Dynein regulatory complex protein 1

Overview
NameDynein regulatory complex protein 1
Smed IDSMED30017180
Uniprot Best hitDynein regulatory complex protein 1 OS=Xenopus laevis OX=8355 GN=drc1 PE=2 SV=1 (E=5.57012e-163)
Length (bp)2420
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein regulatory complex protein 1 (SMED30017180) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein regulatory complex protein 1 (SMED30017180) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein regulatory complex protein 1 (SMED30017180) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein regulatory complex protein 1 (SMED30017180) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017180

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30017180SMESG000072168.1 SmedASXL_013388SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30017180SMESG000072168.1 dd_Smed_v4_8761_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30017180SMESG000072168.1 dd_Smed_v4_8761_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30017180SMESG000072168.1 dd_Smed_v4_8761_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30017180SMESG000072168.1 dd_Smed_v4_8761_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30017180SMESG000072168.1 dd_Smed_v4_8761_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30017180SMESG000072168.1 dd_Smed_v6_8761_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30017180SMESG000072168.1 dd_Smed_v4_8761_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30017180SMESG000072168.1 dd_Smed_v4_8761_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Human
Match: DRC1 (dynein regulatory complex subunit 1 [Source:HGNC Symbol;Acc:HGNC:24245])

HSP 1 Score: 444.506 bits (1142), Expect = 1.674e-144
Identity = 314/740 (42.43%), Postives = 445/740 (60.14%), Query Frame = 1
Query:   97 HVEDEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGE-LDSDKDKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNEDSSNEAATSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDD----INRMLPYFVIQLSN-----PDSMAAQARI------TEDVFQLVQN--------ESLCKN-------------VIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQL 2205
            H+  ++  PS+ S+N +ERI+ RRLRI  RLE +RR   GE LD  K+   + SKS KQ E SR++L KL   G E +TN++VA D RE  RR E+EE+ R R EKLEN  KT  D+F+EIT KWE   QK +PQ+L EML  Q   C  ++++KNKLI+ELQ E K KDD YVK+LKKQSDD+ L++ RM EQ+  + + ++EEL  +EKAF  +R +L+    K+W + L +   K+++YL+ R K+V++ + Q++  R    EEYN +KIKLE +VQ+LEQ +Q  KA +QLN EKLEYN QVLKKRDEE+T+ KSQQKRKI R+ D LNNL+ K  K  +Q + +N+ LT DYKR +  F+ELQ+  R     D + F EIWLMNE + ++   +    DRII    LGL W +P+  FL N GP+  + +    KSAT+++ E+L + E        +  E+         + +   T + +L L+CDE  FLIE KL  LL PL +NE  L++LDAIF+ALGIE+EDD    +N  L Y   +LS+     P S A+  +       T    +L +         ESL +              VIHP  +++ L  FV    +   +    L  Q+         + RD+S D+EYW +    +I  +K+ +WDAL  +LEKY  +LT R KLL +  + + QN EL+ LLQQY++S +N ELQVPP++V+++
Sbjct:   17 HLSTQILAPSVHSDNSQERIQARRLRIAARLEARRREALGEYLDGKKESEEDQSKSYKQKEESRLKLAKLLLCGTELVTNIQVAIDIREIHRRVEEEEIKRQRIEKLENEVKTSQDKFDEITSKWEEGKQKRIPQELWEMLNTQQLHCAGLLEDKNKLISELQQELKTKDDQYVKDLKKQSDDICLLLERMEEQVKNVMKTFREELYNIEKAFEVERQELLASNKKKWEQALQAHNAKELEYLNNRMKKVEDYEKQLNRQRIWDCEEYNMIKIKLEQDVQILEQQLQQRKAIYQLNQEKLEYNLQVLKKRDEESTVIKSQQKRKINRLHDILNNLRSKYAKQIKQFQEENQSLTSDYKRLVMQFKELQKAMRHFALIDDEKFWEIWLMNEEEAKDLIARAFDVDRIIHTHHLGLPWAAPDFWFLNNVGPISQQPQ----KSATQIVEEMLMRSEEEEAEEAAAEPESYL----DLPKQISEKTTKRILMLLCDESGFLIESKLLSLLLPLEQNECYLLRLDAIFSALGIESEDDLYKLVNFFLKYRAHRLSSSLQIKPCSQASMEKASMEETSTRSELELAEQTEMEGEKEESLVEGEKEEEEETPPSPWVIHPNDVLKILEAFVMGL-KKPRDSRAPLRVQK---------NVRDNSKDSEYW-QALTTVIPSSKQNLWDALYTALEKYHLVLTQRAKLLLENSSLEQQNTELQALLQQYLNSKINSELQVPPTQVLRV 737          
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Human
Match: DRC1 (dynein regulatory complex subunit 1 [Source:HGNC Symbol;Acc:HGNC:24245])

HSP 1 Score: 203.371 bits (516), Expect = 8.673e-59
Identity = 134/280 (47.86%), Postives = 188/280 (67.14%), Query Frame = 1
Query:   97 HVEDEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGE-LDSDKDKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQ 933
            H+  ++  PS+ S+N +ERI+ RRLRI  RLE +RR   GE LD  K+   + SKS KQ E SR++L KL   G E +TN++VA D RE  RR E+EE+ R R EKLEN  KT  D+F+EIT KWE   QK +PQ+L EML  Q   C  ++++KNKLI+ELQ E K KDD YVK+LKKQSDD+ L++ RM EQ+  + + ++EEL  +EKAF  +R +L+    K+W + L +   K+++YL+ R K+V++ + Q++  R    EEYN +KIKLE +VQ
Sbjct:   13 HLSTQILAPSVHSDNSQERIQARRLRIAARLEARRREALGEYLDGKKESEEDQSKSYKQKEESRLKLAKLLLCGTELVTNIQVAIDIREIHRRVEEEEIKRQRIEKLENEVKTSQDKFDEITSKWEEGKQKRIPQELWEMLNTQQLHCAGLLEDKNKLISELQQELKTKDDQYVKDLKKQSDDICLLLERMEEQVKNVMKTFREELYNIEKAFEVERQELLASNKKKWEQALQAHNAKELEYLNNRMKKVEDYEKQLNRQRIWDCEEYNMIKIKLEQDVQ 292          
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Human
Match: DRC1 (dynein regulatory complex subunit 1 [Source:HGNC Symbol;Acc:HGNC:24245])

HSP 1 Score: 65.0846 bits (157), Expect = 5.298e-12
Identity = 39/83 (46.99%), Postives = 54/83 (65.06%), Query Frame = 1
Query:   97 HVEDEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGE-LDSDKDKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRV 342
            H+  ++  PS+ S+N +ERI+ RRLRI  RLE +RR   GE LD  K+   + SKS KQ E SR++L KL   G E +TN++V
Sbjct:   17 HLSTQILAPSVHSDNSQERIQARRLRIAARLEARRREALGEYLDGKKESEEDQSKSYKQKEESRLKLAKLLLCGTELVTNIQV 99          
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Fly
Match: CG10958 (gene:FBgn0030004 transcript:FBtr0071153)

HSP 1 Score: 177.948 bits (450), Expect = 2.360e-46
Identity = 181/707 (25.60%), Postives = 315/707 (44.55%), Query Frame = 1
Query:  163 RRLRIKNRLENQRRLERGELDSDKDKMVEMSKSR--KQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIR---NKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNEDSSNEAATSERSSTIQSLHPSTVRSLLNLI---CDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRM----LPYFVIQLSNPDSMAA---------------------------QARITEDVFQLVQNESL---CKN---VIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQY 2148
            RRL I NR+  Q R    E      +  +  KS   +++ELS  RLN+L   G E +TNVRVA++ RE  RR  +         KL+  +   + RFE I  +W    +   P  L + + +Q      ++  K+++I+  Q E    +  Y  + ++Q+ D+  ++ R++ Q++ +K AYKE +  + +    +R        ++W    D++    +++ + + AR +       QI+    S  E   + +I+LE E + LE  ++  +    +N EKL+YN+QVL+KR+EEN I  +QQKR++ R+ + +   +  L  +    K +  +L+ D  +      +++ K+      + + F  IW +N  ++     ++   DRII EQQL + W SP         P I      KAK     I E        +  N    N     +    I+ L P ++R + NLI    D G FLIEE+L ++LEP  E E  L+++D IF AL I +  D+  +    +PY       P  ++                            + R T D F L ++E     C N   V+ P + + A++ F +  ++   E E        +   +   + R+      +W ++       +K  +W  L   L  Y+ +L  R +   +V   + QN ELR LLQ++
Sbjct:   62 RRLAILNRVRQQFR----EAPKGVAERCQAQKSPIDQRLELSSERLNELVRFGKELVTNVRVANERRELNRRLFEGAQKNQMHVKLQRESVETMARFENIKARWTELEETNEPMLLWDQIEEQKKRIAEIMARKDEMISACQAEVDRMNAKYEFDRERQAQDLCCLVERVDHQVETLKEAYKEHIQMLRQTIEEERQIFADNAVEKWRTFFDAMNANFDEKANLVRAREQFYARQTQQINE---SQEELTKSTRIRLEKECERLELELRRTRDNVLMNSEKLDYNYQVLQKRNEENVIINNQQKRRVARLHEAIGRTRRGLKNLYNTGKRNIARLSSDIYKLHSNINDMESKAHQARLNNREKFDRIWEINYKELNLLVDRVYHIDRIIHEQQLAMPWSSPVPPI-----PNIN-----KAKKKRNNILEKFDMRIGRVPKNRVMPNSGVNCK--PDIKELPPDSLRLMRNLIRKLSDRGGFLIEERLLKILEPYSEEEKCLVRIDNIFAALRIRHLRDVKELTKVFMPYTYCPNCQPQGLSPRKCAEVFMKDQKPNRLQGAAGGQPDEKEHRSTGDTF-LPKSEVAAKRCHNHYLVMEPALCLHAMNLFTSKMHKKMYEHEPGSILNAVNLIQITDAEIRN------FWRQFSA-CFPASKCKLWKTLEHGLNHYVEVLKMRVQYDAEVVFLRRQNEELRHLLQKF 741          
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Zebrafish
Match: drc1 (dynein regulatory complex subunit 1 homolog (Chlamydomonas) [Source:NCBI gene;Acc:100034551])

HSP 1 Score: 385.571 bits (989), Expect = 6.746e-123
Identity = 278/685 (40.58%), Postives = 399/685 (58.25%), Query Frame = 1
Query:  121 PSIDSENMEERIECRRLRIKNRLENQRRLERGELDSDK-DKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNEDSSNEAATSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFVIQLSNPDSMAAQARITEDVFQLVQNESL--CKNVIHPTMIVQALHDFVTDF-YQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSV 2163
            PS++S+  EERI  RRLR+  R E Q +   GE D  K D   E  KS+K+VE    R+ KL  DG+E +TN++VA+DARE+ RR E EE  R+RREKLEN AK+  ++FEEI +KW  A  K+ P DL + L  Q   C  +I +KNKLI+ELQ E KA DD YVK+LK+Q+ D+DL++ RM EQI  +K++Y+E+L ++E +   +R  L+    K+W         K++  +      ++E    +  LR   AEEYN  KI+++TEVQ L   +Q  K    +N EKL+Y ++VLKK++EEN I KSQ KRKI RMQD LNNLK KL K E+Q K  N+ L+ DY R  + ++++Q+K+R     DA+  +++WLM E + +  + + L  DR+I EQQLGL W SP   F+   G +    ++   ++AT+   + LK E            E    E   T   L+  TV+S+L L+CDE  FL+E KL  LL PL +NE SL+KLDAIF+A+GIE+E D+ +M  +F+      +    +++ T+D     Q ES     N+IH   ++ AL DF   F  QD     K+          +  +D RDDS D  YW     N++ ++K  +WDAL  +L KY  +LT R +LL +    + QN+ELR LL  Y +S  
Sbjct:   18 PSVESDKKEERILARRLRLAARKEAQTKQRLGEDDLGKEDVKEETRKSQKEVEHRERRMAKLKSDGLELVTNIQVAADARESDRRTELEEGHRLRREKLENEAKSSQEKFEEINRKWTDAKMKQTPLDLRDALSSQQQLCEQIIADKNKLISELQQELKASDDRYVKDLKRQAKDIDLLVERMEEQISTLKKSYREDLHQIENSLDEERRTLLTKHKKKWEHERKDRNEKELKNMMQSLSVMEEYADLLQKLRVQTAEEYNIDKIRMDTEVQKLRMKVQQTKFNCHMNEEKLDYKYEVLKKKEEENAIIKSQLKRKIIRMQDVLNNLKSKLTKQEKQSKAGNQSLSNDYTRISQQYKDMQKKARHFAALDAERLEKLWLMCEDEAKALTHRALETDRVIHEQQLGLEWASPPLPFMERSGAV----QQKTFRTATQAAADTLKGEP-----------EGGLDE--DTAAGLNKRTVKSILELLCDEMGFLVESKLLMLLSPLEKNEQSLIKLDAIFSAIGIESEKDVYKMAEFFM------NYRQHESKYTKDETANGQGESAEELSNLIHTEDLLAALKDFTAQFCRQDVHASHKS---------SILGLDMRDDSEDAAYWESI-ANVMPESKLKLWDALDTALNKYHAVLTERTELLMETQNIQQQNSELRQLLHLYTTSKA 669          
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Xenopus
Match: DRC1 (dynein regulatory complex subunit 1 [Source:NCBI gene;Acc:100494062])

HSP 1 Score: 411.764 bits (1057), Expect = 9.170e-134
Identity = 254/595 (42.69%), Postives = 366/595 (61.51%), Query Frame = 1
Query:  409 KLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAK--SATEVIREVLKKEESMLKTNEDSSNEAATSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFVIQLSNPDSMAAQARITEDVFQLVQNESLCKNVIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPP 2187
            KL+  AK+ L++F+EITKKW     K+VPQ + E+L  Q   C  +I +KN LI+ELQ E + KDD YVK+LKKQ++D+DL++ RM EQI  + + Y++EL ++EK F  +R +L+     +W + +++ R+K+++ L +R ++V+E + Q+  LR    EEYN +KIKLE +VQVL+Q +Q  KAT+QLN EKLEYN+QVLKKRDEENTITKSQQKRKITR+QD LNNL+LK  K  +Q K +N+ L +DYKR +E ++ELQ+K R     DAK F++IWLMNE ++++  +K L ADRII EQQLG+ W  P   FL N GPL+ +++  K     A EV+     ++ES     +    E       S        TV+ +L L+CDE  FLIE KL RLL PL ++E SL+KLD+IF ALGI  E+D+ +++ +F              R   D           + +IHP  ++ A+  FV +F     +  + + A          ++ RD S D  YW       I +++  VWDAL  +LEKY N+L+ R +L+T+  + + QN ELR LL QY++S V    Q+PP
Sbjct:   22 KLDTEAKSSLEKFDEITKKWALDKPKQVPQKMWEILNSQQQQCAHLIGDKNNLISELQKELRRKDDQYVKDLKKQAEDIDLLVERMEEQIKNLTKTYRQELLQIEKVFELERRELLTANRNKWEQGMEARRDKELETLMSRMRKVEEYEQQLKQLRVQDGEEYNMIKIKLEADVQVLQQQLQQMKATYQLNQEKLEYNYQVLKKRDEENTITKSQQKRKITRLQDVLNNLRLKQAKQVKQYKEENQSLMDDYKRIVEQYKELQKKMRHFSAVDAKMFEDIWLMNEEEMKQLVQKALEADRIIQEQQLGMRWEPPELGFLDNVGPLLAKQKDQKPAITVAQEVMSSNAHRDESPAMLGQSDGRERQGGPAVSA------QTVKHILELLCDESGFLIENKLTRLLSPLDKDERSLIKLDSIFGALGIAVEEDVYKLVEFF-------------CRYKRD----AGGSHGPQGLIHPNEVLGAIKAFVMEF-----QKPRFVTAPPR------LMEERDSSEDATYWAA-AAKAIPESRLRVWDALESALEKYHNVLSGRAQLITETVSLRHQNTELRTLLHQYLNSQVRP--QIPP 579          
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Xenopus
Match: DRC1 (dynein regulatory complex subunit 1 [Source:NCBI gene;Acc:100494062])

HSP 1 Score: 382.104 bits (980), Expect = 3.198e-122
Identity = 246/599 (41.07%), Postives = 362/599 (60.43%), Query Frame = 1
Query:  409 KLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNEDSSNEAATSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFVIQLSNPDSMAAQARITEDVFQLVQNESLCKNVIHPTM------IVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPP 2187
            KL+  AK+ L++F+EITKKW     K+VPQ + E+L  Q   C  +I +KN LI+ELQ E + KDD YVK+LKKQ++D+DL++ RM EQI  + + Y++EL ++EK F  +R +L+     +W + +++ R+K+++ L +R ++V+E + Q+  LR    EEYN +KIKLE +VQVL+Q +Q  KAT+QLN EKLEYN+QVLKKRDEENTITKSQQKRKITR+QD LNNL+LK  K  +Q K +N+ L +DYKR +E ++ELQ+K R     DAK F++IWLMNE ++++  +K L ADRII EQQLG+ W  P   FL N GPL+ +++  K   A  V +EV+     +L         A T +       L   T + L+        FLIE KL RLL PL ++E SL+KLD+IF ALGI  E+D+ +++ +F          +A   +++ +   +     C    H TM      ++  +      F     ++++     +        ++ RD S D  YW       I +++  VWDAL  +LEKY N+L+ R +L+T+  + + QN ELR LL QY++S V    Q+PP
Sbjct:   19 KLDTEAKSSLEKFDEITKKWALDKPKQVPQKMWEILNSQQQQCAHLIGDKNNLISELQKELRRKDDQYVKDLKKQAEDIDLLVERMEEQIKNLTKTYRQELLQIEKVFELERRELLTANRNKWEQGMEARRDKELETLMSRMRKVEEYEQQLKQLRVQDGEEYNMIKIKLEADVQVLQQQLQQMKATYQLNQEKLEYNYQVLKKRDEENTITKSQQKRKITRLQDVLNNLRLKQAKQVKQYKEENQSLMDDYKRIVEQYKELQKKMRHFSAVDAKMFEDIWLMNEEEMKQLVQKALEADRIIQEQQLGMRWEPPELGFLDNVGPLLAKQKDQKP--AITVAQEVMSSNGELL---------ALTGQLLGQTGQLLGQTGQLLVL------GFLIENKLTRLLSPLDKDERSLIKLDSIFGALGIAVEEDVYKLVEFFC---RYKRERSATKPVSDQLNSPLSLPIACTERYHKTMAHRDSPVLSTIQQEQPPFSGIHNQIKRCCVGFRERTAPPRLMEERDSSEDATYWAA-AAKAIPESRLRVWDALESALEKYHNVLSGRAQLITETVSLRHQNTELRTLLHQYLNSQVRP--QIPP 594          
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Mouse
Match: Drc1 (dynein regulatory complex subunit 1 [Source:MGI Symbol;Acc:MGI:2685906])

HSP 1 Score: 465.307 bits (1196), Expect = 1.680e-152
Identity = 317/756 (41.93%), Postives = 452/756 (59.79%), Query Frame = 1
Query:   97 HVEDEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGE-LDSDKDKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNEDSSNEAATSERSSTI---QSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFV----IQLSNPDS-------------MAAQARIT----EDVFQLVQ----------------NESL------------CKNVIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQL 2205
            H+   + GPS+ S+N +ERI+ RRLRI  R E +RR   GE LD  K+   E SKS KQ E SR++L KL   G E +TN++VA+D RE  RR E+EE  R R EKLEN  KT  D+F+EIT KWE   +K +PQ+L EML  Q   C  +I++KNKL  ELQ E K KDD YVK+LKKQS+D+ L++ RM EQ+  + + +++EL  +EKAF ++R +L+    K+W   L +   K+++YL  R K+V++ + Q++  R    EEYN +KIKLE +VQ+LEQ +Q  KAT+QLN EKLEYNFQVLKKRDEE+T+ KSQQKRK+ R+ D +NNL+ K  K  RQ + DN+ LT DYKR +  F++LQ+  R  +  D + F+EIWLMNE++ +E +++    DRII  Q LGL W  P+  FL N GP+  +++    KS T+++ E+L      L+T ED + EAA SE    +     +   T   +L L+CDE  FLIE KL  LL PL ++E  L++LDAIF+AL IE+EDD+ +++ +F+     +LS+  +             M+A  R++     D   +V                 N SL                IHP  +++ L  FVT        ++K   AQ          +TRD+S DTEYW      +I   K+ +WDAL  +LEKY  +LT R KLL + ++ + QN E++ LLQQY+ + VN ELQ+PP++  ++
Sbjct:   17 HLATPILGPSVHSDNPQERIQARRLRIAARQEARRREALGEYLDGKKESEEEQSKSYKQKEESRLKLTKLLLCGTELVTNIQVAADVREIHRRVEEEETKRQRLEKLENEVKTSQDKFDEITAKWEEGRRKRIPQELWEMLNSQQVHCAELIEDKNKLANELQQELKIKDDQYVKDLKKQSEDITLILERMEEQVKNVMKNFRQELIHIEKAFESERQELLSSNKKKWERALQAHNAKELEYLTNRMKKVEDYEKQLNKQRVWDCEEYNTIKIKLEQDVQILEQQLQQMKATYQLNQEKLEYNFQVLKKRDEESTVIKSQQKRKLNRLHDVVNNLRTKYTKQIRQFQDDNQSLTSDYKRLVTQFKDLQKALRHFIIIDEEKFREIWLMNEAEAKELAQRAFDVDRIIHSQHLGLPWNMPDLWFLNNVGPISLQQQ----KSVTQILEELL------LQT-EDEATEAAMSEDEDYMDLPNQISAKTTTKVLMLLCDESGFLIESKLLSLLHPLEKSECYLLRLDAIFSALAIEDEDDLYKLVNFFLRYRAHRLSSAQASSSIHSNVERTSLMSALERLSLMSQTDKGSMVSKSDQEPTEQEDEQEGDNASLSSRELEEQEDLSSPRFIHPNDVLKILEAFVTG-------LKKPKDAQPVLKL---KKETRDNSKDTEYWESL-AAVIPFFKQNLWDALYKALEKYYLVLTERAKLLMENESLEQQNAEMQSLLQQYLQAKVNTELQIPPTQGFRM 750          
BLAST of Dynein regulatory complex protein 1 vs. UniProt
Match: sp|Q7T0Y4|DRC1_XENLA (Dynein regulatory complex protein 1 OS=Xenopus laevis OX=8355 GN=drc1 PE=2 SV=1)

HSP 1 Score: 492.271 bits (1266), Expect = 5.570e-163
Identity = 314/702 (44.73%), Postives = 456/702 (64.96%), Query Frame = 1
Query:  103 EDEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGE-LDSDKDKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMK-AKSATEVIREVLKKEESMLKTNEDSSNEAATSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFVIQLSNPDSMAAQARITEDVFQLVQNESLCKNVIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQ 2202
            E  V GPS+DSE+ ++RIE RRLRI  R+E +RR   GE L   K K  E  KS KQ E SR RL KL +DG + +TN+++A+DARE  RR E+EEL R+RREKL+N AK+ L++FEEITK+W     K+VPQ + E+L  Q   C  +I++KN LI++LQ E + KDD YVK+LKKQ++D+DL++ RM EQI  + + Y++EL ++EK F  +R +L+      W + +   R+K+++ L +R K+V+E + Q+  LR    EEYN +KIKLET+VQ+L+Q +Q  KAT+QLN EKLEYN+QVLKKRDEENTITKSQQKRKITR+QD LNNL+LK  K  +Q K +N+ L +DYKR +E ++ELQ+K R     DAK F++IWLMNE ++++  +K L AD++I EQQLG+ W  P+  F+ N GPL+    K+K  KSA  + +EV+    S    ++ S++E  T  R    + +   TV+ +L L+CDE  FLIE KL RLL PL  +E SL+KLD+IF ALG+  E+D+ +++ +       P+          D    ++  S    +IH   +++A+  FV DF +   ++ +           L  ++ RD   DTEYW    K  I +++  VWDAL  +LEKY ++L  R +L+T+  + + QN ELR LL QY++S +N EL++PP++++Q
Sbjct:   10 ESAVAGPSLDSEDQQQRIEARRLRIVTRIEAKRREALGEDLKILKKKTEEPRKSHKQTEDSRQRLGKLVNDGSQLVTNIQIATDARETQRRGEEEELKRLRREKLDNEAKSSLEKFEEITKRWTLDKAKQVPQKMWEILNTQQQQCAQLIEDKNNLISDLQKELRRKDDQYVKDLKKQAEDIDLLVERMEEQIKNLIKTYRQELLQIEKVFELERRELLTANRNTWEQGMQGRRDKELESLMSRMKKVEEYENQLKQLRVQDGEEYNMIKIKLETDVQILQQQLQQMKATYQLNQEKLEYNYQVLKKRDEENTITKSQQKRKITRLQDVLNNLRLKQAKQVKQYKEENQSLMDDYKRIVEQYKELQKKMRHFSAVDAKMFQDIWLMNEEEMKQLVQKALEADQVIQEQQLGMCWEPPDLCFMDNVGPLLG---KLKDQKSAMSLAQEVMS---SHAPGDQSSASEGETDGRQ--CREVSAETVKHILELLCDESGFLIENKLTRLLSPLERDERSLIKLDSIFGALGVTVEEDVYKLVEFLCRYKREPEEEG-------DAGGSLEPGSKAHGLIHSNDVLRAVKAFVMDFQKPRGKVSR-----------LRLMEERDSREDTEYWAAAAK-AIPESRFRVWDALESALEKYYDVLGSRGQLITETVSLRQQNTELRTLLHQYLNSKINVELEIPPTQMMQ 684          
BLAST of Dynein regulatory complex protein 1 vs. UniProt
Match: sp|Q3USS3|DRC1_MOUSE (Dynein regulatory complex protein 1 OS=Mus musculus OX=10090 GN=Drc1 PE=1 SV=1)

HSP 1 Score: 465.307 bits (1196), Expect = 1.175e-151
Identity = 317/756 (41.93%), Postives = 452/756 (59.79%), Query Frame = 1
Query:   97 HVEDEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGE-LDSDKDKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNEDSSNEAATSERSSTI---QSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFV----IQLSNPDS-------------MAAQARIT----EDVFQLVQ----------------NESL------------CKNVIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQL 2205
            H+   + GPS+ S+N +ERI+ RRLRI  R E +RR   GE LD  K+   E SKS KQ E SR++L KL   G E +TN++VA+D RE  RR E+EE  R R EKLEN  KT  D+F+EIT KWE   +K +PQ+L EML  Q   C  +I++KNKL  ELQ E K KDD YVK+LKKQS+D+ L++ RM EQ+  + + +++EL  +EKAF ++R +L+    K+W   L +   K+++YL  R K+V++ + Q++  R    EEYN +KIKLE +VQ+LEQ +Q  KAT+QLN EKLEYNFQVLKKRDEE+T+ KSQQKRK+ R+ D +NNL+ K  K  RQ + DN+ LT DYKR +  F++LQ+  R  +  D + F+EIWLMNE++ +E +++    DRII  Q LGL W  P+  FL N GP+  +++    KS T+++ E+L      L+T ED + EAA SE    +     +   T   +L L+CDE  FLIE KL  LL PL ++E  L++LDAIF+AL IE+EDD+ +++ +F+     +LS+  +             M+A  R++     D   +V                 N SL                IHP  +++ L  FVT        ++K   AQ          +TRD+S DTEYW      +I   K+ +WDAL  +LEKY  +LT R KLL + ++ + QN E++ LLQQY+ + VN ELQ+PP++  ++
Sbjct:   17 HLATPILGPSVHSDNPQERIQARRLRIAARQEARRREALGEYLDGKKESEEEQSKSYKQKEESRLKLTKLLLCGTELVTNIQVAADVREIHRRVEEEETKRQRLEKLENEVKTSQDKFDEITAKWEEGRRKRIPQELWEMLNSQQVHCAELIEDKNKLANELQQELKIKDDQYVKDLKKQSEDITLILERMEEQVKNVMKNFRQELIHIEKAFESERQELLSSNKKKWERALQAHNAKELEYLTNRMKKVEDYEKQLNKQRVWDCEEYNTIKIKLEQDVQILEQQLQQMKATYQLNQEKLEYNFQVLKKRDEESTVIKSQQKRKLNRLHDVVNNLRTKYTKQIRQFQDDNQSLTSDYKRLVTQFKDLQKALRHFIIIDEEKFREIWLMNEAEAKELAQRAFDVDRIIHSQHLGLPWNMPDLWFLNNVGPISLQQQ----KSVTQILEELL------LQT-EDEATEAAMSEDEDYMDLPNQISAKTTTKVLMLLCDESGFLIESKLLSLLHPLEKSECYLLRLDAIFSALAIEDEDDLYKLVNFFLRYRAHRLSSAQASSSIHSNVERTSLMSALERLSLMSQTDKGSMVSKSDQEPTEQEDEQEGDNASLSSRELEEQEDLSSPRFIHPNDVLKILEAFVTG-------LKKPKDAQPVLKL---KKETRDNSKDTEYWESL-AAVIPFFKQNLWDALYKALEKYYLVLTERAKLLMENESLEQQNAEMQSLLQQYLQAKVNTELQIPPTQGFRM 750          
BLAST of Dynein regulatory complex protein 1 vs. UniProt
Match: sp|Q5XI65|DRC1_RAT (Dynein regulatory complex protein 1 OS=Rattus norvegicus OX=10116 GN=Drc1 PE=2 SV=1)

HSP 1 Score: 455.677 bits (1171), Expect = 6.179e-148
Identity = 316/758 (41.69%), Postives = 458/758 (60.42%), Query Frame = 1
Query:   97 HVEDEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGE-LDSDKDKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNEDSSNEAATSERSSTI---QSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFV----------------------------IQ----LSNPDSMAAQARITEDVFQL----------------VQNESLCKNV-IHPTMIVQALHDFVTDF--YQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQL 2205
            H+   + GPS++S+N +ERI+ RRLRI  R E +RR   GE LD  K+   E SKS KQ E SR++L KL   G E +TN++VA+D RE  RR E+EE  R R EKLEN  KT  D+F+EIT KWE   QK +PQ+L EML  Q   C  ++++KNKLI+ELQ E K KDD YVK+LKKQS+D+ +++ RM EQ+  + + +++EL+ +EKAF ++R +L+    K+W   L +   K+++YL  R KRV++ + Q++  R    EEYN++KIKLE +VQ+LEQ +Q  KAT+QLN EKLEYNFQVLKKRDEE+T+ KSQQKRK+ R+ D LNNL+ K  K  +Q + DN+ LT DYKR +  F++LQ+  R  +  D   F+EIWLMNE++ +E +++    D+II  Q LGL W  PN  FL N GP+  ++++   KS T+++ E+L +       +ED   E A SE  S +     +   T + +L L+CDE  FLIE KL  LL PL ++E  L++LDAIF+ALGIE+EDD+ +M+ +F+                            +Q    +S  D  ++ ++   D  +L                V+ E L   + IHP  +++ L  FVT     +DA  +++               DTR++  DTEYW      +I  +K+ +WDAL  +LEKY  +LT R KLL + D+ + QN E++ LLQQY+ + VN ELQVPP++  ++
Sbjct:   17 HLAAPILGPSVNSDNPQERIQARRLRIAARQEARRREALGEYLDGKKESEEEQSKSYKQKEESRLKLTKLLLCGTELVTNIQVAADIREIHRRVEEEETKRQRLEKLENEVKTSQDKFDEITSKWEEGRQKRIPQELWEMLNNQQVHCAGLVEDKNKLISELQQELKIKDDQYVKDLKKQSEDITVLLERMEEQVKSVMKNFRQELNYIEKAFESERQELLTTNKKKWERALQAHNAKELEYLINRMKRVEDYEKQLNRQRVWDCEEYNSIKIKLEQDVQILEQQLQQMKATYQLNQEKLEYNFQVLKKRDEESTVIKSQQKRKLNRLHDILNNLRTKYSKQIKQFQEDNQSLTSDYKRLVTQFKDLQKAIRHFIIIDQDKFREIWLMNEAEAKELAQRAFDVDKIIHSQHLGLPWKIPNFWFLNNVGPISLQQQQ---KSVTQILEELLLQ-------SEDEGTETAMSEDESYMDLPNQVSAKTTKKILVLLCDESGFLIESKLLSLLLPLEKSECYLLRLDAIFSALGIESEDDLYKMVNFFLRFKAHHLSSAQVSISTHSNAERTSLVSALQHMSLMSQTDRRSSASKSDGDPTELEDQQGSDNGSLMGRELVEQEDLSSPMFIHPNDVLKILDAFVTGLKKPKDARPVQRL------------KKDTRNNLKDTEYWESLAM-VIPFSKQNLWDALFKALEKYYLVLTQRAKLLMENDSLEQQNAEMQSLLQQYLQAKVNLELQVPPTQGFRM 751          
BLAST of Dynein regulatory complex protein 1 vs. UniProt
Match: sp|Q32KY1|DRC1_BOVIN (Dynein regulatory complex protein 1 OS=Bos taurus OX=9913 GN=DRC1 PE=2 SV=1)

HSP 1 Score: 449.899 bits (1156), Expect = 2.897e-146
Identity = 320/721 (44.38%), Postives = 449/721 (62.27%), Query Frame = 1
Query:   85 KQLHHVEDEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGE-LDSDKDKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNEDSSNEAATSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFVIQLSN--PDSMAAQARITEDVFQLVQNESLCK------NVIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFH-----LDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQL 2205
            K+  H+   + GPSI S+N +ERI+ RRLRI  RLE +RR   GE LD  K+   + SKS KQ E SR++L KL   G E +TN++VA+D RE  RR E+EE+ R R EKLEN  KT  D+F+EIT KWE   Q+ +PQ+L EML  Q   C  +I++KNKLI+ELQ E K KDD YVK+LKKQSDD+ L++ RM EQ+  + + +++EL  +EKAF  +R +L+    K+W   L +   K+++YL  R K+V++ + Q++  R    EEYN +KIKLE +VQ+LEQ +Q  KAT+QLN EKLEYNFQVLKKRDEE+T+ KSQQKRKI R+ D LNNL+ K  K  +Q + +N+ LT DYKR +  F+ELQ+  R     D K F+EIWLMNE + ++   +    DRIIS   LGL W++P+  FL N GP+  +++    KSAT+++ EVL + E     +EDSS      +    + +    T R +L L+CDE  FLIE KL  LL PL +NE  L++LDA+F+ALGIENEDD+ +++ +F+   ++  P S        E    LV  +S  K       +IHP  +++ L  FV             ++ ++  DF      L AV  RDDS D+EYW +    +I      +WDAL  +LEKY  +LT R +LL +  + + QN EL+ LLQQY+ + +N ELQVPP++V ++
Sbjct:   13 KEEEHLAPPILGPSIHSDNPQERIQARRLRIAARLEARRREALGEYLDGKKESEEDQSKSYKQKEESRLKLAKLLLCGTELVTNIQVAADIREIHRRVEEEEIKRQRLEKLENEVKTSQDKFDEITVKWEEGKQRRIPQELWEMLNAQQVHCAGLIEDKNKLISELQQELKMKDDQYVKDLKKQSDDICLLLERMEEQVKNVMKTFRQELQNIEKAFEVERQELLTSNKKKWERALQAHNAKELEYLMNRIKKVEDYEKQLNKQRIWDCEEYNTIKIKLEQDVQILEQQLQQMKATYQLNQEKLEYNFQVLKKRDEESTVIKSQQKRKINRLHDVLNNLRSKYNKQVKQFQEENQSLTSDYKRLVLQFKELQKAMRHFALIDDKRFREIWLMNEEEAKDLINRAFDVDRIISTHHLGLPWMAPDFWFLKNVGPISQQQQ----KSATQILEEVLMEAEKE-GADEDSSESETYLDLPKQVSA---RTTRKILMLLCDESGFLIESKLLSLLLPLEKNECYLLRLDAVFSALGIENEDDLYKLVNFFLKYQTHHSPSSQEPLDLRAEKERSLVDGKSQEKEPPPSPKLIHPNDVLKILEAFV-------------MSLRKPRDFWVPVKLLKAV--RDDSKDSEYW-EALTTVIPATTLNLWDALYTALEKYHLVLTQRAELLIENSSLERQNTELQQLLQQYLDTKINSELQVPPTQVFRV 709          
BLAST of Dynein regulatory complex protein 1 vs. UniProt
Match: sp|Q96MC2|DRC1_HUMAN (Dynein regulatory complex protein 1 OS=Homo sapiens OX=9606 GN=DRC1 PE=2 SV=2)

HSP 1 Score: 444.506 bits (1142), Expect = 8.039e-144
Identity = 314/740 (42.43%), Postives = 445/740 (60.14%), Query Frame = 1
Query:   97 HVEDEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGE-LDSDKDKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNEDSSNEAATSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDD----INRMLPYFVIQLSN-----PDSMAAQARI------TEDVFQLVQN--------ESLCKN-------------VIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQL 2205
            H+  ++  PS+ S+N +ERI+ RRLRI  RLE +RR   GE LD  K+   + SKS KQ E SR++L KL   G E +TN++VA D RE  RR E+EE+ R R EKLEN  KT  D+F+EIT KWE   QK +PQ+L EML  Q   C  ++++KNKLI+ELQ E K KDD YVK+LKKQSDD+ L++ RM EQ+  + + ++EEL  +EKAF  +R +L+    K+W + L +   K+++YL+ R K+V++ + Q++  R    EEYN +KIKLE +VQ+LEQ +Q  KA +QLN EKLEYN QVLKKRDEE+T+ KSQQKRKI R+ D LNNL+ K  K  +Q + +N+ LT DYKR +  F+ELQ+  R     D + F EIWLMNE + ++   +    DRII    LGL W +P+  FL N GP+  + +    KSAT+++ E+L + E        +  E+         + +   T + +L L+CDE  FLIE KL  LL PL +NE  L++LDAIF+ALGIE+EDD    +N  L Y   +LS+     P S A+  +       T    +L +         ESL +              VIHP  +++ L  FV    +   +    L  Q+         + RD+S D+EYW +    +I  +K+ +WDAL  +LEKY  +LT R KLL +  + + QN EL+ LLQQY++S +N ELQVPP++V+++
Sbjct:   17 HLSTQILAPSVHSDNSQERIQARRLRIAARLEARRREALGEYLDGKKESEEDQSKSYKQKEESRLKLAKLLLCGTELVTNIQVAIDIREIHRRVEEEEIKRQRIEKLENEVKTSQDKFDEITSKWEEGKQKRIPQELWEMLNTQQLHCAGLLEDKNKLISELQQELKTKDDQYVKDLKKQSDDICLLLERMEEQVKNVMKTFREELYNIEKAFEVERQELLASNKKKWEQALQAHNAKELEYLNNRMKKVEDYEKQLNRQRIWDCEEYNMIKIKLEQDVQILEQQLQQRKAIYQLNQEKLEYNLQVLKKRDEESTVIKSQQKRKINRLHDILNNLRSKYAKQIKQFQEENQSLTSDYKRLVMQFKELQKAMRHFALIDDEKFWEIWLMNEEEAKDLIARAFDVDRIIHTHHLGLPWAAPDFWFLNNVGPISQQPQ----KSATQIVEEMLMRSEEEEAEEAAAEPESYL----DLPKQISEKTTKRILMLLCDESGFLIESKLLSLLLPLEQNECYLLRLDAIFSALGIESEDDLYKLVNFFLKYRAHRLSSSLQIKPCSQASMEKASMEETSTRSELELAEQTEMEGEKEESLVEGEKEEEEETPPSPWVIHPNDVLKILEAFVMGL-KKPRDSRAPLRVQK---------NVRDNSKDSEYW-QALTTVIPSSKQNLWDALYTALEKYHLVLTQRAKLLLENSSLEQQNTELQALLQQYLNSKINSELQVPPTQVLRV 737          
BLAST of Dynein regulatory complex protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|15750950 (tr|R7US70|R7US70_CAPTE Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_182544 PE=4 SV=1)

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 350/721 (48.54%), Postives = 495/721 (68.65%), Query Frame = 1
Query:  100 VEDEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGELDSDKDKMVE-MSKSRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNEDSSNEAATSERSSTI-QSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFVIQL--SNPDSMAAQARITEDVFQ---------------LVQNESLCKNVIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQL 2205
             E+E  GP++DS + EERI  RR+RI+ RLE Q+R + GE  ++K ++ E +S SRKQ+E SR RL KL  DG+E ++N+RVA DARE +RR +DEE+ R+R+EKLE  AK G ++FEEITKKWE+ALQKE+PQ+L+EML+ Q   C+ MIDEKNKLI + Q+E K KDD YVK+LKKQ++D+DLMI RM+EQ+  + +AY+EEL +VE+AF+ +R DL+    K+W   + + R+K+++Y+ +R KRV++ + Q+  LR   AEEYN +KIKLET+VQ+L+Q +Q  KAT+QLN EKLEYNFQVL+KRDEENTITKSQQKRKITR+QD L NLK+KL K E+  + +N+QL+++YKR  E FRELQ+KS+  +  D + F +IW+MNE + + Y  K+L  +R++ EQQLGL +  P+ EFL N GP+  ++ K KA  A+++++E++        +  + S +   SER STI Q L    V+S+L L+CDE  FLIE KL +LL PL ++E +LMKLDAIFTALGIE EDDI+ +  YF+  +  + P    ++   T +V Q               L        +++HP ++++ L  FV D  +     EK   AQ    F + ++D RDDS DTEYW K+  ++I +  E +WDAL   LE Y  +LT R  L+TD D+ + QN ELR LL QY++S VN EL++PP++V+QL
Sbjct:    5 AEEENTGPNVDSLDQEERIAARRVRIQKRLEAQKRAQLGEDPNEKKEVKEVLSGSRKQMEESRQRLTKLKQDGLELVSNIRVAGDAREASRRLDDEEVRRLRKEKLEAEAKAGAEKFEEITKKWETALQKEIPQELHEMLMAQKALCDGMIDEKNKLINDFQMELKQKDDLYVKDLKKQAEDVDLMIERMDEQVKQLTKAYREELGQVERAFVAERTDLLDTNRKKWDSTMKNRRDKEVEYMKSREKRVEDYENQLQHLRVQDAEEYNQVKIKLETDVQILQQQLQQMKATYQLNQEKLEYNFQVLRKRDEENTITKSQQKRKITRLQDVLTNLKIKLAKQEKTYRDENQQLSDEYKRITEQFRELQKKSKHFMATDHRKFHDIWVMNEDEAKSYVHKVLDENRVVHEQQLGLQYQMPDLEFLANSGPITNDDGKEKAIPASQIVQEII--------SVRNDSEKGELSERRSTILQKLPAKLVKSVLELLCDESGFLIESKLNKLLSPLEKDEQNLMKLDAIFTALGIETEDDIHLLSQYFLSHVDQTKPADGVSRKSSTAEVRQVTGALDKGEEGAGSGLPSPNQTQGDLVHPNIVLKVLRAFVNDNKRPPK--EKGRNAQ----FQIASLDERDDSGDTEYWQKF-PDVIPEQNERLWDALVDGLEGYHEVLTSRSGLITDNDSLRQQNAELRMLLHQYVNSKVNNELEIPPTRVLQL 710          
BLAST of Dynein regulatory complex protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|21105984 (tr|A0A2T7PEY8|A0A2T7PEY8_POMCA Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_07399 PE=4 SV=1)

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 355/725 (48.97%), Postives = 487/725 (67.17%), Query Frame = 1
Query:  100 VEDEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGE-LDSDKDKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNEDSSNEAATSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFV-IQLSNPDSMAAQ---------------ARITEDVFQLVQNESL------CKNVIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQL 2205
             E+E  GPS+DS N EER+  RR RI++R+E  +R   GE +DS K+   E+SKSRKQ+E SR+RLNKL  DG E +TN+RVA DARE+ RR  +EE+ R+R+++LE   K   +RFEEITKKWE ALQKE+PQ L+EML+QQ  +C++MIDEKNK+IT+ Q + K KDD YVK+LKK +DD+DLM  RM EQI+ + +A ++EL ++E+AF+ +R++L+ +Q K+W E +++ R K++++++ R KRV+EN+  +  LR   AEEYN +K++LET+VQVLEQ +Q  K+T+QLN EKLEYNFQVLKKRD+ENTITKSQQKRKITR+QD LN L+ KL K E+Q K DNEQLTEDYKR  E F +LQRKS+  L  DA+ F ++W MNE + +    ++LAADR+I EQQLGL W +P+  F    GPL+ ++   K  SA+EV++EV    E M K NE    +    ER      +   T++ ++ L+CDE  FLIE KL +LL PL ++E SL+KLDAIF+ALGIE E+DI ++  YF+ I    PD    Q                 + E+V  + +N+          ++IHP  +++AL  FV +  Q     +K+  +Q    F + A++ RD S D+EYW+KY   L D+ KE VWD L   LE Y  IL  R  LL + D  +TQN ELR LL QY++S VN ELQ+PPSKV+Q 
Sbjct:    5 AEEEDSGPSVDSNNPEERVAARRNRIQHRIEVLKRAALGEDVDSKKEVKEELSKSRKQMEESRLRLNKLRRDGFELVTNIRVADDARESNRRGIEEEIKRIRKDRLEQEVKLSAERFEEITKKWEIALQKEMPQALHEMLIQQKRSCDLMIDEKNKIITDFQQDLKNKDDQYVKDLKKMADDIDLMTERMEEQINNIMKANRDELEQIERAFVAERNELLEVQKKKWDEKMNNRREKEVEFMNQRLKRVEENEQLLQHLRVQDAEEYNVVKVRLETDVQVLEQQLQQMKSTYQLNQEKLEYNFQVLKKRDDENTITKSQQKRKITRLQDVLNGLRQKLSKQEKQYKSDNEQLTEDYKRVTEQFHDLQRKSKHFLLTDAQKFDQVWCMNEEECRSLLDEVLAADRVIHEQQLGLPWPAPDLSFTETVGPLLGKDGATKKVSASEVVKEVFSHTEDMGK-NEVEKEQDEEIERPGIFSKISAQTIKQIMELLCDESGFLIENKLNKLLAPLEKDERSLIKLDAIFSALGIETEEDICKLSTYFMHIPDDRPDEHEKQEDAENEEGGQQNSEDGDLDEEVGIMTENQGPDPKSADAFHLIHPNEVLKALRAFVEENRQPIE--DKSYKSQ----FRITALEERDSSGDSEYWMKYNSALSDE-KEKVWDGLLDGLEMYSEILNKRASLLLETDTLRTQNAELRLLLHQYVNSKVNAELQIPPSKVLQF 721          
BLAST of Dynein regulatory complex protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|20338879 (tr|A0A1S3J526|A0A1S3J526_LINUN dynein regulatory complex protein 1 OS=Lingula unguis OX=7574 GN=LOC106169860 PE=4 SV=1)

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 358/778 (46.02%), Postives = 485/778 (62.34%), Query Frame = 1
Query:  103 EDEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGELDSDKDKMV--EMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKK-------------------------------EESMLKTNEDSSNEAATSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFV----------------------------------IQLSNPDSMAAQARITEDVFQLVQN----------ESLCKNVIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQL 2205
            E+E  GPS+DS + EERI  RRLRI+ R E  RR   GE D    K V  E+SKSR Q+E SR RL KL  DG E +TN+RVA D RE ARR E+EE  R R++KLE   K G +RFEEI+KKWESALQKE+PQDL+EML QQ   CN MIDEKNKLI+E Q E K KD+ YVK+LKKQ++++DLMI RM EQI  + +AY+EEL+++EKAF+T+R +L+ LQ K+W  ++   R+K+++Y+ AR KRV++ + Q+  LR   AEEYN++KIKLET+VQ+LEQ IQ  +ATFQLN EKLEYNFQVLKKRDEENTITKSQQKRKITR+QD +N L++KL K E+Q + +N QLTEDYKR  E F ELQ+KSR  +  D K F +IW+MNE++ +E   K+   DR ++E QLGL W  P+ EF+ N GP+++E+ K +  SAT+V++EV+ +                                 SMLK     S +  T  +S+  Q     T++ +L L+CDE  FL+E KL +LL PL ++E SLMKLDAIF ALG+E EDDI R+  +F                                    + +  D MA  A + E++ +++++          +S    +IHP  + +AL  FV + +Q   E  K         F +   + RDD+ D  YW KY  +++ +  E +WDAL   LE Y + L  R KL+T+ D  + QN ELR LL QY++S VN EL++PP++V+ L
Sbjct:    6 EEEEVGPSVDSNDPEERIAARRLRIQRRHELARRAAMGE-DPSAKKAVKEEISKSRIQIEQSRQRLTKLLQDGTELVTNIRVAGDMREGARRIEEEEARRQRKDKLEAENKGGTERFEEISKKWESALQKEIPQDLHEMLKQQQQRCNAMIDEKNKLISEFQQELKGKDEQYVKDLKKQAEEIDLMIERMEEQIKNLTKAYREELNQIEKAFVTERTELLELQRKKWDHMMQQRRDKELEYMKAREKRVEDYEQQLQHLRVQDAEEYNSVKIKLETDVQLLEQQIQLMRATFQLNQEKLEYNFQVLKKRDEENTITKSQQKRKITRLQDVMNTLRIKLAKQEKQFRDENSQLTEDYKRITEQFMELQKKSRHFITTDNKKFTDIWIMNEAEAKELVEKVCEQDRTVTEHQLGLRWDQPDLEFMDNVGPILSEQTKRQQVSATQVVQEVMSQTGGVSDQPVADPVDRPYRPEPGEEEEGSEYHHGSMLKDPATKSEQGETV-KSTITQKFSAHTIKKILELLCDESGFLVENKLVKLLAPLEQDEQSLMKLDAIFAALGVETEDDIYRLSNFFTKFRQATERAQSGQGSRKQSVEEVERQDGEPEKEGEEGTQTDEMAEDAEVAEELQKVMEDGEEVVTPRSVKSEVTELIHPNDVYKALRVFVEEQWQPTKEKSK------QPQFKIANTEDRDDADDAAYWKKY-CSILPEKTERMWDALLDGLEMYSDCLQSRAKLITETDGLRQQNAELRMLLHQYVNSKVNAELEIPPTRVLNL 774          
BLAST of Dynein regulatory complex protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|15796852 (tr|A0A1I8HTF8|A0A1I8HTF8_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013094g1 PE=4 SV=1)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 356/726 (49.04%), Postives = 496/726 (68.32%), Query Frame = 1
Query:  106 DEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGELDSDKDKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNE--DSSNEAATSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFVIQLSNPDSMA----------------------AQARITEDVFQLVQNESLCK-NVIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQLN 2208
            DE   P+++SE+++ERI+ RRLRI+ R+E QRR E G  + +  K+ E+SKS KQ+E SR R  KL  DG EFLTNVRVA DARENARR ED+E  R+RREKLE  AK   ++F++ITKKWE ALQKE+PQDL+EML  Q + C+ +IDEKNKLI EL  E KAKD+ YVKELKKQS+++DL++ RM EQ+  M RAYK+EL ++EKAF+ QR+D +  Q  +W  L+  I ++Q +YL AR  RVD+ + Q+S LR  HAEE+N LK+ LE +V+ L+Q +Q  KATFQLNLEKLEYNFQVLKKR+E+NT TKS QKR+ITR+QD LNNL++KL K E+  K  NEQLTEDY+R  E FR+L +K++ LL AD K F +IWLMNE + ++ + ++L ADR++ EQQLG+ W  P+  FL N GP+++  ++ K+    +V+R++L +E       E   S +EA    RS   + L+PS VRS+L L+CDE  FLIE+KLK LL PL ++E +LM+LDA+F+ALGI +ED+I++MLPYF+      DS A                      +     E++ ++V  +   +  +IHP  + +AL  FV +  + + +  +  +      F L  ++ RDDS D  YW +Y  +LID++KE +WDAL   +EKY ++L  R  LL + DA + QN ELR LLQQY++S VN+EL++PP++V+QL+
Sbjct:    8 DEEPEPTVESEDIQERIQARRLRIERRIEAQRRAE-GTDEEEGVKIEELSKSLKQIEASRQRNTKLLRDGNEFLTNVRVAGDARENARRIEDDEARRLRREKLEAEAKAATEKFDDITKKWEIALQKEIPQDLHEMLQAQQEGCDSLIDEKNKLINELLFELKAKDELYVKELKKQSEEIDLLVERMEEQVRTMTRAYKQELLQIEKAFVQQREDTMERQTSDWEALMKQIVDRQNEYLQARQLRVDDFEDQLSALRTQHAEEFNELKVTLEQDVERLQQQVQMMKATFQLNLEKLEYNFQVLKKREEDNTQTKSLQKRRITRLQDALNNLRVKLRKQEKDFKQQNEQLTEDYRRVTEQFRDLMKKAKNLLGADGKKFHDIWLMNEEEAKKLAERLLDADRVLHEQQLGIPWTEPDCSFLDNVGPVVSASDRAKSVPVAQVVRDMLSREGGDAPGLEQLGSVDEA----RSLAARELNPSIVRSVLELVCDEAGFLIEKKLKTLLAPLEKDERNLMQLDAVFSALGITSEDEIDKMLPYFL-----QDSGAIDEEDEPEEEEGAVGGGGSEAGSGEEAAEEIRRIVSPKDGSRVTLIHPNRVRRALRGFVQELQR-SHQQRQHQSQGGGQQFTLKDIEERDDSEDAAYWARY-GSLIDEDKEALWDALLAGMEKYSSVLQSRSSLLNETDALRLQNAELRHLLQQYVTSKVNQELEIPPTQVMQLD 721          
BLAST of Dynein regulatory complex protein 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|15772863 (tr|A0A267DKT2|A0A267DKT2_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033113g2 PE=4 SV=1)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 356/726 (49.04%), Postives = 496/726 (68.32%), Query Frame = 1
Query:  106 DEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGELDSDKDKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNE--DSSNEAATSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFVIQLSNPDSMA----------------------AQARITEDVFQLVQNESLCK-NVIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQLN 2208
            DE   P+++SE+++ERI+ RRLRI+ R+E QRR E G  + +  K+ E+SKS KQ+E SR R  KL  DG EFLTNVRVA DARENARR ED+E  R+RREKLE  AK   ++F++ITKKWE ALQKE+PQDL+EML  Q + C+ +IDEKNKLI EL  E KAKD+ YVKELKKQS+++DL++ RM EQ+  M RAYK+EL ++EKAF+ QR+D +  Q  +W  L+  I ++Q +YL AR  RVD+ + Q+S LR  HAEE+N LK+ LE +V+ L+Q +Q  KATFQLNLEKLEYNFQVLKKR+E+NT TKS QKR+ITR+QD LNNL++KL K E+  K  NEQLTEDY+R  E FR+L +K++ LL AD K F +IWLMNE + ++ + ++L ADR++ EQQLG+ W  P+  FL N GP+++  ++ K+    +V+R++L +E       E   S +EA    RS   + L+PS VRS+L L+CDE  FLIE+KLK LL PL ++E +LM+LDA+F+ALGI +ED+I++MLPYF+      DS A                      +     E++ ++V  +   +  +IHP  + +AL  FV +  + + +  +  +      F L  ++ RDDS D  YW +Y  +LID++KE +WDAL   +EKY ++L  R  LL + DA + QN ELR LLQQY++S VN+EL++PP++V+QL+
Sbjct:   26 DEEPEPTVESEDIQERIQARRLRIERRIEAQRRAE-GTDEEEGVKIEELSKSLKQIEASRQRNTKLLRDGNEFLTNVRVAGDARENARRIEDDEARRLRREKLEAEAKAATEKFDDITKKWEIALQKEIPQDLHEMLQAQQEGCDSLIDEKNKLINELLFELKAKDELYVKELKKQSEEIDLLVERMEEQVRTMTRAYKQELLQIEKAFVQQREDTMERQTSDWEALMKQIVDRQNEYLQARQLRVDDFEDQLSALRTQHAEEFNELKVTLEQDVERLQQQVQMMKATFQLNLEKLEYNFQVLKKREEDNTQTKSLQKRRITRLQDALNNLRVKLRKQEKDFKQQNEQLTEDYRRVTEQFRDLMKKAKNLLGADGKKFHDIWLMNEEEAKKLAERLLDADRVLHEQQLGIPWTEPDCSFLDNVGPVVSASDRAKSVPVAQVVRDMLSREGGDAPGLEQLGSVDEA----RSLAARELNPSIVRSVLELVCDEAGFLIEKKLKTLLAPLEKDERNLMQLDAVFSALGITSEDEIDKMLPYFL-----QDSGAIDEEDEPEEEEGAVGGGGSEAGSGEEAAEEIRRIVSPKDGSRVTLIHPNRVRRALRGFVQELQR-SHQQRQHQSQGGGQQFTLKDIEERDDSEDAAYWARY-GSLIDEDKEALWDALLAGMEKYSSVLQSRSSLLNETDALRLQNAELRHLLQQYVTSKVNQELEIPPTQVMQLD 739          
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Cavefish
Match: drc1 (dynein regulatory complex protein 1-like [Source:NCBI gene;Acc:103046744])

HSP 1 Score: 397.127 bits (1019), Expect = 3.225e-127
Identity = 276/699 (39.48%), Postives = 425/699 (60.80%), Query Frame = 1
Query:  118 GPSIDSENMEERIECRRLRIKNRLENQRRLERGELDSDKDKMVEMSK-SRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKS--ATEVIREVLKKEESMLKTNEDSSNEAATSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFVIQLSNPDSMAAQARITEDVFQLVQNESLCKNVIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQL 2205
             P+++S++ EERI  RRLRI  R E + RLE GE   ++++  E  + S+KQV+ S  R+ KL  DG E +TN+ VA+DARE  RRA+  E   +R EKLEN AK+ L++FEE+T+ W  A  KE+PQDL + L  Q   C ++ ++KNKLI ELQ E K+ DD YVKELKKQ++D+DLM  +M EQ+  + + Y++EL  +E +F  +R  L+    K+W +      ++++++L  R K+ +EN++ +  LR ++ +EYN +K+ LET+ ++L+Q+IQ  KAT QLN EKLEY+  V+  R  E    +S Q+++I R+QD+L NLK+K    E+Q + +N+ LT+ YKR M  ++++Q+  R     DA+ F+EIWLMNE++ +    K+L  DR+I EQ LGL+W  P+  F+ N GP+  + +  +     A + + EV +K E           E++T+E    +  L   TV+ LL L+CDE  FLIE KL +LL PL ++  S +KL  IF+ALGIENE+D+ +M  +F            +     +  +LV+   +   ++HP  +V+ALH F   + +      + L +Q+     + +++ RDDS D  YW +   N+I ++K  VW+AL  +L KY  +LT R K+L D    K QN EL  LL QY+S   N EL++PP+ V+QL
Sbjct:   10 SPAVESDSPEERIAARRLRIAARTEARTRLELGEEAQEQEENTEEPRTSQKQVDQSEKRMIKLQTDGTELVTNILVAADARETKRRAQLAEARTLRNEKLENEAKSSLEKFEEVTQNWPVAKAKEIPQDLRDALKSQQQLCMLITEDKNKLINELQHELKSSDDRYVKELKKQAEDVDLMREKMQEQMTSLMKLYRQELDLIENSFDDERKTLLTSNLKKWEQQRKERSDRELEHLLQRIKQKEENEVLLHRLRVANIKEYNMMKLNLETQSEILQQNIQKTKATNQLNQEKLEYSRHVITHRKMETIHIESLQRKRILRLQDSLKNLKVKCASQEKQAQEENQSLTDGYKRSMLEYKDMQKHLRHFAAVDAERFEEIWLMNENEAKALVHKVLETDRVIYEQFLGLAWAPPHVPFMENSGPIQPQHQAKRTAQQFAMQALGEVEEKRE--------MEGESSTAE----VAGLDRRTVKKLLELLCDETGFLIESKLLKLLSPLEKDPQSFIKLHLIFSALGIENEEDVYKMAEFFEKYKQQQKDQPEEGISVSNENELVR--EMDSELVHPNHVVKALHAFTAQYCRP-----RDLQSQKQSS--VLSLEERDDSEDAAYW-ESMANVIPESKLKVWNALEDALSKYHTVLTERSKILIDTHHLKQQNAELTALLHQYLSQKGNTELKIPPTLVMQL 686          
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000026867.2 (dynein regulatory complex protein 1-like [Source:NCBI gene;Acc:103023424])

HSP 1 Score: 140.198 bits (352), Expect = 4.479e-34
Identity = 185/706 (26.20%), Postives = 345/706 (48.87%), Query Frame = 1
Query:  118 GPSIDSENMEERIECRRLRIKNRLENQRRLERG-----ELDSDKDKM-VEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEML--LQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNEDSSNEAATSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFVIQLSNPDSMAAQARITEDVFQLVQNESL-CKNVIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQLN 2208
             PS++SE+ +ERI  RRLRI  R E ++RLE G     +++  ++++     ++RKQ + S+ ++ +  D   E +++ +V SDAR   R +E  E  R+R EKLE +AK+ L+  + + +K   A  K  PQ+L E L  L+Q  A  I +  + K+I +L  E +  D SY  ELK+ ++ + LM  +  E     K   ++EL +++ + L +    +    ++W +    I  KQ +      K+ +E++ Q+  L+     E+  +K  LET+  +L+  ++ AKA   LN EKL+++ QV+   + E +  KS+QKRK+ ++ D L +LK K  +  +Q     + LT+  K+  + +R++Q++SR      AK  +E+  M E +  +  ++ L+ D+ I    + L WV P   F                            K  S  +  +  + E++TS+ + T  ++ P T + +L L+C+E +FL++  L +LL  + + E + +K++ I  ALGIE  +D++ ++ +FV                    +  Q E +   +++ P  +V+ L  F   +           + ++      DAV     + D+  W +   N++ ++K  +WD L  +L++YL++LT R + L +    K +  +LR L               PP+ V  ++
Sbjct:   32 APSLESESPQERIAARRLRIAARKEAEKRLELGIGAQPQVEKKEEELPAAFPETRKQWKQSQKKMLEEIDMYKETISSFQVESDARLLIRSSEILEAQRLREEKLEILAKSDLEDLKLMEEKCAEATAKNTPQELFEALEDLKQFGAEKIEV--RKKVIEDLLGEIREADLSYETELKRDAEQIYLMAQKKQELKSSFKELQRKELDQIQSSLLDEEKAFLSSSYEKWEQKRKEIPYKQQEQFLEMMKQKEEHEDQLDELKVKKINEFTRMKRTLETQADLLQLKLEKAKAAKFLNDEKLDFSRQVVGFCEMEKSQIKSKQKRKLIKLYDTLKDLKAKCTQANKQSLEGKKALTDANKQASQKYRDMQKRSRDFAANAAKTHQEMRQMLEEEAMDLIQRALSLDQQIQAHIIDLDWVPPPMPF----------------------------KARSPYQPQQTEAAESSTSKSART--AVDPETEQRVLQLLCEEASFLLDPDLLQLLSCMPKQEQTFIKIELICFALGIEKIEDLHGLVEFFV--------------------EYKQREKMGSSDIVRPDQVVKVLKAFTAQY-----------SKRRQVSRSKDAVTRGRRADDSGDW-ESTANILPESKFRIWDILEDALKQYLSVLTVRFQTLAETRQLKQEITKLRLL--------------APPTDVFSVS 659          
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004667.1 (pep scaffold:Pmarinus_7.0:GL480581:13359:25845:-1 gene:ENSPMAG00000004233.1 transcript:ENSPMAT00000004667.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.586 bits (488), Expect = 6.777e-54
Identity = 156/472 (33.05%), Postives = 232/472 (49.15%), Query Frame = 1
Query:  961 KATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNEDSSNEAA---TSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEK-----------------LKRLLEPLG-ENEASLMKLDAIFTALGI------ENEDDINRMLPYF--------VIQLSNPDSMAAQARI----------------------TEDVFQLVQNESLCKNVIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDA-VDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQ 2202
            KAT+QLN EKLEYNF VLKKRDEEN + K+ QKR++TR QD L +LK +  K+ERQ K +N  L  D+ R  E  +++   +R     DA+ F+ +WLM E +    +R+ L ADR I+EQQLGL W +P     L  GP          ++A E+ + VL     + + +++   +     TS+      +L P+T++ +L L+ DE  FL+E+K                 L  +L  LG E E  + KL   F A  I      + +D I+ +L +            L   D  A  A++                      TE   Q     S   ++I P  ++ AL  F+ +  +  +E  +AL         L+A +  RD+  D EYW +    +I D + TVWDAL   L+KY  +L+ R+ L+ + +A + QN ELR LLQQYM + VN E+Q P SK  +
Sbjct:   12 KATYQLNQEKLEYNFHVLKKRDEENALAKALQKRRLTRQQDLLTSLKARYAKMERQYKDENLSLASDFTRMSEEQQQVHSLTRHFGGVDARRFRGVWLMAEEEAHRLARRALDADRAITEQQLGLDWEAPPDSDALLGGP---SRLAGSHRTAAELAKSVLTTPGGLKQEDKEEEEKVREAETSKEGRESPALTPATLKRILELLSDESGFLVEQKLLKLLEPLPRDERSLLTLHTVLTALGLETEEDVKKLAEFFLAFAIHTYTYIQGKDHIHTLLRWCQLVQGRERAASLKKEDGEAVAAKVEEVREREEEEEERDADGRNGGETEGGEQPWAPTS--DDLIDPDDVLLALKLFMKEHRKPNSE--RAL---------LEAGLGERDEERDQEYWHQL-AGIIPDERLTVWDALLQGLDKYHTVLSAREGLVGETEALRRQNAELRLLLQQYMHTRVNPEMQEPSSKSFE 466          
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003173.1 (pep scaffold:Pmarinus_7.0:GL476693:257328:263743:1 gene:ENSPMAG00000002895.1 transcript:ENSPMAT00000003173.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.696 bits (413), Expect = 2.069e-45
Identity = 110/276 (39.86%), Postives = 173/276 (62.68%), Query Frame = 1
Query:  121 PSIDSENMEERIECRRLRIKNRLENQRRLERGELDSDK-DKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQK--EVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVL 939
            PS++S +  ERIE RRLR+  R++  +R   GE  S   D + +  +++++ E SR RL+KL +DG E ++NVRVA DARE  RRA +EE  R+R EKLE+ A+  L++FE I   W +  ++   VPQ L + L  Q   C  +I++KNKLITEL+ E K  D+ +V++LK+Q+ D++L+  RM EQ   + +  +EE++ +EK F  +R +L+    KEW +   + R+++   L+ R +R +E + Q+  LR    EE N +K KLE +VQV+
Sbjct:   18 PSVESSDQRERIEARRLRVAARVDAAKRANLGETSSPSLDALTQGGQAQRREEESRQRLDKLLEDGTELVSNVRVAGDAREAQRRARNEEARRLRLEKLESEARESLEKFERIASGWHNGTKRALPVPQALRDALHAQQKLCAALIEDKNKLITELEQELKTHDEQFVRDLKRQATDIELLTERMEEQARSVAQTCREEMTSLEKEFEAERHELLEKNRKEWEQATHTRRDREEQQLEGRLRRAEEQEQQLQDLRRQGVEETNEIKEKLEGDVQVI 293          
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Nematostella
Match: EDO36669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI13])

HSP 1 Score: 325.865 bits (834), Expect = 3.049e-103
Identity = 201/466 (43.13%), Postives = 271/466 (58.15%), Query Frame = 1
Query:  904 LKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNK-GPLITEEEKMKAKSATEVIREVLKKEESMLKTNEDSSNEAATSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFVIQLSNPD--------------------------------SMAAQARITEDVFQLVQNESLCKNVIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQ 2202
            +KIKLET+VQ+LEQ +Q  KAT+QLN EKLEYNFQVLKKRDEENTITKSQQKRKITR+QD LNNLK KL K ERQ + +N+ LT+DYKR  E F+ELQ+KSR     D K F++IW MNE  +++    +L  DRII EQQLGL W +P  E L  +  P  +   + K  SATE+  E++    ++L    D      TS+  S    L    ++S+L L+CDE  FL+E KL  LL PL  +E SLMKLDAIF ALG++ E+DI  +  YF+ Q S  D                                +M        D+      ++  K +IHP  ++ AL  FV D  Q   E +K    Q     H  A   RD   D E+W +   ++ D++KE +W+AL    +KYL +LT R  L+ + D+ + QN ELR LL QY++S VN+EL++PP++++Q
Sbjct:    2 VKIKLETDVQILEQQLQQMKATYQLNQEKLEYNFQVLKKRDEENTITKSQQKRKITRLQDVLNNLKQKLAKQERQYRDENQNLTDDYKRITEQFKELQKKSRHFQATDQKKFEDIWNMNEEQVRDLVHSVLEEDRIIMEQQLGLPWEAPQLEVLETRIRPQGSATTREKQASATEIAHEIMTAGTALLP---DEGESDPTSDTISQKSKLPARVIKSVLELVCDESGFLVESKLNTLLAPLDRDEQSLMKLDAIFAALGVDTEEDIYLLAQYFIKQQSEEDADGEDQPTEGDRSREKDVDETKEVKEAEEGSIAMTTDEDHMSDISSARSRKADGKQLIHPNELIPALRRFVQDHRQPQRETKK----QAVKTGHGAA---RDLKSDAEFWQQM-SSVTDESKERLWNALEDGFDKYLGVLTERAVLIQETDSLRQQNAELRMLLHQYVNSRVNQELEIPPTRILQ 456          
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Nematostella
Match: EDO36670 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI14])

HSP 1 Score: 136.732 bits (343), Expect = 3.027e-37
Identity = 66/116 (56.90%), Postives = 90/116 (77.59%), Query Frame = 1
Query:  409 KLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLI 756
            KLE   K+  ++FEEITKKWE AL KE+PQDL+ ML +Q  AC+ M +EK+KLI + Q E KAKDD YVK+LKK ++D+DLMI R  EQ+  + +AY+EEL+++EKAF+T+R +LI
Sbjct:   42 KLEAEIKSAAEKFEEITKKWEYALSKEIPQDLHSMLTEQKSACDAMFEEKDKLINDFQQELKAKDDQYVKDLKKAAEDIDLMIEREEEQVKQLTKAYREELTQIEKAFVTERSELI 157          

HSP 2 Score: 48.9062 bits (115), Expect = 9.849e-7
Identity = 28/56 (50.00%), Postives = 36/56 (64.29%), Query Frame = 1
Query:   97 HVEDEVQGPSIDSENMEERIECRRLRIKNRLENQRRLER--GELDSDKDKMVEMSK 258
            H E+E  GPS+DS   EERI  RRLRI+ RLE  RR E+   E+ S  +K  E++K
Sbjct:    4 HEEEEDDGPSVDSAVAEERIAARRLRIQRRLEAARRNEKLEAEIKSAAEKFEEITK 59          
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Medaka
Match: ENSORLT00000029891.1 (dynein regulatory complex subunit 1 [Source:NCBI gene;Acc:101155737])

HSP 1 Score: 75.0998 bits (183), Expect = 1.539e-13
Identity = 89/338 (26.33%), Postives = 164/338 (48.52%), Query Frame = 1
Query:  445 FEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASH----AEEYNALKIKLETEVQVLEQSIQN--AKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKR---RMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSW----------VSPNTEFLLNKGPLITEEEK 1401
            FEE+ + W +A QKE  QDL E L  Q   C  +I +K  LI +L+ E   + +SYV+ L+K +++++L+ + M E++  M   Y+EE  ++E+    + + L+     +W + + ++ +K++  L  R K+V             H     +  N  K K+         S++N   K    L + K   + Q+ K+  E +T        +I  +++++  L+    + ER+ K   ++L  +Y+R   R++   ++Q K+R     DAK FKE+  M + ++ + +++ L  D +I  Q LGL W          +SP  E + N G L  E +K
Sbjct:  107 FEELIEGWSTAHQKEAHQDLLEALESQQHLCAAVIRDKKILINDLKQELNRRHESYVRTLRKNAEELNLVTVMMEEKMKIMTDVYREESEQMERIHQQEVEILLTKDKDQWEKQIKALCDKELQLLTERKKKVK------EYEEKCHDKILGDVINNAKSKV---------SVKNLHKKVPSDLLVPKNNLHAQLAKQSKEMSTFLNG----RIFSLKNDIKKLRETYTEKERELKNCTDKLYGEYQRSYQRVQRCNQMQMKTRH-NSVDAKQFKELQQMIDGELNQLAQRALTIDSLIC-QYLGLPWKQDNMAMLELLSPIQEQVPNFGQLNYETDK 423          
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Medaka
Match: ENSORLT00000046289.1 (dynein regulatory complex subunit 1 [Source:NCBI gene;Acc:101155737])

HSP 1 Score: 75.0998 bits (183), Expect = 1.641e-13
Identity = 89/338 (26.33%), Postives = 164/338 (48.52%), Query Frame = 1
Query:  445 FEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASH----AEEYNALKIKLETEVQVLEQSIQN--AKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKR---RMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSW----------VSPNTEFLLNKGPLITEEEK 1401
            FEE+ + W +A QKE  QDL E L  Q   C  +I +K  LI +L+ E   + +SYV+ L+K +++++L+ + M E++  M   Y+EE  ++E+    + + L+     +W + + ++ +K++  L  R K+V             H     +  N  K K+         S++N   K    L + K   + Q+ K+  E +T        +I  +++++  L+    + ER+ K   ++L  +Y+R   R++   ++Q K+R     DAK FKE+  M + ++ + +++ L  D +I  Q LGL W          +SP  E + N G L  E +K
Sbjct:  107 FEELIEGWSTAHQKEAHQDLLEALESQQHLCAAVIRDKKILINDLKQELNRRHESYVRTLRKNAEELNLVTVMMEEKMKIMTDVYREESEQMERIHQQEVEILLTKDKDQWEKQIKALCDKELQLLTERKKKVK------EYEEKCHDKILGDVINNAKSKV---------SVKNLHKKVPSDLLVPKNNLHAQLAKQSKEMSTFLNG----RIFSLKNDIKKLRETYTEKERELKNCTDKLYGEYQRSYQRVQRCNQMQMKTRH-NSVDAKQFKELQQMIDGELNQLAQRALTIDSLIC-QYLGLPWKQDNMAMLELLSPIQEQVPNFGQLNYETDK 423          
BLAST of Dynein regulatory complex protein 1 vs. Planmine SMEST
Match: SMESG000072168.1 (SMESG000072168.1)

HSP 1 Score: 1359.74 bits (3518), Expect = 0.000e+0
Identity = 711/713 (99.72%), Postives = 713/713 (100.00%), Query Frame = 1
Query:   70 MNSLLKQLHHVEDEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGELDSDKDKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVXXXXXXXXXXXXXXXXXXXXXXKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDXXXXXXXXXXXXERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNEDSSNEAATSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFVIQLSNPDSMAAQARITEDVFQLVQNESLCKNVIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQLN 2208
            MNSLLKQLHHVEDEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGELDSDKDKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVASDARENARRAEDEELARVRREKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLI+LQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDNLNNLKLKLVKVERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNEDSSNEAATSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFVIQLSNPDSMAAQARITE+VFQLVQNESLCKNVIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQLN
Sbjct:    1 MNSLLKQLHHVEDEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGELDSDKDKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVASDARENARRAEDEELARVRREKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLLQQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMNEQIDCMKRAYKEELSEVEKAFLTQRDDLIVLQNKEWTELLDSIRNKQIDYLDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKATFQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDNLNNLKLKLVKVERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESDIQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSATEVIREVLKKEESMLKTNEDSSNEAATSERSSTIQSLHPSTVRSLLNLICDEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYFVIQLSNPDSMAAQARITEEVFQLVQNESLCKNVIHPTMIVQALHDFVTDFYQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKETVWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNRELQVPPSKVIQLN 713          
The following BLAST results are available for this feature:
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
DRC11.674e-14442.43dynein regulatory complex subunit 1 [Source:HGNC S... [more]
DRC18.673e-5947.86dynein regulatory complex subunit 1 [Source:HGNC S... [more]
DRC15.298e-1246.99dynein regulatory complex subunit 1 [Source:HGNC S... [more]
back to top
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG109582.360e-4625.60gene:FBgn0030004 transcript:FBtr0071153[more]
back to top
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
drc16.746e-12340.58dynein regulatory complex subunit 1 homolog (Chlam... [more]
back to top
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
DRC19.170e-13442.69dynein regulatory complex subunit 1 [Source:NCBI g... [more]
DRC13.198e-12241.07dynein regulatory complex subunit 1 [Source:NCBI g... [more]
back to top
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Drc11.680e-15241.93dynein regulatory complex subunit 1 [Source:MGI Sy... [more]
back to top
BLAST of Dynein regulatory complex protein 1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7T0Y4|DRC1_XENLA5.570e-16344.73Dynein regulatory complex protein 1 OS=Xenopus lae... [more]
sp|Q3USS3|DRC1_MOUSE1.175e-15141.93Dynein regulatory complex protein 1 OS=Mus musculu... [more]
sp|Q5XI65|DRC1_RAT6.179e-14841.69Dynein regulatory complex protein 1 OS=Rattus norv... [more]
sp|Q32KY1|DRC1_BOVIN2.897e-14644.38Dynein regulatory complex protein 1 OS=Bos taurus ... [more]
sp|Q96MC2|DRC1_HUMAN8.039e-14442.43Dynein regulatory complex protein 1 OS=Homo sapien... [more]
back to top
BLAST of Dynein regulatory complex protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|157509500.000e+048.54tr|R7US70|R7US70_CAPTE Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|211059840.000e+048.97tr|A0A2T7PEY8|A0A2T7PEY8_POMCA Uncharacterized pro... [more]
gnl|BL_ORD_ID|203388790.000e+046.02tr|A0A1S3J526|A0A1S3J526_LINUN dynein regulatory c... [more]
gnl|BL_ORD_ID|157968520.000e+049.04tr|A0A1I8HTF8|A0A1I8HTF8_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157728630.000e+049.04tr|A0A267DKT2|A0A267DKT2_9PLAT Uncharacterized pro... [more]
back to top
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
drc13.225e-12739.48dynein regulatory complex protein 1-like [Source:N... [more]
ENSAMXT00000026867.24.479e-3426.20dynein regulatory complex protein 1-like [Source:N... [more]
back to top
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000004667.16.777e-5433.05pep scaffold:Pmarinus_7.0:GL480581:13359:25845:-1 ... [more]
ENSPMAT00000003173.12.069e-4539.86pep scaffold:Pmarinus_7.0:GL476693:257328:263743:1... [more]
back to top
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO366693.049e-10343.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366703.027e-3756.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein regulatory complex protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000029891.11.539e-1326.33dynein regulatory complex subunit 1 [Source:NCBI g... [more]
ENSORLT00000046289.11.641e-1326.33dynein regulatory complex subunit 1 [Source:NCBI g... [more]
back to top
BLAST of Dynein regulatory complex protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000072168.10.000e+099.72SMESG000072168.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017180 ID=SMED30017180|Name=Dynein regulatory complex protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2420bp
CAACTAATTGAGCGTATTTAGAGCATTTAATTCATTACTTATAAAATATA
GACTTTAATAAAATTAAATATGAATAGTTTATTGAAGCAGTTACATCATG
TTGAAGATGAAGTTCAAGGTCCAAGTATTGACTCAGAGAATATGGAAGAA
AGAATTGAATGTCGACGGTTAAGAATTAAAAACAGATTAGAAAATCAAAG
ACGATTAGAGCGGGGGGAATTGGATTCAGATAAGGATAAAATGGTTGAAA
TGAGTAAAAGTAGAAAACAGGTCGAATTAAGTCGTATTAGGCTTAATAAG
TTAAATGATGATGGTATGGAATTCCTGACAAATGTCCGCGTCGCCAGCGA
TGCGAGAGAAAATGCACGTCGAGCCGAAGATGAAGAGCTCGCACGTGTCC
GTCGCGAGAAACTAGAGAATATTGCCAAAACTGGTTTGGACAGATTTGAG
GAGATTACAAAAAAGTGGGAAAGTGCATTGCAGAAGGAAGTACCCCAAGA
TCTTAATGAGATGTTACTCCAGCAAACCGATGCCTGCAATATCATGATTG
ACGAGAAGAACAAATTGATCACCGAATTACAGCTGGAATGCAAGGCAAAG
GATGATAGCTACGTTAAGGAATTGAAAAAACAATCTGATGATATGGACTT
GATGATTTTACGAATGAATGAACAAATTGACTGCATGAAAAGAGCTTATA
AAGAAGAATTATCCGAGGTTGAGAAAGCTTTCTTAACACAAAGAGATGAT
CTAATATTGTTGCAGAACAAAGAATGGACTGAATTATTGGATTCTATCAG
AAACAAGCAAATCGACTATTTAGACGCGAGGGCCAAGCGTGTCGATGAAA
ACGATTTACAAATTAGCACATTGAGAGCGTCTCATGCGGAGGAATACAAC
GCGTTGAAAATTAAACTGGAAACCGAAGTCCAAGTGCTCGAACAAAGCAT
TCAAAATGCCAAAGCAACATTCCAGTTGAATCTCGAGAAACTGGAATATA
ATTTCCAAGTTCTGAAGAAGCGGGATGAGGAGAACACGATCACGAAATCA
CAGCAAAAGAGAAAAATCACGAGAATGCAGGACAATCTAAATAATCTGAA
ATTGAAATTAGTGAAGGTGGAAAGGCAGTGCAAGTTGGACAACGAGCAGC
TGACGGAGGATTATAAGCGCCGCATGGAGCTGTTCCGGGAATTGCAGAGG
AAATCAAGGACTCTGCTCAAGGCTGATGCGAAACATTTCAAGGAAATTTG
GCTGATGAATGAGTCGGACATCCAGGAATATTCCCGCAAGATTTTAGCAG
CAGACCGCATAATCAGTGAGCAGCAACTCGGTCTCTCCTGGGTTTCTCCC
AACACGGAGTTCCTGCTCAATAAAGGACCGTTGATCACCGAAGAGGAAAA
GATGAAAGCGAAATCCGCTACGGAAGTGATTCGCGAAGTCCTGAAAAAAG
AAGAATCTATGCTGAAAACCAATGAAGACTCTTCTAATGAGGCCGCTACG
AGTGAGCGCTCAAGCACGATTCAATCTCTCCATCCGTCCACTGTCCGATC
ACTGTTGAACCTGATCTGTGATGAAGGCGCATTTCTCATCGAAGAAAAAT
TGAAGCGACTTCTCGAGCCGCTGGGAGAAAATGAGGCGAGCTTGATGAAA
TTGGATGCAATTTTCACGGCGCTCGGCATTGAGAATGAGGATGATATCAA
TAGGATGCTGCCATATTTCGTGATTCAGCTGTCGAATCCCGATTCCATGG
CTGCACAGGCTAGGATTACCGAGGACGTGTTTCAATTGGTGCAGAATGAG
TCCCTCTGCAAGAATGTCATCCACCCGACAATGATCGTACAAGCACTGCA
TGATTTCGTCACAGATTTCTATCAGGATGCTGCGGAAATGGAGAAGGCTT
TGGCTGCCCAGCAGGCGGACGATTTTCATTTGGACGCAGTTGACACGAGG
GATGATAGCCATGACACAGAGTATTGGCTGAAATACGAAAAGAATCTTAT
CGACGACAACAAGGAAACTGTCTGGGATGCATTGACAGTCTCTTTGGAAA
AGTATTTAAATATTTTGACCTTCCGAAAGAAGTTGTTAACCGACGTTGAT
GCCTTTAAAACTCAGAATAACGAGTTGCGATTTCTGCTTCAGCAGTACAT
GAGTTCATCAGTCAATCGGGAACTACAAGTTCCGCCATCAAAGGTGATTC
AATTAAACTAGAGAAATGCCAAGGATAACCTGTCCATTTTTGGGCATTGA
TTGGGTACTCAGCGGATATGTTGTGAATTATAATTATTGTAGGCCTTCTT
ACTGTTTGTATTGGTCACTTATCGCTCTCCTTTCATTATGGGCTACACCG
GGTTCCTCGGCCCCATTTCGTCTCTCGTCATTCATCTCAATTTCTCTAAT
AATTTTTTTGTTTAAACGAG
back to top

protein sequence of SMED30017180-orf-1

>SMED30017180-orf-1 ID=SMED30017180-orf-1|Name=SMED30017180-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=714bp
MNSLLKQLHHVEDEVQGPSIDSENMEERIECRRLRIKNRLENQRRLERGE
LDSDKDKMVEMSKSRKQVELSRIRLNKLNDDGMEFLTNVRVASDARENAR
RAEDEELARVRREKLENIAKTGLDRFEEITKKWESALQKEVPQDLNEMLL
QQTDACNIMIDEKNKLITELQLECKAKDDSYVKELKKQSDDMDLMILRMN
EQIDCMKRAYKEELSEVEKAFLTQRDDLILLQNKEWTELLDSIRNKQIDY
LDARAKRVDENDLQISTLRASHAEEYNALKIKLETEVQVLEQSIQNAKAT
FQLNLEKLEYNFQVLKKRDEENTITKSQQKRKITRMQDNLNNLKLKLVKV
ERQCKLDNEQLTEDYKRRMELFRELQRKSRTLLKADAKHFKEIWLMNESD
IQEYSRKILAADRIISEQQLGLSWVSPNTEFLLNKGPLITEEEKMKAKSA
TEVIREVLKKEESMLKTNEDSSNEAATSERSSTIQSLHPSTVRSLLNLIC
DEGAFLIEEKLKRLLEPLGENEASLMKLDAIFTALGIENEDDINRMLPYF
VIQLSNPDSMAAQARITEDVFQLVQNESLCKNVIHPTMIVQALHDFVTDF
YQDAAEMEKALAAQQADDFHLDAVDTRDDSHDTEYWLKYEKNLIDDNKET
VWDALTVSLEKYLNILTFRKKLLTDVDAFKTQNNELRFLLQQYMSSSVNR
ELQVPPSKVIQLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005858axonemal dynein complex
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005929cilium
GO:0005930axoneme
GO:0042995cell projection
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR039505DRC1/2_N
IPR039750DRC1/DRC2
IPR029440DRC1_C
Vocabulary: biological process
TermDefinition
GO:0060285cilium-dependent cell motility
GO:0070286axonemal dynein complex assembly
GO:0071973bacterial-type flagellum-dependent cell motility
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 37..57
NoneNo IPR availableCOILSCoilCoilcoord: 200..220
NoneNo IPR availableCOILSCoilCoilcoord: 273..300
NoneNo IPR availableCOILSCoilCoilcoord: 326..378
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 469..485
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 464..485
NoneNo IPR availablePANTHERPTHR21625:SF1DYNEIN REGULATORY COMPLEX PROTEIN 1coord: 18..709
IPR039505Dynein regulatory complex protein 1/2, N-terminalPFAMPF14772NYD-SP28coord: 92..191
e-value: 1.6E-27
score: 95.5
IPR029440Dynein regulatory complex protein 1, C-terminalPFAMPF14775NYD-SP28_assoccoord: 634..694
e-value: 9.9E-16
score: 57.6
IPR039750Dynein regulatory complex proteinPANTHERPTHR21625NYD-SP28 PROTEINcoord: 18..709