE7.948e-5823.27Anion exchange protein 2 OS=Mus musculus OX=10090 ... [more]
sp|P15575|B3AT_CHICK1.180e-5723.82Band 3 anion transport protein OS=Gallus gallus OX... [more]
back to top
BLAST of slc4a-7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF420.000e+0100.00Slc4a-7 OS=Schmidtea mediterranea OX=79327 GN=slc4... [more]
A0A4S2LWF62.694e-15733.40Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LVH02.208e-15633.91Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A3R7CGM71.135e-15233.30Band 3 anion transport protein (Fragment) OS=Clono... [more]
A0A5K4F3N96.930e-14632.79Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of slc4a-7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc4a2a1.018e-7024.13anion exchange protein 2-like [Source:NCBI gene;Ac... [more]
slc4a2a1.495e-7024.16anion exchange protein 2-like [Source:NCBI gene;Ac... [more]
slc4a2b2.450e-6924.23anion exchange protein 2-like [Source:NCBI gene;Ac... [more]
slc4a2b2.855e-6924.23anion exchange protein 2-like [Source:NCBI gene;Ac... [more]
slc4a2b4.072e-6924.12anion exchange protein 2-like [Source:NCBI gene;Ac... [more]
back to top
BLAST of slc4a-7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC4A22.808e-7324.63solute carrier family 4 member 2 [Source:HGNC Symb... [more]
SLC4A22.740e-6523.05solute carrier family 4 member 2 [Source:HGNC Symb... [more]
SLC4A42.053e-2324.72solute carrier family 4 member 4 [Source:HGNC Symb... [more]
SLC4A41.286e-2224.40solute carrier family 4 member 4 [Source:HGNC Symb... [more]
slc4a75.877e-2220.69solute carrier family 4 member 7 [Source:ZFIN;Acc:... [more]
back to top
BLAST of slc4a-7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BOR17.993e-725.00Boron efflux transporter of the plasma membrane; b... [more]
back to top
BLAST of slc4a-7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO458441.457e-5221.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317935.135e-4920.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406102.199e-922.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO270898.588e-825.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc4a-7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc4a2b1.266e-6423.43anion exchange protein 2 [Source:NCBI gene;Acc:101... [more]
slc4a31.328e-6423.98solute carrier family 4 member 3 [Source:NCBI gene... [more]
slc4a2b1.337e-6423.43anion exchange protein 2 [Source:NCBI gene;Acc:101... [more]
slc4a2b2.286e-6423.43anion exchange protein 2 [Source:NCBI gene;Acc:101... [more]
slc4a2b2.286e-6423.43anion exchange protein 2 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of slc4a-7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063821.10.000e+099.70SMESG000063821.1[more]
SMESG000020434.10.000e+051.76SMESG000020434.1[more]
SMESG000049796.11.988e-10831.24SMESG000049796.1[more]
SMESG000049796.12.039e-10530.73SMESG000049796.1[more]
SMESG000049796.11.495e-9635.50SMESG000049796.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30017190
GenBankAKN21412.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017190 ID=SMED30017190|Name=slc4a-7|organism=Schmidtea mediterranea sexual|type=transcript|length=3213bp
TTGTATTTAACTGAAGTCAAATTTGCTAGATTAACATTAGTAATATCTAG
AATATTTATTATCATTTTATGCATCATCAAAAAATTAGCGCAGACAATCC
GGTTTATGAGGAAGACGAGAACGAAATAAAGGACGACCAACCTGACTCGG
AAGTAGCTGGAGGAGAACTGAAACAATGGAGGAACTCAATCGAACAGGAA
GGAGATATGAGTTTTCATGATCAACCTATCTATATGAAAAAGGAAAGTTC
AGCTACAACTATTTGCCAGACGTCAGTTCCAGATTTACTGATTGAATTGG
ATATCTTGTACCTGAATCCACGCACAAATTCGTATTGCTGGACTGAGAAA
TCAAGATGGATAATTTACGAAGAAGATTTCGACATGGAGCTTAGACGATT
CAACAACCCACACCTATCAACCCTATCAGTGAGGGGATTGAAATTTTTCA
AAGATTTATTCAAAGATGGATACGCAAATTTTAAATGCGACGTAAGAAAT
AATATCGATGTGTTGAACACGTATTCGGAATCCGTCGAACAGTCAAATCG
CTTTAACAAAGATGAATTAAAGGAAATCAGAAATGCTCTAATCCTTAACC
ATTTCCACGTTGGGATGCATTTATCTTCCACGATCCACGAGTGCCCCACA
ATCCATTTCAATGAAGAAAAACAATGTTTCGAGACGAATGAAAATTACAT
CCCTCACATAGGCCGGAGACGAAATCGGTCATCTATAACATTGAATGAGA
ATATGCACAGAGTGCAAAGTCAAAAAAAGTTAAGTGAATGCCTGCCTACT
GGATCAGAAGGAGCATTAATCCAAGTTGGCATATTGCCTACAATCGAAAG
AACTCATTCACTTTTCATGAGATTAGACCAACCAGTTTATGAGGATGGTT
TATTGGACACATACTGTCCGTTACGGATTATATTTATAATTTTTGGACCA
AAATCTCGGGAAGAAGAGTTACTGGAAGTTGGTCGAGTGTTTGGGATTAT
GTTGTCTAATAGGGAATTTCGTGAAATGGTTTATCGGGCAGAATCCAAAC
TTGATGTCATTTCTGCATCAAAACAATTTGTCGAAAATTCCGCATTGGTT
CATCTCAACCGTAGAATTACCCATGAAATATTGGTCCACTGTTTGCCACA
GCTCAAATACTATGCCAACAAAAGCCATACAGAACAACATCAGAAACATT
TACAAAATATATATGAAGAAGAAAAGAGAGAATCTACAACTGATAATAAG
GACATCAATATTGAAATCGGGCCAAATTTTAACAATAAAGATAAAGCTTC
GTTTGATGTTTTGGAAACCCAGAAAAAAGAGGAGCCAAGTTGTTCAAAGA
AAGTTGTTTCGACAGTTAAAAAATTTTTCCCTCCATTTTACCAATTGTAT
ATCGATTTGAAAGGAAATAAAGAAAGATATTTGTCGGATTTCCGAGACGG
CTTTACCAAGGAAAACGCACCAATCATTTTTACAGGAATTGTTTTTGCGT
ATTTCGTCGTTCTTTCACCTGCAATCACTTTTGGAGCTTTATTCAATAAA
CTTGTATCACCGAATATGACAATAACAATGCTGCTCGTGTCCAGTGGTAC
CTTTCAACTGCTCTATGTTCTAATAAATGGGCAGCCGCTTGAGATTGTCG
GAGTCACTCCTACGGTTTTTATAGTGGAACAAGTTCTTGCATCACTTGCC
ATATCTCTAGGGATACCGTTAGAGTTGATGAGGTTTTGGATTGGGGTATA
TCTTTCTATTCTTGGATTTGTCTTCACCATGTTCAACGGTGCAATCATCG
TTCCTCAATTTCGCCGATCAGTAGAAGAAGTCTATAATTTTTATTATAGT
ATAATTTATCTTCTCTCCGCTCTATTTACAATGTTTAAGGCTCTTCCATA
TTTCTACACTCTTTATAGTCCAGCCGAAAATTCAACTCTTTACATTAACG
AAAGAGACAAGTTTGGCATTGGAGGAACAACTTTATTTCTTGCTCTTTTA
ATGCTAAATTTTTGTTTGTATCTCGTCAAAATTAACCGAGGTATTTATCT
AAGGCATACATTTCGGAAACTTCTCGGAGCTTTCAATGTTCCGCTGGGAA
TAATTCTGGTTACGGCATTGAATTACATATTTTTTAACGCATTTCGTATG
CCAACTTTGAGTATACCAGACAGTAACAAAATTAACATCAGCATGTGGGT
CAATATTCCAGATTTCTCCAAATTGACTTCTTTAAGTACGGCGGACCAAG
GATACTGCTTTCTGATAGGCATTACCATGTTTATCATGCTAGTGGTGGAA
GTAGCCACAAATTCGATTTCAGTAACAAAGGTTGAAAGAAAGTTAAAGAA
GAAAACATTATATGCTCTAAATATGTTTTGCCTTATTACAGTGTTTCCAA
TCATTTCTATTTTCCTCGGATGGCCCTTCTTTTCTGGTGCAATGGTACGG
TCAAATGCTCACTGCTTATCCATGGCAAAATGGAGTGCCAATGCTGCCCC
TGGAATTCCTAAAAGGATCATTGGGCATTGCGAACAAAGGATCTCTGGAA
TGATAGTTGGAATACTAGTGTTTTGTTCGGTCTTTTTGGGATCAATATTA
AAATACATTCCAATGGCGTCAATGTACGGAATGTTTTTATACATGGGGGT
GATGGGAATCAGTGACATGGTTTTGTGGAAAAGATTGGTCAACTTAATGC
AGCGCAGAAAACATTGGAATGAACATGATTATTTAAAAGGAATTCCTCTC
TGGAACATACGAACATTAGTTATTATCCAACTGTTCTTTGTTATCATTTT
AATTATTATCTACGTACTTTCTCAATTCACAACATATGTTTGGACATTAT
TCTTGTTCCCGATATTTGTTGGTATATATGCAATGATACGAGGCTACGCG
TTGCCACGTTGGCCAAGACTAAACACACACTTATCCAAGATGGACAAAAA
ACACTTTGTCAAATTGTATGATGGAAAAAAAGTTAAATCTGAAGCTGAGA
TAGTGCAGGATAATCAAGCTTTTGATCCAGAAAACAATGAAGATTCCTCA
AATAGTTCCGAAGAAGAATCTGGAATATATTGAAGAATAAAAACACATTT
TCTTACTAACATTGCTCCTTCAAAATTCATATTTTTAATAAACAATAACT
TTACTTCTAATAATATTTTCTGGCTTATGTAGAAAGATCGCAGAGTGAAA
GTTTATAATAATT
back to top

protein sequence of SMED30017190-orf-1

>SMED30017190-orf-1 ID=SMED30017190-orf-1|Name=SMED30017190-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1005bp
MHHQKISADNPVYEEDENEIKDDQPDSEVAGGELKQWRNSIEQEGDMSFH
DQPIYMKKESSATTICQTSVPDLLIELDILYLNPRTNSYCWTEKSRWIIY
EEDFDMELRRFNNPHLSTLSVRGLKFFKDLFKDGYANFKCDVRNNIDVLN
TYSESVEQSNRFNKDELKEIRNALILNHFHVGMHLSSTIHECPTIHFNEE
KQCFETNENYIPHIGRRRNRSSITLNENMHRVQSQKKLSECLPTGSEGAL
IQVGILPTIERTHSLFMRLDQPVYEDGLLDTYCPLRIIFIIFGPKSREEE
LLEVGRVFGIMLSNREFREMVYRAESKLDVISASKQFVENSALVHLNRRI
THEILVHCLPQLKYYANKSHTEQHQKHLQNIYEEEKRESTTDNKDINIEI
GPNFNNKDKASFDVLETQKKEEPSCSKKVVSTVKKFFPPFYQLYIDLKGN
KERYLSDFRDGFTKENAPIIFTGIVFAYFVVLSPAITFGALFNKLVSPNM
TITMLLVSSGTFQLLYVLINGQPLEIVGVTPTVFIVEQVLASLAISLGIP
LELMRFWIGVYLSILGFVFTMFNGAIIVPQFRRSVEEVYNFYYSIIYLLS
ALFTMFKALPYFYTLYSPAENSTLYINERDKFGIGGTTLFLALLMLNFCL
YLVKINRGIYLRHTFRKLLGAFNVPLGIILVTALNYIFFNAFRMPTLSIP
DSNKINISMWVNIPDFSKLTSLSTADQGYCFLIGITMFIMLVVEVATNSI
SVTKVERKLKKKTLYALNMFCLITVFPIISIFLGWPFFSGAMVRSNAHCL
SMAKWSANAAPGIPKRIIGHCEQRISGMIVGILVFCSVFLGSILKYIPMA
SMYGMFLYMGVMGISDMVLWKRLVNLMQRRKHWNEHDYLKGIPLWNIRTL
VIIQLFFVIILIIIYVLSQFTTYVWTLFLFPIFVGIYAMIRGYALPRWPR
LNTHLSKMDKKHFVKLYDGKKVKSEAEIVQDNQAFDPENNEDSSNSSEEE
SGIY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000047collecting duct
PLANA:0000054dorsal region of the epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
Vocabulary: INTERPRO
TermDefinition
IPR003020HCO3_transpt_euk
IPR011531HCO3_transpt_C
IPR013769Band3_cytoplasmic_dom
IPR016152PTrfase/Anion_transptr
Vocabulary: biological process
TermDefinition
GO:0006820anion transport
GO:0006810transport
GO:0015698inorganic anion transport
GO:0098656anion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0008509anion transmembrane transporter activity
GO:0005215transporter activity
GO:0005452inorganic anion exchanger activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.287.570coord: 451..494
e-value: 3.0E-8
score: 35.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 983..1004
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 979..1004
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..31
NoneNo IPR availableCDDcd06179MFS_TRI12_likecoord: 500..692
e-value: 0.00338887
score: 38.7616
NoneNo IPR availableTMHMMTMhelixcoord: 556..578
NoneNo IPR availableTMHMMTMhelixcoord: 894..916
NoneNo IPR availableTMHMMTMhelixcoord: 825..844
NoneNo IPR availableTMHMMTMhelixcoord: 633..655
NoneNo IPR availableTMHMMTMhelixcoord: 764..786
NoneNo IPR availableTMHMMTMhelixcoord: 923..945
NoneNo IPR availableTMHMMTMhelixcoord: 668..690
NoneNo IPR availableTMHMMTMhelixcoord: 514..536
NoneNo IPR availableTMHMMTMhelixcoord: 851..870
NoneNo IPR availableTMHMMTMhelixcoord: 591..613
NoneNo IPR availableTMHMMTMhelixcoord: 730..752
NoneNo IPR availableTMHMMTMhelixcoord: 471..493
IPR016152Phosphotransferase/anion transporterGENE3DG3DSA:3.40.930.10coord: 68..380
e-value: 1.6E-50
score: 174.0
IPR016152Phosphotransferase/anion transporterSUPERFAMILYSSF55804Phoshotransferase/anion transport proteincoord: 73..343
IPR013769Band 3 cytoplasmic domainPFAMPF07565Band_3_cytocoord: 108..342
e-value: 5.7E-22
score: 78.8
IPR011531Bicarbonate transporter, C-terminalPFAMPF00955HCO3_cotranspcoord: 438..611
e-value: 1.1E-28
score: 100.3
coord: 639..899
e-value: 1.0E-46
score: 159.9
IPR003020Bicarbonate transporter, eukaryoticPANTHERPTHR11453ANION EXCHANGE PROTEINcoord: 73..981