ras GTPase-activating protein nGAP isoform X8

Overview
Nameras GTPase-activating protein nGAP isoform X8
Smed IDSMED30017175
Length (bp)4815
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ras GTPase-activating protein nGAP isoform X8 (SMED30017175) t-SNE clustered cells

Violin plots show distribution of expression levels for ras GTPase-activating protein nGAP isoform X8 (SMED30017175) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ras GTPase-activating protein nGAP isoform X8 (SMED30017175) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ras GTPase-activating protein nGAP isoform X8 (SMED30017175) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017175

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30017175SMESG000037132.1 SMESG000037110.1 dd_Smed_v4_6499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017175SMESG000037132.1 SMESG000037110.1 dd_Smed_v4_6499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017175SMESG000037132.1 SMESG000037110.1 dd_Smed_v4_6499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017175SMESG000037132.1 SMESG000037110.1 dd_Smed_v4_6499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30017175SMESG000037132.1 SMESG000037110.1 dd_Smed_v4_6499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30017175SMESG000037132.1 SMESG000037110.1 dd_Smed_v4_6499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30017175SMESG000037132.1 SMESG000037110.1 dd_Smed_v4_6499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017175SMESG000037132.1 SMESG000037110.1 dd_Smed_v4_6499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017175SMESG000037132.1 SMESG000037110.1 dd_Smed_v4_6499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30017175SMESG000037132.1 SMESG000037110.1 dd_Smed_v4_6499_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30017175SMESG000037132.1 SMESG000037110.1 dd_Smed_v4_6499_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Human
Match: DAB2IP (DAB2 interacting protein [Source:HGNC Symbol;Acc:HGNC:17294])

HSP 1 Score: 332.028 bits (850), Expect = 3.454e-94
Identity = 194/494 (39.27%), Postives = 274/494 (55.47%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LW+ EAK++P KK+Y CE+ LD+ L+A+TT K  TD +FWGE F   +L  + TVT+ L++   +   KKKK ++  +  V++    ++ R  VE+WYP   + N  G                                             PMIRIKARYQ I +LP+  Y    E +  H + L   ++  L  K KE++A +L+++L   G   +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S + L E Q                    +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:   91 FSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYR---ETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPV-VTPNPKG----------------------------------------GKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SAADLPEHQG-------------------NLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 505          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Human
Match: DAB2IP (DAB2 interacting protein [Source:HGNC Symbol;Acc:HGNC:17294])

HSP 1 Score: 332.028 bits (850), Expect = 3.564e-94
Identity = 194/494 (39.27%), Postives = 274/494 (55.47%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LW+ EAK++P KK+Y CE+ LD+ L+A+TT K  TD +FWGE F   +L  + TVT+ L++   +   KKKK ++  +  V++    ++ R  VE+WYP   + N  G                                             PMIRIKARYQ I +LP+  Y    E +  H + L   ++  L  K KE++A +L+++L   G   +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S + L E                    Q +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:   58 FSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYR---ETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPV-VTPNPKG----------------------------------------GKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SAADLPE-------------------HQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 472          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Human
Match: DAB2IP (DAB2 interacting protein [Source:HGNC Symbol;Acc:HGNC:17294])

HSP 1 Score: 332.028 bits (850), Expect = 7.453e-94
Identity = 194/494 (39.27%), Postives = 274/494 (55.47%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LW+ EAK++P KK+Y CE+ LD+ L+A+TT K  TD +FWGE F   +L  + TVT+ L++   +   KKKK ++  +  V++    ++ R  VE+WYP   + N  G                                             PMIRIKARYQ I +LP+  Y    E +  H + L   ++  L  K KE++A +L+++L   G   +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S + L E Q                    +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:  154 FSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYR---ETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPV-VTPNPKG----------------------------------------GKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SAADLPEHQG-------------------NLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 568          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Human
Match: DAB2IP (DAB2 interacting protein [Source:HGNC Symbol;Acc:HGNC:17294])

HSP 1 Score: 332.028 bits (850), Expect = 8.409e-94
Identity = 194/494 (39.27%), Postives = 274/494 (55.47%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LW+ EAK++P KK+Y CE+ LD+ L+A+TT K  TD +FWGE F   +L  + TVT+ L++ +     KKKK ++  +  V++    ++ R  VE+WYP   + N  G                                             PMIRIKARYQ I +LP+  Y    E +  H + L   ++  L  K KE++A +L+++L   G   +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S + L E                    Q +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:  121 FSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDK---KKKKERNSYLGLVSLPAASVAGRQFVEKWYPV-VTPNPKG----------------------------------------GKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SAADLPE-------------------HQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 535          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Human
Match: DAB2IP (DAB2 interacting protein [Source:HGNC Symbol;Acc:HGNC:17294])

HSP 1 Score: 332.798 bits (852), Expect = 1.027e-93
Identity = 194/494 (39.27%), Postives = 274/494 (55.47%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LW+ EAK++P KK+Y CE+ LD+ L+A+TT K  TD +FWGE F   +L  + TVT+ L++   +   KKKK ++  +  V++    ++ R  VE+WYP   + N  G                                             PMIRIKARYQ I +LP+  Y    E +  H + L   ++  L  K KE++A +L+++L   G   +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S + L E Q                    +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:  182 FSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYR---ETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPV-VTPNPKG----------------------------------------GKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SAADLPEHQG-------------------NLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 596          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Celegans
Match: gap-2 (Ras GTPase-activating protein gap-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MLZ5])

HSP 1 Score: 340.117 bits (871), Expect = 2.824e-98
Identity = 201/521 (38.58%), Postives = 305/521 (58.54%), Query Frame = 3
Query: 1305 LLAYVFSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKE 2867
            L +  +SC +  ER KW+  L + + P    +RR E S+ +WI EAK +P K++Y+CE+ LD+TL+AKT++K  TD +FWGE F    L +++ V + L++ S    +KKKK    LI  V I    +S+R+ VERWY  + S++ SGT                            + ++ +    S+S   P +RIKAR+Q++ +LP+  Y +LLE L  + + L  +++  L V++KEDLA SL+ V++K  +A EFL DL+ +E++K DN++++ RGNT+A+KA+E ++KL+ + YL   LSDF+  + Q ++ CEVDPQ  K    SNSSL + ++L                   LM  V++ W KIL++    P+ L+ VF +LR RLE  +R A         L + ++SS IFLRF+CPAIL+PSLF L+ EYP +P   R  TL+AK +Q+LANFS   G KE +M FMN F++ ++  M+ FL  ISS +    S  + N  + VDA KE
Sbjct:   99 LASTYYSCRTPLERAKWMENLRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSKARTDNVFWGENFEFMMLPKIDEVCVSLFRESD---SKKKKDT--LIGYVTIGIDQLSSRSPVERWYTVNTSHSDSGT----------------------------SRIASALGGKSSSQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKLDNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQ--KLGNVSNSSLEKNRAL-------------------LMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREA---------LADTLISSSIFLRFLCPAILSPSLFNLVSEYP-SPTNARNLTLIAKTLQNLANFSKF-GGKEPHMEFMNEFVDREWHRMKDFLLRISSESK---SGPEKNADAIVDAGKE 551          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Celegans
Match: gap-2 (Ras GTPase-activating protein gap-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MLZ5])

HSP 1 Score: 340.117 bits (871), Expect = 3.323e-98
Identity = 201/521 (38.58%), Postives = 305/521 (58.54%), Query Frame = 3
Query: 1305 LLAYVFSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKE 2867
            L +  +SC +  ER KW+  L + + P    +RR E S+ +WI EAK +P K++Y+CE+ LD+TL+AKT++K  TD +FWGE F    L +++ V + L++ S    +KKKK    LI  V I    +S+R+ VERWY  + S++ SGT                            + ++ +    S+S   P +RIKAR+Q++ +LP+  Y +LLE L  + + L  +++  L V++KEDLA SL+ V++K  +A EFL DL+ +E++K DN++++ RGNT+A+KA+E ++KL+ + YL   LSDF+  + Q ++ CEVDPQ  K    SNSSL + ++L                   LM  V++ W KIL++    P+ L+ VF +LR RLE  +R A         L + ++SS IFLRF+CPAIL+PSLF L+ EYP +P   R  TL+AK +Q+LANFS   G KE +M FMN F++ ++  M+ FL  ISS +    S  + N  + VDA KE
Sbjct:  107 LASTYYSCRTPLERAKWMENLRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSKARTDNVFWGENFEFMMLPKIDEVCVSLFRESD---SKKKKDT--LIGYVTIGIDQLSSRSPVERWYTVNTSHSDSGT----------------------------SRIASALGGKSSSQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKLDNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQ--KLGNVSNSSLEKNRAL-------------------LMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREA---------LADTLISSSIFLRFLCPAILSPSLFNLVSEYP-SPTNARNLTLIAKTLQNLANFSKF-GGKEPHMEFMNEFVDREWHRMKDFLLRISSESK---SGPEKNADAIVDAGKE 559          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Celegans
Match: gap-2 (Ras GTPase-activating protein gap-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MLZ5])

HSP 1 Score: 341.273 bits (874), Expect = 7.274e-98
Identity = 201/521 (38.58%), Postives = 305/521 (58.54%), Query Frame = 3
Query: 1305 LLAYVFSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKE 2867
            L +  +SC +  ER KW+  L + + P    +RR E S+ +WI EAK +P K++Y+CE+ LD+TL+AKT++K  TD +FWGE F    L +++ V + L++ S    +KKKK    LI  V I    +S+R+ VERWY  + S++ SGT                            + ++ +    S+S   P +RIKAR+Q++ +LP+  Y +LLE L  + + L  +++  L V++KEDLA SL+ V++K  +A EFL DL+ +E++K DN++++ RGNT+A+KA+E ++KL+ + YL   LSDF+  + Q ++ CEVDPQ  K    SNSSL + ++L                   LM  V++ W KIL++    P+ L+ VF +LR RLE  +R A         L + ++SS IFLRF+CPAIL+PSLF L+ EYP +P   R  TL+AK +Q+LANFS   G KE +M FMN F++ ++  M+ FL  ISS +    S  + N  + VDA KE
Sbjct:  199 LASTYYSCRTPLERAKWMENLRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSKARTDNVFWGENFEFMMLPKIDEVCVSLFRESD---SKKKKDT--LIGYVTIGIDQLSSRSPVERWYTVNTSHSDSGT----------------------------SRIASALGGKSSSQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKLDNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQ--KLGNVSNSSLEKNRAL-------------------LMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREA---------LADTLISSSIFLRFLCPAILSPSLFNLVSEYP-SPTNARNLTLIAKTLQNLANFSKF-GGKEPHMEFMNEFVDREWHRMKDFLLRISSESK---SGPEKNADAIVDAGKE 651          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Celegans
Match: gap-2 (Ras GTPase-activating protein gap-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MLZ5])

HSP 1 Score: 341.273 bits (874), Expect = 1.360e-97
Identity = 201/521 (38.58%), Postives = 305/521 (58.54%), Query Frame = 3
Query: 1305 LLAYVFSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKE 2867
            L +  +SC +  ER KW+  L + + P    +RR E S+ +WI EAK +P K++Y+CE+ LD+TL+AKT++K  TD +FWGE F    L +++ V + L++ S    +KKKK    LI  V I    +S+R+ VERWY  + S++ SGT                            + ++ +    S+S   P +RIKAR+Q++ +LP+  Y +LLE L  + + L  +++  L V++KEDLA SL+ V++K  +A EFL DL+ +E++K DN++++ RGNT+A+KA+E ++KL+ + YL   LSDF+  + Q ++ CEVDPQ  K    SNSSL + ++L                   LM  V++ W KIL++    P+ L+ VF +LR RLE  +R A         L + ++SS IFLRF+CPAIL+PSLF L+ EYP +P   R  TL+AK +Q+LANFS   G KE +M FMN F++ ++  M+ FL  ISS +    S  + N  + VDA KE
Sbjct:  239 LASTYYSCRTPLERAKWMENLRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSKARTDNVFWGENFEFMMLPKIDEVCVSLFRESD---SKKKKDT--LIGYVTIGIDQLSSRSPVERWYTVNTSHSDSGT----------------------------SRIASALGGKSSSQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKLDNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQ--KLGNVSNSSLEKNRAL-------------------LMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREA---------LADTLISSSIFLRFLCPAILSPSLFNLVSEYP-SPTNARNLTLIAKTLQNLANFSKF-GGKEPHMEFMNEFVDREWHRMKDFLLRISSESK---SGPEKNADAIVDAGKE 691          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Celegans
Match: gap-2 (Ras GTPase-activating protein gap-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MLZ5])

HSP 1 Score: 341.658 bits (875), Expect = 2.090e-97
Identity = 201/521 (38.58%), Postives = 305/521 (58.54%), Query Frame = 3
Query: 1305 LLAYVFSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKE 2867
            L +  +SC +  ER KW+  L + + P    +RR E S+ +WI EAK +P K++Y+CE+ LD+TL+AKT++K  TD +FWGE F    L +++ V + L++ S    +KKKK    LI  V I    +S+R+ VERWY  + S++ SGT                            + ++ +    S+S   P +RIKAR+Q++ +LP+  Y +LLE L  + + L  +++  L V++KEDLA SL+ V++K  +A EFL DL+ +E++K DN++++ RGNT+A+KA+E ++KL+ + YL   LSDF+  + Q ++ CEVDPQ  K    SNSSL + ++L                   LM  V++ W KIL++    P+ L+ VF +LR RLE  +R A         L + ++SS IFLRF+CPAIL+PSLF L+ EYP +P   R  TL+AK +Q+LANFS   G KE +M FMN F++ ++  M+ FL  ISS +    S  + N  + VDA KE
Sbjct:  288 LASTYYSCRTPLERAKWMENLRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSKARTDNVFWGENFEFMMLPKIDEVCVSLFRESD---SKKKKDT--LIGYVTIGIDQLSSRSPVERWYTVNTSHSDSGT----------------------------SRIASALGGKSSSQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKLDNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQ--KLGNVSNSSLEKNRAL-------------------LMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREA---------LADTLISSSIFLRFLCPAILSPSLFNLVSEYP-SPTNARNLTLIAKTLQNLANFSKF-GGKEPHMEFMNEFVDREWHRMKDFLLRISSESK---SGPEKNADAIVDAGKE 740          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Fly
Match: raskol (gene:FBgn0261570 transcript:FBtr0302836)

HSP 1 Score: 315.849 bits (808), Expect = 4.160e-87
Identity = 168/494 (34.01%), Postives = 279/494 (56.48%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISS 2801
            +SC S  ER  W+  L + + PN ++ RR + SL +W+ EAKN+P KKRYFCE+ LD+TL+ +T+ K  TDLLFWGE F+   + ++N +T+ +++   +   KKK+ ++  +  V I   D+++R   E+WYP     + +G  +                                 +   + + LP +RIK R+Q+ D+LPIN Y + L +LK++  ++   ++  + VK KED+  +L+ ++H QG+A  FL+D++  ++ +  ++ +  RGN++A+K++E +LKL GE+YL   LS  +N + Q + DCEVDP ++     S SS    Q                ++Q +L   V   W  I  S  +FP +L++ F + R+RL+Q+ R          ++ + ++S+ IFLRF+CPAIL+PSLF +  E P + +  R  TLVAK +Q+LANF+   G KE++M F+N F+E +   MQ FL+ IS+
Sbjct:  274 YSCGSRQERDLWIYSLRKSIAPNAEHTRRTDNSLKMWVYEAKNLPPKKRYFCELQLDKTLYGRTSVKLQTDLLFWGEHFDFPDIPEINVITVNVFR---EVDKKKKRDKYQFVGSVKIPVHDVTSRLPCEQWYP--ILSDKAGDSL-------------------------GRTSGGGGSGSKDKEQLPTLRIKCRFQSTDILPINVYGNFLTYLKENYKRVCETLEPVIGVKAKEDIGQALVLLMHAQGLAGAFLTDVVALDLLRVGDQRLTFRGNSLATKSMEAFLKLTGEQYLQDTLSAPINELIQSERDCEVDPTKT-----SGSSAGSLQ----------------RQQAALRGAVRGAWQCIFESHKHFPAQLRNCFATFRERLQQLGR---------QDMADNLISASIFLRFLCPAILSPSLFNITSELP-SARATRNLTLVAKTLQTLANFTRFQG-KENFMEFLNDFLEQEAARMQQFLEIIST 705          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Fly
Match: raskol (gene:FBgn0261570 transcript:FBtr0340629)

HSP 1 Score: 315.464 bits (807), Expect = 5.179e-87
Identity = 169/495 (34.14%), Postives = 280/495 (56.57%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMN-VDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISS 2801
            +SC S  ER  W+  L + + PN ++ RR + SL +W+ EAKN+P KKRYFCE+ LD+TL+ +T+ K  TDLLFWGE F+   + ++N +T+ +++   +   KKK+ ++  +  V I   D+++R   E+WYP     + +G  +                                 +   + + LP +RIK R+Q+ D+LPIN Y + L +LK++  ++   ++  + VK KED+  +L+ ++H QG+A  FL+D++  ++ +  ++ +  RGN++A+K++E +LKL GE+YL   LS  +N + Q + DCEVDP ++     S SS                    LQRQ++ +   V   W  I  S  +FP +L++ F + R+RL+Q+ R          ++ + ++S+ IFLRF+CPAIL+PSLF +  E P + +  R  TLVAK +Q+LANF+   G KE++M F+N F+E +   MQ FL+ IS+
Sbjct:  274 YSCGSRQERDLWIYSLRKSIAPNAEHTRRTDNSLKMWVYEAKNLPPKKRYFCELQLDKTLYGRTSVKLQTDLLFWGEHFDFPDIPEINVITVNVFR---EVDKKKKRDKYQFVGSVKIPVHDVTSRLPCEQWYP--ILSDKAGDSL-------------------------GRTSGGGGSGSKDKEQLPTLRIKCRFQSTDILPINVYGNFLTYLKENYKRVCETLEPVIGVKAKEDIGQALVLLMHAQGLAGAFLTDVVALDLLRVGDQRLTFRGNSLATKSMEAFLKLTGEQYLQDTLSAPINELIQSERDCEVDPTKT-----SGSSAGS-----------------LQRQQAALRGAVRGAWQCIFESHKHFPAQLRNCFATFRERLQQLGR---------QDMADNLISASIFLRFLCPAILSPSLFNITSELP-SARATRNLTLVAKTLQTLANFTRFQG-KENFMEFLNDFLEQEAARMQQFLEIIST 705          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Fly
Match: raskol (gene:FBgn0261570 transcript:FBtr0302834)

HSP 1 Score: 314.309 bits (804), Expect = 1.119e-86
Identity = 168/494 (34.01%), Postives = 279/494 (56.48%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISS 2801
            +SC S  ER  W+  L + + PN ++ RR + SL +W+ EAKN+P KKRYFCE+ LD+TL+ +T+ K  TDLLFWGE F+   + ++N +T+ +++   +   KKK+ ++  +  V I   D+++R   E+WYP     + +G  +                                 +   + + LP +RIK R+Q+ D+LPIN Y + L +LK++  ++   ++  + VK KED+  +L+ ++H QG+A  FL+D++  ++ +  ++ +  RGN++A+K++E +LKL GE+YL   LS  +N + Q + DCEVDP ++     S SS    Q                ++Q +L   V   W  I  S  +FP +L++ F + R+RL+Q+ R          ++ + ++S+ IFLRF+CPAIL+PSLF +  E P + +  R  TLVAK +Q+LANF+   G KE++M F+N F+E +   MQ FL+ IS+
Sbjct:  247 YSCGSRQERDLWIYSLRKSIAPNAEHTRRTDNSLKMWVYEAKNLPPKKRYFCELQLDKTLYGRTSVKLQTDLLFWGEHFDFPDIPEINVITVNVFR---EVDKKKKRDKYQFVGSVKIPVHDVTSRLPCEQWYPILS--DKAGDSL-------------------------GRTSGGGGSGSKDKEQLPTLRIKCRFQSTDILPINVYGNFLTYLKENYKRVCETLEPVIGVKAKEDIGQALVLLMHAQGLAGAFLTDVVALDLLRVGDQRLTFRGNSLATKSMEAFLKLTGEQYLQDTLSAPINELIQSERDCEVDPTKT-----SGSSAGSLQ----------------RQQAALRGAVRGAWQCIFESHKHFPAQLRNCFATFRERLQQLGR---------QDMADNLISASIFLRFLCPAILSPSLFNITSELP-SARATRNLTLVAKTLQTLANFTRFQG-KENFMEFLNDFLEQEAARMQQFLEIIST 678          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Fly
Match: raskol (gene:FBgn0261570 transcript:FBtr0340631)

HSP 1 Score: 313.923 bits (803), Expect = 1.257e-86
Identity = 168/494 (34.01%), Postives = 279/494 (56.48%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISS 2801
            +SC S  ER  W+  L + + PN ++ RR + SL +W+ EAKN+P KKRYFCE+ LD+TL+ +T+ K  TDLLFWGE F+   + ++N +T+ +++   +   KKK+ ++  +  V I   D+++R   E+WYP     + +G  +                                 +   + + LP +RIK R+Q+ D+LPIN Y + L +LK++  ++   ++  + VK KED+  +L+ ++H QG+A  FL+D++  ++ +  ++ +  RGN++A+K++E +LKL GE+YL   LS  +N + Q + DCEVDP ++     S SS    Q                ++Q +L   V   W  I  S  +FP +L++ F + R+RL+Q+ R          ++ + ++S+ IFLRF+CPAIL+PSLF +  E P + +  R  TLVAK +Q+LANF+   G KE++M F+N F+E +   MQ FL+ IS+
Sbjct:  247 YSCGSRQERDLWIYSLRKSIAPNAEHTRRTDNSLKMWVYEAKNLPPKKRYFCELQLDKTLYGRTSVKLQTDLLFWGEHFDFPDIPEINVITVNVFR---EVDKKKKRDKYQFVGSVKIPVHDVTSRLPCEQWYPILS--DKAGDSL-------------------------GRTSGGGGSGSKDKEQLPTLRIKCRFQSTDILPINVYGNFLTYLKENYKRVCETLEPVIGVKAKEDIGQALVLLMHAQGLAGAFLTDVVALDLLRVGDQRLTFRGNSLATKSMEAFLKLTGEQYLQDTLSAPINELIQSERDCEVDPTKT-----SGSSAGSLQ----------------RQQAALRGAVRGAWQCIFESHKHFPAQLRNCFATFRERLQQLGR---------QDMADNLISASIFLRFLCPAILSPSLFNITSELP-SARATRNLTLVAKTLQTLANFTRFQG-KENFMEFLNDFLEQEAARMQQFLEIIST 678          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Fly
Match: raskol (gene:FBgn0261570 transcript:FBtr0302835)

HSP 1 Score: 314.309 bits (804), Expect = 1.270e-86
Identity = 168/494 (34.01%), Postives = 279/494 (56.48%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISS 2801
            +SC S  ER  W+  L + + PN ++ RR + SL +W+ EAKN+P KKRYFCE+ LD+TL+ +T+ K  TDLLFWGE F+   + ++N +T+ +++   +   KKK+ ++  +  V I   D+++R   E+WYP     + +G  +                                 +   + + LP +RIK R+Q+ D+LPIN Y + L +LK++  ++   ++  + VK KED+  +L+ ++H QG+A  FL+D++  ++ +  ++ +  RGN++A+K++E +LKL GE+YL   LS  +N + Q + DCEVDP ++     S SS    Q                ++Q +L   V   W  I  S  +FP +L++ F + R+RL+Q+ R          ++ + ++S+ IFLRF+CPAIL+PSLF +  E P + +  R  TLVAK +Q+LANF+   G KE++M F+N F+E +   MQ FL+ IS+
Sbjct:  271 YSCGSRQERDLWIYSLRKSIAPNAEHTRRTDNSLKMWVYEAKNLPPKKRYFCELQLDKTLYGRTSVKLQTDLLFWGEHFDFPDIPEINVITVNVFR---EVDKKKKRDKYQFVGSVKIPVHDVTSRLPCEQWYPILS--DKAGDSL-------------------------GRTSGGGGSGSKDKEQLPTLRIKCRFQSTDILPINVYGNFLTYLKENYKRVCETLEPVIGVKAKEDIGQALVLLMHAQGLAGAFLTDVVALDLLRVGDQRLTFRGNSLATKSMEAFLKLTGEQYLQDTLSAPINELIQSERDCEVDPTKT-----SGSSAGSLQ----------------RQQAALRGAVRGAWQCIFESHKHFPAQLRNCFATFRERLQQLGR---------QDMADNLISASIFLRFLCPAILSPSLFNITSELP-SARATRNLTLVAKTLQTLANFTRFQG-KENFMEFLNDFLEQEAARMQQFLEIIST 702          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Zebrafish
Match: dab2ipa (DAB2 interacting protein a [Source:ZFIN;Acc:ZDB-GENE-081104-516])

HSP 1 Score: 331.257 bits (848), Expect = 1.005e-93
Identity = 195/494 (39.47%), Postives = 283/494 (57.29%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L  WI EAK++P KK+YFCE+ LD+TL+A+TT K  TD +FWGE F   +L  V ++T+ L+K   +   KKKK +++ +  VNI    ++ R  VE+WY  S    + G                                             PM+R+K+RYQ++ +LP+  Y    E++  + + +   ++  L VKNKE++A +L+++L   G A +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S+S L+E QS                   +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF L+ EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:  126 FSCRSAAERDKWMENLRRAVHPNKDNTRRVENMLKCWIIEAKDLPAKKKYFCELCLDDTLYARTTCKLKTDNVFWGEHFEFNNLPSVKSITVHLYK---ETDKKKKKDKNNYVGLVNIPIATVTGRQFVEKWYSVSTPNPNKG-----------------------------------------KSPGPMVRMKSRYQSMSILPMELYKEFAEYITNNYMLMCSVLEPALSVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SSSDLHEHQS-------------------NLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGR---------PDISERLISASLFLRFLCPAIMSPSLFSLMQEYPDD-RTARTLTLIAKVTQNLANFTKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 540          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Zebrafish
Match: dab2ipa (DAB2 interacting protein a [Source:ZFIN;Acc:ZDB-GENE-081104-516])

HSP 1 Score: 331.257 bits (848), Expect = 1.154e-93
Identity = 195/494 (39.47%), Postives = 283/494 (57.29%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L  WI EAK++P KK+YFCE+ LD+TL+A+TT K  TD +FWGE F   +L  V ++T+ L+K   +   KKKK +++ +  VNI    ++ R  VE+WY  S    + G                                             PM+R+K+RYQ++ +LP+  Y    E++  + + +   ++  L VKNKE++A +L+++L   G A +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S+S L+E QS                   +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF L+ EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:  138 FSCRSAAERDKWMENLRRAVHPNKDNTRRVENMLKCWIIEAKDLPAKKKYFCELCLDDTLYARTTCKLKTDNVFWGEHFEFNNLPSVKSITVHLYK---ETDKKKKKDKNNYVGLVNIPIATVTGRQFVEKWYSVSTPNPNKG-----------------------------------------KSPGPMVRMKSRYQSMSILPMELYKEFAEYITNNYMLMCSVLEPALSVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SSSDLHEHQS-------------------NLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGR---------PDISERLISASLFLRFLCPAIMSPSLFSLMQEYPDD-RTARTLTLIAKVTQNLANFTKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 552          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Zebrafish
Match: dab2ipb (DAB2 interacting protein b [Source:ZFIN;Acc:ZDB-GENE-030131-2449])

HSP 1 Score: 325.479 bits (833), Expect = 5.833e-92
Identity = 193/494 (39.07%), Postives = 284/494 (57.49%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R + PN  N RR E  L LWI EAK++P KK+YFCE+ LD++L+A+TT K  TD +FWGE F   +L  V ++T+ +++   D+  KKKK +++ +  V+I    +++R  VE+WYP S                                     N  +  A+       PM+RIKARYQ++++LP+  Y    E+   + + L   ++  + VKNKE++A +L+++L   G A +FL+DL+  E+ +  +NE++I R NT+ +KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S+S L E QS                   +L M  ++ + KI+ S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF L  EYPD+ +  RT TL+AK  Q+LANF+   G+KE YM FMN F+E ++T MQ FL EIS
Sbjct:  110 FSCRSAAERDKWMENLRRAIHPNKDNSRRVENMLRLWIIEAKDLPAKKKYFCELCLDDSLYARTTCKMKTDNVFWGEHFEFNNLPAVQSITVHVYR---DSDKKKKKDKNNYVGLVSIPVVTVTSRQLVEKWYPVS-----------------------------------QPNPGKGKAAG------PMVRIKARYQSMNILPMELYKEFAEYTTNNYMLLCSVLEPVISVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLGTKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SSSDLPEHQS-------------------NLRMCCELAFCKIIESYRVFPRELKEVFASWRQECGNRGRP---------DISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTKF-GNKEEYMSFMNQFLEQEWTNMQRFLLEIS 524          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Zebrafish
Match: dab2ipb (DAB2 interacting protein b [Source:ZFIN;Acc:ZDB-GENE-030131-2449])

HSP 1 Score: 325.865 bits (834), Expect = 8.953e-92
Identity = 193/494 (39.07%), Postives = 284/494 (57.49%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R + PN  N RR E  L LWI EAK++P KK+YFCE+ LD++L+A+TT K  TD +FWGE F   +L  V ++T+ +++   D+  KKKK +++ +  V+I    +++R  VE+WYP S                                     N  +  A+       PM+RIKARYQ++++LP+  Y    E+   + + L   ++  + VKNKE++A +L+++L   G A +FL+DL+  E+ +  +NE++I R NT+ +KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S+S L E QS                   +L M  ++ + KI+ S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF L  EYPD+ +  RT TL+AK  Q+LANF+   G+KE YM FMN F+E ++T MQ FL EIS
Sbjct:  153 FSCRSAAERDKWMENLRRAIHPNKDNSRRVENMLRLWIIEAKDLPAKKKYFCELCLDDSLYARTTCKMKTDNVFWGEHFEFNNLPAVQSITVHVYR---DSDKKKKKDKNNYVGLVSIPVVTVTSRQLVEKWYPVS-----------------------------------QPNPGKGKAAG------PMVRIKARYQSMNILPMELYKEFAEYTTNNYMLLCSVLEPVISVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLGTKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SSSDLPEHQS-------------------NLRMCCELAFCKIIESYRVFPRELKEVFASWRQECGNRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTKF-GNKEEYMSFMNQFLEQEWTNMQRFLLEIS 567          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Zebrafish
Match: dab2ipb (DAB2 interacting protein b [Source:ZFIN;Acc:ZDB-GENE-030131-2449])

HSP 1 Score: 325.479 bits (833), Expect = 1.499e-91
Identity = 193/494 (39.07%), Postives = 284/494 (57.49%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R + PN  N RR E  L LWI EAK++P KK+YFCE+ LD++L+A+TT K  TD +FWGE F   +L  V ++T+ +++   D+  KKKK +++ +  V+I    +++R  VE+WYP S                                     N  +  A+       PM+RIKARYQ++++LP+  Y    E+   + + L   ++  + VKNKE++A +L+++L   G A +FL+DL+  E+ +  +NE++I R NT+ +KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S+S L E QS                   +L M  ++ + KI+ S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF L  EYPD+ +  RT TL+AK  Q+LANF+   G+KE YM FMN F+E ++T MQ FL EIS
Sbjct:  181 FSCRSAAERDKWMENLRRAIHPNKDNSRRVENMLRLWIIEAKDLPAKKKYFCELCLDDSLYARTTCKMKTDNVFWGEHFEFNNLPAVQSITVHVYR---DSDKKKKKDKNNYVGLVSIPVVTVTSRQLVEKWYPVS-----------------------------------QPNPGKGKAAG------PMVRIKARYQSMNILPMELYKEFAEYTTNNYMLLCSVLEPVISVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLGTKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SSSDLPEHQS-------------------NLRMCCELAFCKIIESYRVFPRELKEVFASWRQECGNRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTKF-GNKEEYMSFMNQFLEQEWTNMQRFLLEIS 595          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Xenopus
Match: DAB2IP (DAB2 interacting protein [Source:NCBI gene;Acc:100145038])

HSP 1 Score: 329.717 bits (844), Expect = 1.216e-93
Identity = 198/494 (40.08%), Postives = 280/494 (56.68%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LWI EAK++P KK+Y CE+YLD+ L+A+TT K  TD +FWGE F   +L  + ++T+ L+K   +   KKKK +++ +  V+I    ++ R  VE+WYP      S G                                             PMIRIK RYQ+I +LP+  Y    E++  + + L   ++  L VKNKE++A +L+++L   G A +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  +KC   S S L E QS                   +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:   58 FSCRSAAERDKWMENLRRAVHPNKDNSRRIENMLKLWIIEAKDLPAKKKYLCELYLDDILYARTTCKLKTDNVFWGEHFEFNNLPTLKSITVHLYK---ETDKKKKKDKNNYVGLVSIPIGAVTGRLFVEKWYPIVTPNPSKGKSCG-----------------------------------------PMIRIKTRYQSISILPMEMYKEFAEYITNNYMVLCSTLEGILSVKNKEEMASALVHILQSTGKAKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--NKC---STSDLPEHQS-------------------NLKMCCELAFCKIINSYCVFPRELKEVFASWRQECNSRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 472          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Xenopus
Match: DAB2IP (DAB2 interacting protein [Source:NCBI gene;Acc:100145038])

HSP 1 Score: 329.717 bits (844), Expect = 1.618e-93
Identity = 198/494 (40.08%), Postives = 280/494 (56.68%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LWI EAK++P KK+Y CE+YLD+ L+A+TT K  TD +FWGE F   +L  + ++T+ L+K   +   KKKK +++ +  V+I    ++ R  VE+WYP      S G                                             PMIRIK RYQ+I +LP+  Y    E++  + + L   ++  L VKNKE++A +L+++L   G A +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  +KC   S S L E QS                   +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:   79 FSCRSAAERDKWMENLRRAVHPNKDNSRRIENMLKLWIIEAKDLPAKKKYLCELYLDDILYARTTCKLKTDNVFWGEHFEFNNLPTLKSITVHLYK---ETDKKKKKDKNNYVGLVSIPIGAVTGRLFVEKWYPIVTPNPSKGKSCG-----------------------------------------PMIRIKTRYQSISILPMEMYKEFAEYITNNYMVLCSTLEGILSVKNKEEMASALVHILQSTGKAKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--NKC---STSDLPEHQS-------------------NLKMCCELAFCKIINSYCVFPRELKEVFASWRQECNSRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 493          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Xenopus
Match: DAB2IP (DAB2 interacting protein [Source:NCBI gene;Acc:100145038])

HSP 1 Score: 329.717 bits (844), Expect = 1.975e-93
Identity = 198/494 (40.08%), Postives = 280/494 (56.68%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LWI EAK++P KK+Y CE+YLD+ L+A+TT K  TD +FWGE F   +L  + ++T+ L+K   +   KKKK +++ +  V+I    ++ R  VE+WYP      S G                                             PMIRIK RYQ+I +LP+  Y    E++  + + L   ++  L VKNKE++A +L+++L   G A +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  +KC   S S L E QS                   +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:   72 FSCRSAAERDKWMENLRRAVHPNKDNSRRIENMLKLWIIEAKDLPAKKKYLCELYLDDILYARTTCKLKTDNVFWGEHFEFNNLPTLKSITVHLYK---ETDKKKKKDKNNYVGLVSIPIGAVTGRLFVEKWYPIVTPNPSKGKSCG-----------------------------------------PMIRIKTRYQSISILPMEMYKEFAEYITNNYMVLCSTLEGILSVKNKEEMASALVHILQSTGKAKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--NKC---STSDLPEHQS-------------------NLKMCCELAFCKIINSYCVFPRELKEVFASWRQECNSRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 486          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Xenopus
Match: DAB2IP (DAB2 interacting protein [Source:NCBI gene;Acc:100145038])

HSP 1 Score: 329.331 bits (843), Expect = 2.022e-93
Identity = 198/494 (40.08%), Postives = 280/494 (56.68%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LWI EAK++P KK+Y CE+YLD+ L+A+TT K  TD +FWGE F   +L  + ++T+ L+K   +   KKKK +++ +  V+I    ++ R  VE+WYP      S G                                             PMIRIK RYQ+I +LP+  Y    E++  + + L   ++  L VKNKE++A +L+++L   G A +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  +KC   S S L E QS                   +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:   58 FSCRSAAERDKWMENLRRAVHPNKDNSRRIENMLKLWIIEAKDLPAKKKYLCELYLDDILYARTTCKLKTDNVFWGEHFEFNNLPTLKSITVHLYK---ETDKKKKKDKNNYVGLVSIPIGAVTGRLFVEKWYPIVTPNPSKGKSCG-----------------------------------------PMIRIKTRYQSISILPMEMYKEFAEYITNNYMVLCSTLEGILSVKNKEEMASALVHILQSTGKAKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--NKC---STSDLPEHQS-------------------NLKMCCELAFCKIINSYCVFPRELKEVFASWRQECNSRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 472          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Xenopus
Match: DAB2IP (DAB2 interacting protein [Source:NCBI gene;Acc:100145038])

HSP 1 Score: 329.717 bits (844), Expect = 2.228e-93
Identity = 198/494 (40.08%), Postives = 280/494 (56.68%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LWI EAK++P KK+Y CE+YLD+ L+A+TT K  TD +FWGE F   +L  + ++T+ L+K   +   KKKK +++ +  V+I    ++ R  VE+WYP      S G                                             PMIRIK RYQ+I +LP+  Y    E++  + + L   ++  L VKNKE++A +L+++L   G A +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  +KC   S S L E QS                   +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:   75 FSCRSAAERDKWMENLRRAVHPNKDNSRRIENMLKLWIIEAKDLPAKKKYLCELYLDDILYARTTCKLKTDNVFWGEHFEFNNLPTLKSITVHLYK---ETDKKKKKDKNNYVGLVSIPIGAVTGRLFVEKWYPIVTPNPSKGKSCG-----------------------------------------PMIRIKTRYQSISILPMEMYKEFAEYITNNYMVLCSTLEGILSVKNKEEMASALVHILQSTGKAKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--NKC---STSDLPEHQS-------------------NLKMCCELAFCKIINSYCVFPRELKEVFASWRQECNSRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 489          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Mouse
Match: Dab2ip (disabled 2 interacting protein [Source:MGI Symbol;Acc:MGI:1916851])

HSP 1 Score: 332.798 bits (852), Expect = 1.585e-94
Identity = 193/494 (39.07%), Postives = 276/494 (55.87%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LW+ EAK++P KK+Y CE+ LD+ L+A+TT+K  TD +FWGE F   +L  + TVT+ L++   +   KKKK ++  +  V++    ++ R  VE+WYP   + N  G                                             PMIRIKARYQ + +LP+  Y    E +  H + L   ++  L  K KE++A +L+++L   G   +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S++ L E Q                    +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:   76 FSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYR---ETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPV-VTPNPKG----------------------------------------GKGPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SSADLPEHQG-------------------NLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 490          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Mouse
Match: Dab2ip (disabled 2 interacting protein [Source:MGI Symbol;Acc:MGI:1916851])

HSP 1 Score: 332.028 bits (850), Expect = 2.227e-94
Identity = 193/494 (39.07%), Postives = 276/494 (55.87%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LW+ EAK++P KK+Y CE+ LD+ L+A+TT+K  TD +FWGE F   +L  + TVT+ L++   +   KKKK ++  +  V++    ++ R  VE+WYP   + N  G                                             PMIRIKARYQ + +LP+  Y    E +  H + L   ++  L  K KE++A +L+++L   G   +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S++ L E                    Q +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:   58 FSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYR---ETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPV-VTPNPKG----------------------------------------GKGPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SSADLPE-------------------HQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 472          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Mouse
Match: Dab2ip (disabled 2 interacting protein [Source:MGI Symbol;Acc:MGI:1916851])

HSP 1 Score: 333.183 bits (853), Expect = 2.426e-94
Identity = 193/494 (39.07%), Postives = 276/494 (55.87%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LW+ EAK++P KK+Y CE+ LD+ L+A+TT+K  TD +FWGE F   +L  + TVT+ L++   +   KKKK ++  +  V++    ++ R  VE+WYP   + N  G                                             PMIRIKARYQ + +LP+  Y    E +  H + L   ++  L  K KE++A +L+++L   G   +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S++ L E Q                    +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:  182 FSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYR---ETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPV-VTPNPKG----------------------------------------GKGPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SSADLPEHQG-------------------NLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 596          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Mouse
Match: Dab2ip (disabled 2 interacting protein [Source:MGI Symbol;Acc:MGI:1916851])

HSP 1 Score: 333.183 bits (853), Expect = 2.612e-94
Identity = 193/494 (39.07%), Postives = 276/494 (55.87%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LW+ EAK++P KK+Y CE+ LD+ L+A+TT+K  TD +FWGE F   +L  + TVT+ L++   +   KKKK ++  +  V++    ++ R  VE+WYP   + N  G                                             PMIRIKARYQ + +LP+  Y    E +  H + L   ++  L  K KE++A +L+++L   G   +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S++ L E Q                    +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:  154 FSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYR---ETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPV-VTPNPKG----------------------------------------GKGPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SSADLPEHQG-------------------NLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRP---------DISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 568          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Mouse
Match: Dab2ip (disabled 2 interacting protein [Source:MGI Symbol;Acc:MGI:1916851])

HSP 1 Score: 332.798 bits (852), Expect = 3.622e-94
Identity = 193/494 (39.07%), Postives = 276/494 (55.87%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LW+ EAK++P KK+Y CE+ LD+ L+A+TT+K  TD +FWGE F   +L  + TVT+ L++   +   KKKK ++  +  V++    ++ R  VE+WYP   + N  G                                             PMIRIKARYQ + +LP+  Y    E +  H + L   ++  L  K KE++A +L+++L   G   +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S++ L E Q                    +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:  125 FSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYR---ETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPV-VTPNPKG----------------------------------------GKGPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SSADLPEHQG-------------------NLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 539          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. UniProt/SwissProt
Match: sp|Q8MLZ5|GAP2_CAEEL (Ras GTPase-activating protein gap-2 OS=Caenorhabditis elegans OX=6239 GN=gap-2 PE=2 SV=2)

HSP 1 Score: 340.887 bits (873), Expect = 1.219e-95
Identity = 201/521 (38.58%), Postives = 305/521 (58.54%), Query Frame = 3
Query: 1305 LLAYVFSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKE 2867
            L +  +SC +  ER KW+  L + + P    +RR E S+ +WI EAK +P K++Y+CE+ LD+TL+AKT++K  TD +FWGE F    L +++ V + L++ S    +KKKK    LI  V I    +S+R+ VERWY  + S++ SGT                            + ++ +    S+S   P +RIKAR+Q++ +LP+  Y +LLE L  + + L  +++  L V++KEDLA SL+ V++K  +A EFL DL+ +E++K DN++++ RGNT+A+KA+E ++KL+ + YL   LSDF+  + Q ++ CEVDPQ  K    SNSSL + ++L                   LM  V++ W KIL++    P+ L+ VF +LR RLE  +R A         L + ++SS IFLRF+CPAIL+PSLF L+ EYP +P   R  TL+AK +Q+LANFS   G KE +M FMN F++ ++  M+ FL  ISS +    S  + N  + VDA KE
Sbjct:  358 LASTYYSCRTPLERAKWMENLRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSKARTDNVFWGENFEFMMLPKIDEVCVSLFRESD---SKKKKDT--LIGYVTIGIDQLSSRSPVERWYTVNTSHSDSGT----------------------------SRIASALGGKSSSQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKLDNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQ--KLGNVSNSSLEKNRAL-------------------LMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREA---------LADTLISSSIFLRFLCPAILSPSLFNLVSEYP-SPTNARNLTLIAKTLQNLANFSKF-GGKEPHMEFMNEFVDREWHRMKDFLLRISSESK---SGPEKNADAIVDAGKE 810          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. UniProt/SwissProt
Match: sp|Q3UHC7|DAB2P_MOUSE (Disabled homolog 2-interacting protein OS=Mus musculus OX=10090 GN=Dab2ip PE=1 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 3.697e-93
Identity = 193/494 (39.07%), Postives = 276/494 (55.87%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LW+ EAK++P KK+Y CE+ LD+ L+A+TT+K  TD +FWGE F   +L  + TVT+ L++   +   KKKK ++  +  V++    ++ R  VE+WYP   + N  G                                             PMIRIKARYQ + +LP+  Y    E +  H + L   ++  L  K KE++A +L+++L   G   +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S++ L E Q                    +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:  182 FSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKLKTDNVFWGEHFEFHNLPPLRTVTVHLYR---ETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPV-VTPNPKG----------------------------------------GKGPGPMIRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SSADLPEHQG-------------------NLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRP---------DISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 596          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. UniProt/SwissProt
Match: sp|Q5VWQ8|DAB2P_HUMAN (Disabled homolog 2-interacting protein OS=Homo sapiens OX=9606 GN=DAB2IP PE=1 SV=2)

HSP 1 Score: 332.798 bits (852), Expect = 4.930e-93
Identity = 194/494 (39.27%), Postives = 274/494 (55.47%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LW+ EAK++P KK+Y CE+ LD+ L+A+TT K  TD +FWGE F   +L  + TVT+ L++   +   KKKK ++  +  V++    ++ R  VE+WYP   + N  G                                             PMIRIKARYQ I +LP+  Y    E +  H + L   ++  L  K KE++A +L+++L   G   +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S + L E Q                    +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:  182 FSCRSAAERDKWMENLRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYR---ETDKKKKKERNSYLGLVSLPAASVAGRQFVEKWYPV-VTPNPKG----------------------------------------GKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SAADLPEHQG-------------------NLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 596          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. UniProt/SwissProt
Match: sp|Q6P730|DAB2P_RAT (Disabled homolog 2-interacting protein OS=Rattus norvegicus OX=10116 GN=Dab2ip PE=1 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 8.736e-88
Identity = 186/479 (38.83%), Postives = 264/479 (55.11%), Query Frame = 3
Query: 1365 LTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            L R V PN  N RR E  L LW+ EAK++P KK+Y CE+ LD+ L+A+TT K  TD +FWGE F   +L  + TVT+ L++ +     KKKK ++  +  V++    ++ R  VE+WYP   + N  G                                             PMIRIKARYQ I +LP+  Y    E +  H + L   ++  L  K KE++A +L+++L   G   +FL+DL+  E+ +  DNE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S + L E Q                    +L M  ++ + KI++S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF LL EYPD+ +  RT TL+AK  Q+LANF+   GSKE YM FMN F+E+++T MQ FL EIS
Sbjct:    4 LRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKLKTDNVFWGEHFEFHNLPPLRTVTVHLYRETDK---KKKKERNSYLGLVSLPAASVAGRQFVEKWYPV-VTPNPKG----------------------------------------GKGPGPMIRIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC---SAADLPEHQG-------------------NLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKF-GSKEEYMSFMNQFLEHEWTNMQRFLLEIS 403          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. UniProt/SwissProt
Match: sp|Q9UJF2|NGAP_HUMAN (Ras GTPase-activating protein nGAP OS=Homo sapiens OX=9606 GN=RASAL2 PE=1 SV=2)

HSP 1 Score: 313.153 bits (801), Expect = 1.002e-86
Identity = 188/494 (38.06%), Postives = 281/494 (56.88%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S SER KW+  L R V+PN  N RR E  L LWI EAK++  KK+YFCE+ LD+TL A+TT+KT  D +FWGE F    L  ++++T+ ++K     + K K +   L   VNI T  ++ R  VE+WYP S    + G                                   T         P IRIK+R+Q I +LP+ +Y    EF+  +   L   ++  + V+NKE+LA +L+++L   G A +FL+DL+  E+ +  +++ +I R NTIA+K+IE YLKL+G++YL   L +F+  + + DE+CEVDP  SKC   S+S                    L+  Q +L M  ++ + KI++S   FPRELK VF S +++          ++  + ++ ER++S+ +FLRF+CPAI++PSLF L+ EYPD+ +  RT TL+AK IQ+LANF+   G+KE YM FMN F+E+++  M+ FL EIS
Sbjct:  138 FSCNSASERDKWMENLRRTVQPNKDNCRRAENVLRLWIIEAKDLAPKKKYFCELCLDDTLFARTTSKTKADNIFWGEHFEFFSLPPLHSITVHIYKDVEKKKKKDKNNYVGL---VNIPTASVTGRQFVEKWYPVSTPTPNKG----------------------------------KTGG-------PSIRIKSRFQTITILPMEQYKEFAEFVTSNYTMLCSVLEPVISVRNKEELACALVHILQSTGRAKDFLTDLVMSEVDRCGEHDVLIFRENTIATKSIEEYLKLVGQQYLHDALGEFIKALYESDENCEVDP--SKC---SSSE-------------------LIDHQSNLKMCCELAFCKIINSYCVFPRELKEVFASWKQQC---------LNRGKQDISERLISASLFLRFLCPAIMSPSLFNLMQEYPDD-RTSRTLTLIAKVIQNLANFAKF-GNKEEYMAFMNDFLEHEWGGMKRFLLEIS 552          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. TrEMBL
Match: V4ANY2 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_114108 PE=4 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 7.230e-101
Identity = 206/544 (37.87%), Postives = 302/544 (55.51%), Query Frame = 3
Query: 1170 LLLPTGTRSLGHTCQIIGTKKLQEQCPSCNSSRLSLFASAEQQNHLLAYVFSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISS 2801
            L  P    S+  +   IG K L       +SS L      +   H  +   SC +  ER KWL  L +  +PN ++ RR + SL LW+ EAKNV  KKRYFCEIYLD+TL+A+T+ K  +D+LFWGE F   +L  V+ +T+ L++ +     KKKK ++ L+  +NI   +I  R  VE+WY A+     SGT                                   A   + + LP+IR+KARYQ + +LPIN YS  +++LK    +L   ++  + V++KED+AI+LIN++ K G+A  FLSD++  EI + DNE++  RGN++A+KA+E Y+KL+GEKYL   + D+V  + +  +DCEVDP +          +N   +LQ               Q++L M   M WAKI++S  YFP EL+ VF S R R          +   + ++ + ++S  IFLRF+CPAIL+PSLF L  EYP   K  R  TL+AK IQ+LANF+   G KE YM F+N+F+E +  +M +FL +IS+
Sbjct:   12 LTTPASMNSMDMSSPDIGIKPL-------HSSVLGQDHCFQVSTHHGSKFISCRTAEERDKWLDSLRKTAKPNQEHCRRTDNSLKLWVVEAKNVTPKKRYFCEIYLDKTLYARTSIKMKSDMLFWGEHFEFNNLPPVDVITVNLFREAD---RKKKKDKNTLLGYINIPISEIGNRQYVEKWYTAA-----SGT--------------------------------VGKAGKDSKNDLPIIRLKARYQTVHILPINLYSEFIQYLKSDYCKLCESIEPLVNVRDKEDIAITLINIMQKLGMAQTFLSDVVMAEIGRLDNEHLTFRGNSMATKAMEAYMKLVGEKYLHDTIGDYVRNLIECQDDCEVDPTK----------VNNVTTLQC-------------HQKNLEMYCQMAWAKIMNSYCYFPSELREVFSSFRDRC---------IKRGKEDMSDNLISGSIFLRFLCPAILSPSLFNLTQEYPQE-KAARNLTLIAKTIQTLANFTKFGGGKEEYMTFLNSFVERESNSMHNFLHQIST 475          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. TrEMBL
Match: A0A3Q1GA50 (Uncharacterized protein OS=Acanthochromis polyacanthus OX=80966 PE=4 SV=1)

HSP 1 Score: 346.665 bits (888), Expect = 5.092e-99
Identity = 193/494 (39.07%), Postives = 281/494 (56.88%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKS-DNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L +W+ EAK++P KKRYFCE+ LD++L+A+T+ K  TD +FWGE F+   L  V++VT+ L+K   D   K+KK +   +  VNI    ++ R  VE+WY  S    S G   V                                         P +R+KARYQ+I +LP+ +Y    E++  + + L   ++A + ++ KE+LA +L+++LH  G A +FL+DL+  E+ +  DN+ +I R NT+A+K+IE YLKLIG+KYL   L +F+  + + DE+CEVDP R             C +             LL+ Q +L M  ++ + KIL S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPA+++PSLF L+ EYPD  +  RT TL+AK IQ+LANFS   G+KE YMLFMN F+E ++++MQ FL+EIS
Sbjct:   82 FSCRSAAERDKWMENLRRAVHPNKDNSRRLENVLTVWVIEAKDLPAKKRYFCELCLDDSLYARTSCKLRTDNVFWGERFDFSSLPSVSSVTLHLYK---DTDRKRKKDKSSYVGLVNIPVATVTGRQLVEKWYSVSTPSTSRGKSSV-----------------------------------------PTVRVKARYQSIVILPMEQYKEFAEYISSNYLLLCSTLEASISLRAKEELAAALVHILHSTGKAKDFLTDLMMSEVDRCRDNDQLIFRENTLATKSIEEYLKLIGQKYLQDALGEFIKALYESDENCEVDPSR-------------CSTSD-----------LLEHQANLRMCCELAFCKILDSYRVFPRELKEVFASWRQECGNRGR---------PDISERLISASLFLRFLCPAVMSPSLFDLMQEYPDE-RTARTLTLIAKVIQNLANFSKF-GTKEEYMLFMNDFVERQWSSMQRFLQEIS 496          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. TrEMBL
Match: A0A3Q1ER52 (Uncharacterized protein OS=Acanthochromis polyacanthus OX=80966 PE=4 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 5.931e-98
Identity = 194/494 (39.27%), Postives = 283/494 (57.29%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L +W+ EAK++P KKRYFCE+ LD++L+A+T+ K  TD +FWGE F+   L  V++VT+ L+K   D   K+KK +   +  VNI    ++ R  VE+WY                                          S ST S   S  +P +R+KARYQ+I +LP+ +Y    E++  + + L   ++A + ++ KE+LA +L+++LH  G A +FL+DL+  E+ +  DN+ +I R NT+A+K+IE YLKLIG+KYL   L +F+  + + DE+CEVDP R             C +             LL+ Q +L M  ++ + KIL S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPA+++PSLF L+ EYPD  +  RT TL+AK IQ+LANFS   G+KE YMLFMN F+E ++++MQ FL+EIS
Sbjct:   85 FSCRSAAERDKWMENLRRAVHPNKDNSRRLENVLTVWVIEAKDLPAKKRYFCELCLDDSLYARTSCKLRTDNVFWGERFDFSSLPSVSSVTLHLYK---DTDRKRKKDKSSYVGLVNIPVATVTGRQLVEKWY------------------------------------------SVSTPSTRKS-SVPTVRVKARYQSIVILPMEQYKEFAEYISSNYLLLCSTLEASISLRAKEELAAALVHILHSTGKAKDFLTDLMMSEVDRCRDNDQLIFRENTLATKSIEEYLKLIGQKYLQDALGEFIKALYESDENCEVDPSR-------------CSTSD-----------LLEHQANLRMCCELAFCKILDSYRVFPRELKEVFASWRQECGNRGR---------PDISERLISASLFLRFLCPAVMSPSLFDLMQEYPDE-RTARTLTLIAKVIQNLANFSKF-GTKEEYMLFMNDFVERQWSSMQRFLQEIS 497          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. TrEMBL
Match: A0A3S2UDU6 (Uncharacterized protein OS=Oryzias javanicus OX=123683 GN=OJAV_G00094940 PE=4 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 6.827e-98
Identity = 192/494 (38.87%), Postives = 285/494 (57.69%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L +W+ EAK++P KKRYFCE+ LD++L+A+T+ K  TD +FWGE F+ C L  +N++T+ L+K   D   K+KK +   +  VNI    ++ R  VE+WY  S                                         + +++     +P +R+KARYQ+I +LP+ +Y    E++  + + L   ++A + ++ KE+LA +L+++LH  G A +FL+DL+  E+ +  DN+ +I R NT+A+K+IE YLKLIG+KYL   L +F+  + + DE+CEVDP  S+C   S S L E                    Q +L M  ++ + KIL S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPA+++PSLF L+ EYPD  +  RT TL+AK IQ+LANFS   G+KE YMLFMN F+E ++++MQ FL+EIS
Sbjct:   56 FSCRSAAERDKWMENLRRAVHPNKDNSRRLENVLTVWVIEAKDLPAKKRYFCELCLDDSLYARTSCKLKTDNIFWGEHFDFCSLPSINSITLHLYK---DTDRKRKKDKSSYVGLVNIPVSTVTGRQLVEKWYSVS-----------------------------------------TPSTIRGKSSIPTVRVKARYQSIVILPMEQYKEFAEYISSNYLLLCSTLEASISLRAKEELAAALVHILHSTGKAKDFLTDLMMSEVDRCRDNDQLIFRENTLATKSIEEYLKLIGQKYLQDALGEFIKALYESDENCEVDP--SRC---STSDLAE-------------------HQANLRMCCELAFCKILDSYRVFPRELKEVFASWRQECSNRGRP---------DISERLISASLFLRFLCPAVMSPSLFDLMQEYPDE-RTARTLTLIAKVIQNLANFSKF-GTKEEYMLFMNDFVERQWSSMQRFLQEIS 470          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. TrEMBL
Match: A0A3B3DB07 (Uncharacterized protein OS=Oryzias melastigma OX=30732 PE=4 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 1.331e-97
Identity = 192/494 (38.87%), Postives = 285/494 (57.69%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L +W+ EAK++P KKRYFCE+ LD++L+A+T+ K  TD +FWGE F+ C L  +N++T+ L+K   D   K+KK +   +  VNI    ++ R  VE+WY  S                                         + +++     +P +R+KARYQ+I +LP+ +Y    E++  + + L   ++A + ++ KE+LA +L+++LH  G A +FL+DL+  E+ +  DN+ +I R NT+A+K+IE YLKLIG+KYL   L +F+  + + DE+CEVDP  S+C   S S L E                    Q +L M  ++ + KIL S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPA+++PSLF L+ EYPD  +  RT TL+AK IQ+LANFS   G+KE YMLFMN F+E ++++MQ FL+EIS
Sbjct:   56 FSCRSAAERDKWMENLRRAVHPNKDNSRRLENVLTVWVIEAKDLPAKKRYFCELCLDDSLYARTSCKLKTDNIFWGEHFDFCSLPSINSITLHLYK---DTDRKRKKDKSSYVGLVNIPVSTVTGRQLVEKWYSVS-----------------------------------------TPSTIRGKSSIPTVRVKARYQSIIILPMEQYKEFAEYISSNYLLLCSTLEASISLRAKEELAAALVHILHSTGKAKDFLTDLMMSEVDRCRDNDQLIFRENTLATKSIEEYLKLIGQKYLQDALGEFIKALYESDENCEVDP--SRC---STSDLAE-------------------HQANLRMCCELAFCKILDSYRVFPRELKEVFASWRQECSNRGRP---------DISERLISASLFLRFLCPAVMSPSLFDLMQEYPDE-RTARTLTLIAKVIQNLANFSKF-GTKEEYMLFMNDFVERQWSSMQRFLQEIS 470          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Cavefish
Match: dab2ipb (DAB2 interacting protein [Source:NCBI gene;Acc:103023248])

HSP 1 Score: 333.954 bits (855), Expect = 6.773e-95
Identity = 195/494 (39.47%), Postives = 284/494 (57.49%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LW+ EAK++P KK+YFCE+ LD++L+A+TT K   D +FWGE F   +L  V  +T+ L++   D+  KKKK +++ +  V+I  + +++R  VE+WYP S    S G                                   TA        PMIRIKARYQ++++LP+  Y    E+   + + L   ++  + VKNKE++A +L+++L   G A +FL+DL+  E+ +  +NE++I R NT+ +KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC      S N+                L + Q +L M  ++ + KI+SS   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF L  EYPD+ +  RT TL+AK  Q+LANF+   G+KE YM FMN F+E+++T MQ FL EIS
Sbjct:  151 FSCRSSAERDKWMENLRRAVHPNKDNSRRVENMLRLWVIEAKDLPAKKKYFCELCLDDSLYARTTCKLKADNIFWGEHFEFSNLPAVQNITVHLYR---DSEKKKKKDKNNYVGLVSIPVETVTSRQLVEKWYPVSTPNPSKG----------------------------------KTAG-------PMIRIKARYQSMNILPMEMYKEFAEYTTNNYMLLCSVLEPAISVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLGTKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC------SPND----------------LPEHQSNLKMCCELAFCKIISSYCVFPRELKEVFASWRQECGNRGRP---------DISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTKF-GNKEEYMSFMNQFLEHEWTNMQRFLLEIS 565          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Cavefish
Match: dab2ipb (DAB2 interacting protein [Source:NCBI gene;Acc:103023248])

HSP 1 Score: 333.954 bits (855), Expect = 1.188e-94
Identity = 195/494 (39.47%), Postives = 284/494 (57.49%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LW+ EAK++P KK+YFCE+ LD++L+A+TT K   D +FWGE F   +L  V  +T+ L++   D+  KKKK +++ +  V+I  + +++R  VE+WYP S    S G                                   TA        PMIRIKARYQ++++LP+  Y    E+   + + L   ++  + VKNKE++A +L+++L   G A +FL+DL+  E+ +  +NE++I R NT+ +KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC      S N+                L + Q +L M  ++ + KI+SS   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF L  EYPD+ +  RT TL+AK  Q+LANF+   G+KE YM FMN F+E+++T MQ FL EIS
Sbjct:  151 FSCRSSAERDKWMENLRRAVHPNKDNSRRVENMLRLWVIEAKDLPAKKKYFCELCLDDSLYARTTCKLKADNIFWGEHFEFSNLPAVQNITVHLYR---DSEKKKKKDKNNYVGLVSIPVETVTSRQLVEKWYPVSTPNPSKG----------------------------------KTAG-------PMIRIKARYQSMNILPMEMYKEFAEYTTNNYMLLCSVLEPAISVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLGTKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC------SPND----------------LPEHQSNLKMCCELAFCKIISSYCVFPRELKEVFASWRQECGNRGRP---------DISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTKF-GNKEEYMSFMNQFLEHEWTNMQRFLLEIS 565          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Cavefish
Match: dab2ipb (DAB2 interacting protein [Source:NCBI gene;Acc:103023248])

HSP 1 Score: 333.954 bits (855), Expect = 2.210e-94
Identity = 195/494 (39.47%), Postives = 284/494 (57.49%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LW+ EAK++P KK+YFCE+ LD++L+A+TT K   D +FWGE F   +L  V  +T+ L++   D+  KKKK +++ +  V+I  + +++R  VE+WYP S    S G                                   TA        PMIRIKARYQ++++LP+  Y    E+   + + L   ++  + VKNKE++A +L+++L   G A +FL+DL+  E+ +  +NE++I R NT+ +KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC      S N+                L + Q +L M  ++ + KI+SS   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF L  EYPD+ +  RT TL+AK  Q+LANF+   G+KE YM FMN F+E+++T MQ FL EIS
Sbjct:  179 FSCRSSAERDKWMENLRRAVHPNKDNSRRVENMLRLWVIEAKDLPAKKKYFCELCLDDSLYARTTCKLKADNIFWGEHFEFSNLPAVQNITVHLYR---DSEKKKKKDKNNYVGLVSIPVETVTSRQLVEKWYPVSTPNPSKG----------------------------------KTAG-------PMIRIKARYQSMNILPMEMYKEFAEYTTNNYMLLCSVLEPAISVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLGTKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC------SPND----------------LPEHQSNLKMCCELAFCKIISSYCVFPRELKEVFASWRQECGNRGRP---------DISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTKF-GNKEEYMSFMNQFLEHEWTNMQRFLLEIS 593          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Cavefish
Match: dab2ipb (DAB2 interacting protein [Source:NCBI gene;Acc:103023248])

HSP 1 Score: 333.569 bits (854), Expect = 1.535e-93
Identity = 195/494 (39.47%), Postives = 284/494 (57.49%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LW+ EAK++P KK+YFCE+ LD++L+A+TT K   D +FWGE F   +L  V  +T+ L++   D+  KKKK +++ +  V+I  + +++R  VE+WYP S    S G                                   TA        PMIRIKARYQ++++LP+  Y    E+   + + L   ++  + VKNKE++A +L+++L   G A +FL+DL+  E+ +  +NE++I R NT+ +KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC      S N+                L + Q +L M  ++ + KI+SS   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF L  EYPD+ +  RT TL+AK  Q+LANF+   G+KE YM FMN F+E+++T MQ FL EIS
Sbjct:  344 FSCRSSAERDKWMENLRRAVHPNKDNSRRVENMLRLWVIEAKDLPAKKKYFCELCLDDSLYARTTCKLKADNIFWGEHFEFSNLPAVQNITVHLYR---DSEKKKKKDKNNYVGLVSIPVETVTSRQLVEKWYPVSTPNPSKG----------------------------------KTAG-------PMIRIKARYQSMNILPMEMYKEFAEYTTNNYMLLCSVLEPAISVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLGTKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC------SPND----------------LPEHQSNLKMCCELAFCKIISSYCVFPRELKEVFASWRQECGNRGR---------PDISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTKF-GNKEEYMSFMNQFLEHEWTNMQRFLLEIS 758          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Cavefish
Match: dab2ipb (DAB2 interacting protein [Source:NCBI gene;Acc:103023248])

HSP 1 Score: 327.02 bits (837), Expect = 1.198e-92
Identity = 194/494 (39.27%), Postives = 283/494 (57.29%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L LW+ EAK++P KK+YFCE+ LD++L+A+TT K   D +FWGE F   +L  V  +T+ L++   D+  KKKK +++ +  V+I  + +++R  VE+WYP S    S G                                   TA        PMIRIKARYQ++++LP+  Y    E+   + + L   ++  + VKNKE++A +L+++L   G   +FL+DL+  E+ +  +NE++I R NT+ +KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC      S N+                L + Q +L M  ++ + KI+SS   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF L  EYPD+ +  RT TL+AK  Q+LANF+   G+KE YM FMN F+E+++T MQ FL EIS
Sbjct:   83 FSCRSSAERDKWMENLRRAVHPNKDNSRRVENMLRLWVIEAKDLPAKKKYFCELCLDDSLYARTTCKLKADNIFWGEHFEFSNLPAVQNITVHLYR---DSEKKKKKDKNNYVGLVSIPVETVTSRQLVEKWYPVSTPNPSKG----------------------------------KTAG-------PMIRIKARYQSMNILPMEMYKEFAEYTTNNYMLLCSVLEPAISVKNKEEMACALVHILQSTG--KDFLTDLMMSEVDRCGENEHLIFRENTLGTKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDP--SKC------SPND----------------LPEHQSNLKMCCELAFCKIISSYCVFPRELKEVFASWRQECGNRGRP---------DISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTKF-GNKEEYMSFMNQFLEHEWTNMQRFLLEIS 495          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000945.1 (pep scaffold:Pmarinus_7.0:GL477254:323984:383899:1 gene:ENSPMAG00000000852.1 transcript:ENSPMAT00000000945.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 291.967 bits (746), Expect = 1.779e-81
Identity = 182/491 (37.07%), Postives = 267/491 (54.38%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLIL-SDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFL 2786
            FSC S +E+ KW+  L R+V+PN  N +R E  L +WI EAK +P KK+YFCEI LD+TL+A+T +K   D LFWGE F   +L  V  + + L+K +   + K+K S   L+  +++E    S R  VE+WYP S      G   V                                         P +RIK R+Q + +LP+ +Y    EFL    + L   ++  L VK+KE+LA +L+  LH  G   EFL++L+  E+ + S+NE+++ R NT+A+KAIE YLK++G+ YL   L  +FV  +   DE+CEV+             L++C S +  D            + +L M  ++ + KILSS   FP EL+ VF S R+  E   R         + + ER++S+ +FLRF+CPAI++PSLFGL  EYPD  +  RT TL+AK +Q+LANF+   G+KE YM FMN F+E ++  M+ FL
Sbjct:   14 FSCRSAAEQDKWMENLRRIVQPNKDNIQRVENDLKVWIIEAKELPAKKKYFCEICLDDTLYARTASKAKVDNLFWGEHFEFSNLPAVKHIMVHLYKDTDKKKKKEKSSYVGLV-NISVEG-GTSGRQFVEKWYPLSTPNPGKGKGAV-----------------------------------------PTVRIKWRHQQLSILPMERYKEFAEFLSASCLPLCLLLEPVLGVKSKEELARALVRFLHTTGRVKEFLAELVIAEVTRCSENEHLLFRENTLATKAIEEYLKMVGQWYLHDALEGEFVRALYDSDENCEVE-------------LSKCSSAELADH-----------RNNLRMCCELAFCKILSSCCVFPAELRDVFSSWRRLCEARGR---------AEISERLISASLFLRFLCPAIMSPSLFGLSQEYPDE-RTARTLTLIAKVVQNLANFTKF-GNKEDYMTFMNGFLEQEWGRMKQFL 426          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Yeast
Match: BUD2 (GTPase activating factor for Rsr1p/Bud1p; plays a role in spindle position checkpoint distinct from its role in bud site selection; required for both axial and bipolar budding patterns; mutants exhibit random budding in all cell types; contains two PH-like domains [Source:SGD;Acc:S000001575])

HSP 1 Score: 87.4261 bits (215), Expect = 1.215e-17
Identity = 61/225 (27.11%), Postives = 111/225 (49.33%), Query Frame = 3
Query: 2130 NMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQ--MDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            N + RGN+I +K+IE Y   +G +YLS  LS  +  I + ++ CE+DP R K +       +E +             ++    + L   V  IW ++ ++S   P E+++V    R++LE   +D T   + N         +S  +FLRF CP IL P LF  + +   N    R  TL++K + +L+  +    +KE +++ MN FI+ +   +  ++ +++
Sbjct:  557 NSLFRGNSILTKSIEQYFFRVGNEYLSKALSAILKEIIESNKSCELDPARVKEK-------DEVKK----------RKIIADNYKRLYSWVTKIWKRLYATSNDLPIEIRNVLKIFRQKLEIICIDDTLQIILNG--------ISGLLFLRFFCPVILNPKLFKYVSQNL-NETARRNLTLISKVLLNLSTLTQF-ANKEPWLMKMNNFIDKRHNDLLDYIDKMT 754          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Nematostella
Match: EDO35799 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKG2])

HSP 1 Score: 288.5 bits (737), Expect = 1.321e-80
Identity = 175/498 (35.14%), Postives = 267/498 (53.61%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPL--KKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK--SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISS 2801
            FSC S  E  KW++ + + ++P    + R +ISL++W+ EAK      KKRYFCE+ LD+ L+A+TT+KT  D LFWGE F+   L  ++T+T+ ++K   D  AK KK +  L+  VNI  +D+ +   VE+W+P   +                                          +  N+D    IR+K +YQ I +LP+  Y+ +L +L  + + L   +++ +  K K+++A  ++ VL   G A EFL D++  E+ +  S +EN++ RGN+ A+KA++ Y+K++GE   S  L DFV  +    EDCEVDP +S                 NG   S+        QE+L    +  W  IL SS  FP +L+  F   R+R            N   +L  +++S+ IFLRF+CPAI++PSLF L+ EYP N ++LRT TL+AK IQ+LANF+   G KE YM FMN F++N+F  M+ F+  ISS
Sbjct:   34 FSCRSAQELNKWVNSIKKSIQPARDQQNRMDISLSVWVCEAKGAMTTPKKRYFCELLLDKMLYARTTSKTKVDTLFWGENFSFDDLLDLSTITVNIYK---DLEAKNKKEKRKLVGTVNIPVRDLDSSQEVEKWFPVDMT------------------------------------------TKGNADS-GSIRLKIKYQKIHILPLTTYNEMLSYLSNNYMHLCGTLESAVSSKVKDEIAGVILRVLQPVGKAQEFLVDIVMDEVNRLGSADENLVFRGNSFATKAMDTYMKMVGE---SETLGDFVQSVYAMSEDCEVDPAKS----------------VNGSIQSN--------QENLKAFAEKAWNHILCSSCIFPCDLQDTFHEFRQR----------SINGSRDLSNKLISASIFLRFLCPAIMSPSLFHLVQEYP-NERILRTLTLIAKVIQNLANFTKF-GGKEDYMGFMNDFVQNEFDKMREFVATISS 446          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Nematostella
Match: EDO36190 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJB4])

HSP 1 Score: 116.701 bits (291), Expect = 1.932e-26
Identity = 121/471 (25.69%), Postives = 209/471 (44.37%), Query Frame = 3
Query: 1404 RQEISLNLWIQEAKNVPLKK--RYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHL-EQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQH---AVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            +Q  SL L + EA  +PL K    +C + L+E    +T T      L W EEF    L   V++ T+ L+        K  +++  LI  V +    +     V+ WYP + +                                     S   A + N      +RI+ ++ +  ++P+ +Y  L E L      AV  L ++      K++  LA +L+ +   +      L  +  +EI+K D +  + RG ++A+  ++ Y+K++   YL   + D + +I +  + CE++P  +K E  +++ +N                 L Q  E L   +D I+    +S+   P+ L+ +F  L++ ++  D+ A   DN    +  R+VS  +FLR  CPAI+ P    L+ E P +    RT TLVAKC+Q LAN  +  G+KES M  +N F++     M SF+ E+S
Sbjct:  233 KQLRSLELNVIEAHKLPLNKVSHPYCMVSLNEVKTCRTKTFEGQTPL-WNEEFKFNDLPSDVSSFTLSLYN-------KSWRTKDVLIGHVLVPLNKLPKGQTVDDWYPLAAA-------------------------------------SHGKAEVGN------VRIRVKFTHEIIMPVEEYEALKEILLDEDLVAVTALGQV-----CKDRVVLASTLLKIFRHEKQEIFLLKTMNAREIEKQDEQATLFRGASLATSLMDQYMKMVAIPYLQHTIKDVILKILECKQSCELNP--AKMEKGADTVVN-----------------LKQLLEFLFEAIDAIF----TSAEECPKTLRYLFGCLQQNVK--DKWA---DN--QTVRTRVVSGFLFLRLFCPAIMNPKTCNLMSELP-SATAARTLTLVAKCLQKLANLVEF-GAKESCMTPVNPFMQKNRERMVSFMDELS 615          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Nematostella
Match: EDO43446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYE3])

HSP 1 Score: 116.316 bits (290), Expect = 3.382e-26
Identity = 95/318 (29.87%), Postives = 153/318 (48.11%), Query Frame = 3
Query: 1890 IRIKARYQNIDVLPINKYSHLLE-FLKQHAVQLLHEMDAHLK---VKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANF--SDLTGS-KESYMLFMNTFI--ENKFTTMQSFLKEISSSTDDD 2816
            +R+K  Y    V P + Y  L E  L+    + +    A++    VK+K   A +L+ V        +F+  ++  E+  + + N + RGN++ +KAI+ ++K  G +YL   +   V+ I +  + CE+DP R                L++GD        L Q   +L   V+ + A I  S++  P  +  VFV++R+       +A Q  + + ++    VS  +FLRF  PAIL P LF +  E+PD P V RT TL +K IQSL N   S + G  KE YM  +   I  ++  T ++ FL  ISS+   D
Sbjct:  276 LRLKVCYTEDYVFPSSYYEPLREAILEIEGHKDVTTTPAYILSEIVKDKLTAARALVRVFTHHNKVVDFIKAVVDHEVNTTADCNTLFRGNSLGTKAIDEFMKHAGMQYLHETIKTLVDEIYEERKCCEIDPSR----------------LRDGDS-------LPQNLANLQGYVNKLCAAITCSAMACPTAMSKVFVTIRE-------SAVQRFSDEPDVRYTAVSGFVFLRFFAPAILNPKLFQMRNEHPD-PLVARTLTLASKAIQSLGNLVSSVICGQVKEPYMESLKAMILDQDHITAVKRFLDAISSTVCAD 562          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Nematostella
Match: EDO40933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5U4])

HSP 1 Score: 68.9366 bits (167), Expect = 1.424e-11
Identity = 69/245 (28.16%), Postives = 118/245 (48.16%), Query Frame = 3
Query: 2106 EIKKSDNENMILRGNTIASKAIEVYLKL-IGEKYLSLILSDFVNRI-SQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNG--DKSSHFHPML----LQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRK-RLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGS-KESYMLFMNTFIENKFTTMQSFLKEISSSTD 2810
            E  +S+N N +LR NT  S+ +  Y +   G++YL   L + +N + SQ D   E++P +   E + +       +L+    D    F   L    LQ   SL + +      I+SS    P  ++ +  ++++  +E+      +  N+       ++     LRFI PAI+TP+ + L+ + P    + R  TL+AK +QS+AN + ++   KE YM  +  F  N    MQSFL ++SS  D
Sbjct:  147 EFAESENFNSLLRANTAISRMMTTYTRRGPGQEYLKCTLEEPLNDLMSQEDLVLEINPIKVYIELYGHPMDESSLTLERAMDDPEVMFRTKLRIKKLQDISSLFLGI------IISSLSQVPYGIQWLCRAIKELAMEKFPEATPEQINA-------MIGGFFLLRFINPAIVTPTAYMLVNKQPTY-TMRRNLTLIAKILQSMANKNVVSSHFKEEYMQPLQPFAINHVDLMQSFLSDLSSVPD 377          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Medaka
Match: ENSORLT00000022035.2 (disabled homolog 2-interacting protein-like [Source:NCBI gene;Acc:101175325])

HSP 1 Score: 350.903 bits (899), Expect = 5.066e-101
Identity = 192/494 (38.87%), Postives = 283/494 (57.29%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V PN  N RR E  L +W+ EAK++P KKRYFCE+ LD++L+A+T+ K  TD +FWGE F+ C L  VN++T+ L+K   D   K+KK +   +  VNI    ++ R  VE+WY  S                                         + +++     +P +R+KARYQ+I +LP+ +Y    E++  + + L   ++A + ++ KE+LA +L+++LH  G A +FL+DL+  E+ +  DN+ +I R NT+A+K+IE YLKLIG+KYL   L +F+  + + DE+CEVDP R      S S L E                    Q +L M  ++ + KIL S   FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPA+++PSLF L+ EYPD  +  RT TL+AK IQ+LANFS   G+KE YMLFMN F+E ++++MQ FL+EIS
Sbjct:   56 FSCRSAAERDKWMENLRRAVHPNKDNSRRLENVLTVWVIEAKDLPAKKRYFCELCLDDSLYARTSCKLKTDNIFWGEHFDFCSLPSVNSITLHLYK---DTDRKRKKDKSSYVGLVNIPVSTVTGRQLVEKWYSVS-----------------------------------------TPSTIRGKSSIPNVRVKARYQSIIILPMEQYKEFAEYISSNYLLLCSTLEASISLRAKEELAAALVHILHSTGKAKDFLTDLMMSEVDRCRDNDQLIFRENTLATKSIEEYLKLIGQKYLQDALGEFIKALYESDENCEVDPARC-----STSDLAE-------------------HQANLRMCCELAFCKILDSYRVFPRELKEVFASWRQECSNRGRP---------DISERLISASLFLRFLCPAVMSPSLFDLMQEYPDE-RTARTLTLIAKVIQNLANFSKF-GTKEEYMLFMNDFVERQWSSMQRFLQEIS 470          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Medaka
Match: dab2ipb (DAB2 interacting protein [Source:NCBI gene;Acc:101160924])

HSP 1 Score: 329.717 bits (844), Expect = 2.462e-93
Identity = 196/494 (39.68%), Postives = 283/494 (57.29%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V+PN  N RR E  L LWI EAK++P KK+YFCE+ LDE+L+A+TT K  TD +FWGE F   +L  V ++T  L+K +     KKKK +++ I  VNI    +S R  +E+WYP S      G                                             PMIRIKARYQ++ +LP+  Y    E++  + + L   ++  + VK+KE++A +L+++L   G A +FL+DL+  E+ +  +NE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S+S L + QS                   +L M  ++ + KI+ S  +FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF L  EYPD+ +  RT TL+AK  Q+LANF++  G+KE YM FMN F+E++++ MQ FL EIS
Sbjct:  126 FSCRSAAERDKWMENLRRAVQPNKDNSRRVENILRLWIIEAKDLPAKKKYFCELCLDESLYARTTCKLKTDNVFWGEHFEFSNLPAVRSITAHLYKDTD---KKKKKDKNNYIGLVNISVAAVSGRQFMEKWYPVSTPNPPKG-----------------------------------------KTSGPMIRIKARYQSMSILPMEMYKEFAEYITNNYMLLCSVLEPAISVKSKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLATKAIEEYLKLVGQKYLQDTLGEFIKALYESDENCEVDP--SKC---SSSDLPDHQS-------------------NLKMCCELAFCKIIKSYCFFPRELKEVFASWRQECSSRGRP---------DISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTNF-GNKEEYMSFMNQFLEHEWSDMQRFLLEIS 540          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Medaka
Match: dab2ipb (DAB2 interacting protein [Source:NCBI gene;Acc:101160924])

HSP 1 Score: 328.561 bits (841), Expect = 3.482e-93
Identity = 196/494 (39.68%), Postives = 283/494 (57.29%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V+PN  N RR E  L LWI EAK++P KK+YFCE+ LDE+L+A+TT K  TD +FWGE F   +L  V ++T  L+K +     KKKK +++ I  VNI    +S R  +E+WYP S      G                                             PMIRIKARYQ++ +LP+  Y    E++  + + L   ++  + VK+KE++A +L+++L   G A +FL+DL+  E+ +  +NE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S+S L + QS                   +L M  ++ + KI+ S  +FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF L  EYPD+ +  RT TL+AK  Q+LANF++  G+KE YM FMN F+E++++ MQ FL EIS
Sbjct:   69 FSCRSAAERDKWMENLRRAVQPNKDNSRRVENILRLWIIEAKDLPAKKKYFCELCLDESLYARTTCKLKTDNVFWGEHFEFSNLPAVRSITAHLYKDTD---KKKKKDKNNYIGLVNISVAAVSGRQFMEKWYPVSTPNPPKG-----------------------------------------KTSGPMIRIKARYQSMSILPMEMYKEFAEYITNNYMLLCSVLEPAISVKSKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLATKAIEEYLKLVGQKYLQDTLGEFIKALYESDENCEVDP--SKC---SSSDLPDHQS-------------------NLKMCCELAFCKIIKSYCFFPRELKEVFASWRQECSSRGRP---------DISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTNF-GNKEEYMSFMNQFLEHEWSDMQRFLLEIS 483          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Medaka
Match: dab2ipb (DAB2 interacting protein [Source:NCBI gene;Acc:101160924])

HSP 1 Score: 328.946 bits (842), Expect = 3.610e-93
Identity = 196/494 (39.68%), Postives = 283/494 (57.29%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V+PN  N RR E  L LWI EAK++P KK+YFCE+ LDE+L+A+TT K  TD +FWGE F   +L  V ++T  L+K +     KKKK +++ I  VNI    +S R  +E+WYP S      G                                             PMIRIKARYQ++ +LP+  Y    E++  + + L   ++  + VK+KE++A +L+++L   G A +FL+DL+  E+ +  +NE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S+S L + QS                   +L M  ++ + KI+ S  +FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF L  EYPD+ +  RT TL+AK  Q+LANF++  G+KE YM FMN F+E++++ MQ FL EIS
Sbjct:  108 FSCRSAAERDKWMENLRRAVQPNKDNSRRVENILRLWIIEAKDLPAKKKYFCELCLDESLYARTTCKLKTDNVFWGEHFEFSNLPAVRSITAHLYKDTD---KKKKKDKNNYIGLVNISVAAVSGRQFMEKWYPVSTPNPPKG-----------------------------------------KTSGPMIRIKARYQSMSILPMEMYKEFAEYITNNYMLLCSVLEPAISVKSKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLATKAIEEYLKLVGQKYLQDTLGEFIKALYESDENCEVDP--SKC---SSSDLPDHQS-------------------NLKMCCELAFCKIIKSYCFFPRELKEVFASWRQECSSRGRP---------DISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTNF-GNKEEYMSFMNQFLEHEWSDMQRFLLEIS 522          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Medaka
Match: dab2ipb (DAB2 interacting protein [Source:NCBI gene;Acc:101160924])

HSP 1 Score: 330.102 bits (845), Expect = 4.254e-93
Identity = 196/494 (39.68%), Postives = 283/494 (57.29%), Query Frame = 3
Query: 1320 FSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKK-SDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEIS 2798
            FSC S +ER KW+  L R V+PN  N RR E  L LWI EAK++P KK+YFCE+ LDE+L+A+TT K  TD +FWGE F   +L  V ++T  L+K +     KKKK +++ I  VNI    +S R  +E+WYP S      G                                             PMIRIKARYQ++ +LP+  Y    E++  + + L   ++  + VK+KE++A +L+++L   G A +FL+DL+  E+ +  +NE++I R NT+A+KAIE YLKL+G+KYL   L +F+  + + DE+CEVDP  SKC   S+S L + QS                   +L M  ++ + KI+ S  +FPRELK VF S R+      R          ++ ER++S+ +FLRF+CPAI++PSLF L  EYPD+ +  RT TL+AK  Q+LANF++  G+KE YM FMN F+E++++ MQ FL EIS
Sbjct:  151 FSCRSAAERDKWMENLRRAVQPNKDNSRRVENILRLWIIEAKDLPAKKKYFCELCLDESLYARTTCKLKTDNVFWGEHFEFSNLPAVRSITAHLYKDTD---KKKKKDKNNYIGLVNISVAAVSGRQFMEKWYPVSTPNPPKG-----------------------------------------KTSGPMIRIKARYQSMSILPMEMYKEFAEYITNNYMLLCSVLEPAISVKSKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLATKAIEEYLKLVGQKYLQDTLGEFIKALYESDENCEVDP--SKC---SSSDLPDHQS-------------------NLKMCCELAFCKIIKSYCFFPRELKEVFASWRQECSSRGRP---------DISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTNF-GNKEEYMSFMNQFLEHEWSDMQRFLLEIS 565          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Planmine SMEST
Match: SMESG000037132.1 (SMESG000037132.1)

HSP 1 Score: 2222.59 bits (5758), Expect = 0.000e+0
Identity = 1134/1144 (99.13%), Postives = 1139/1144 (99.56%), Query Frame = 3
Query:  585 MKSQQRTYSKPSGFNLSKTASHDSCLDQIEEAYINDDCPSVGGKYSKSNSNRRFTMTMASSRSSLLDISKPQASSSQRFLAFIQKGIHGSRNKSINKLDNPTFIKIVNEKKYLEALNEVVPIPIRETAIQGHSKILFHKIPKSNVRPRPLLKLGEETKFVLIHPSLLSKNIHHCVKIVSLSPSIYRNCSSGNQYELLLPTGTRSLGHTCQIIGTKKLQEQCPSCNSSRLSLFASAEQQNHLLAYVFSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKENGGYWENXXXXXXXXXXXXXXXXAKLHRQFEEYLQVIPVQKYTGNIEMLINIIADINERLSAKPDVTEPVGVSYSHSYHDXXXXXXXXXXXXDCNEICGTPTRNPDMDQCHHNAQINQPKKIKSMNLSFSTETSPIHTYIDRDSTSGNYLMTQSMIQDHKNYSHIPHPDSIYREQVDKEWKEMVSESTYYHKISNINDKKKPKIERLHGISSDSSGYETLNRSNCKISNEDEINMYDKLPLSPSVFKQSVKKCKQFRRKIEVVPNSDPLDGYYCDGAQLIALSRNFRSSSIDEMPNHTFYNDLLTRTEAIDNGSTETITTNTASRLNGNKYSMNTSISLPSFKIQDSNRDFSQSFTNVNLGTSNEHVDNKIKMKVTSDKISRH 4016
            MKSQQRTYSKPSGFNLSKTASHDSCLDQIEEAYINDDCPSVGGKYSKSNSNRRFTMTMASSRSSLLDISKPQASSSQRFLAFIQKGIHGSRNKSINKLDNPTFIKIVNEKKYLEALNEVVPIPIRETAIQGHSKILFHKIPKSNVRPRPLLKLGEETKFVLIHPSLLSKNIHHCVKIVSLSPSIYRNCSSGNQYELLLPTGTRSLGHTCQIIGTKKLQEQCPSCNSSRLSLFASAEQQNHLLAYVFSC SESERKKW+SVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAKTTTKTMTDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQ HLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHSNMSHSIISSTDSTPTSTLQSMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLL EMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKENGGYWENLSSTLSLDSIDISLCLAKLHRQFEEYLQVIPVQKYTGNIEMLINIIADINERLSAKPD+TEPVGVSYSHSYHD NGQQGVEVVQNDCNEICGTPTRNPDMDQCHHNAQINQPKKIKSMNLSFSTETSPIHTYIDRDSTSGN+LMTQSMIQDHKNYSHIPH DSIYREQVDKEWKEMVSESTYYHKISNINDKKKPKIER+HGISSDSSGYETLNRSNCKISNEDEIN+YDKLPLSPSVFKQSVKKCKQFRRKIEVVPNSDPLDGYYCDGAQLIALSRNFRSSSIDEMPNHTFYNDLLTRTEAIDNGSTETITTNTASRLNGNKYSMNTSISLPSFKIQDSNRDFSQSFTNVNLGTSNEHVDNKIKMKVTSDKISRH
Sbjct:    1 MKSQQRTYSKPSGFNLSKTASHDSCLDQIEEAYINDDCPSVGGKYSKSNSNRRFTMTMASSRSSLLDISKPQASSSQRFLAFIQKGIHGSRNKSINKLDNPTFIKIVNEKKYLEALNEVVPIPIRETAIQGHSKILFHKIPKSNVRPRPLLKLGEETKFVLIHPSLLSKNIHHCVKIVSLSPSIYRNCSSGNQYELLLPTGTRSLGHTCQIIGTKKLQEQCPSCNSSRLSLFASAEQQNHLLAYVFSCSSESERKKWMSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAKTTTKTMTDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQQHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHSNMSHSIISSTDSTPTSTLQSMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLQEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKENGGYWENLSSTLSLDSIDISLCLAKLHRQFEEYLQVIPVQKYTGNIEMLINIIADINERLSAKPDITEPVGVSYSHSYHDTNGQQGVEVVQNDCNEICGTPTRNPDMDQCHHNAQINQPKKIKSMNLSFSTETSPIHTYIDRDSTSGNHLMTQSMIQDHKNYSHIPHSDSIYREQVDKEWKEMVSESTYYHKISNINDKKKPKIERVHGISSDSSGYETLNRSNCKISNEDEINIYDKLPLSPSVFKQSVKKCKQFRRKIEVVPNSDPLDGYYCDGAQLIALSRNFRSSSIDEMPNHTFYNDLLTRTEAIDNGSTETITTNTASRLNGNKYSMNTSISLPSFKIQDSNRDFSQSFTNVNLGTSNEHVDNKIKMKVTSDKISRH 1144          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Planmine SMEST
Match: SMESG000037132.1 (SMESG000037132.1)

HSP 1 Score: 2178.29 bits (5643), Expect = 0.000e+0
Identity = 1115/1136 (98.15%), Postives = 1123/1136 (98.86%), Query Frame = 3
Query:  609 SKPSGFNLSKTASHDSCLDQIEEAYINDDCPSVGGKYSKSNSNRRFTMTMASSRSSLLDISKPQASSSQRFLAFIQKGIHGSRNKSINKLDNPTFIKIVNEKKYLEALNEVVPIPIRETAIQGHSKILFHKIPKSNVRPRPLLKLGEETKFVLIHPSLLSKNIHHCVKIVSLSPSIYRNCSSGNQYELLLPTGTRSLGHTCQIIGTKKLQEQCPSCNSSRLSLFASAEQQNHLLAYVFSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKENGGYWENXXXXXXXXXXXXXXXXAKLHRQFEEYLQVIPVQKYTGNIEMLINIIADINERLSAKPDVTEPVGVSYSHSYHDXXXXXXXXXXXXDCNEICGTPTRNPDMDQCHHNAQINQPKKIKSMNLSFSTETSPIHTYIDRDSTSGNYLMTQSMIQDHKNYSHIPHPDSIYREQVDKEWKEMVSESTYYHKISNINDKKKPKIERLHGISSDSSGYETLNRSNCKISNEDEINMYDKLPLSPSVFKQSVKKCKQFRRKIEVVPNSDPLDGYYCDGAQLIALSRNFRSSSIDEMPNHTFYNDLLTRTEAIDNGSTETITTNTASRLNGNKYSMNTSISLPSFKIQDSNRDFSQSFTNVNLGTSNEHVDNKIKMKVTSDKISRH 4016
            S P G+     + +DSCLDQIEEAYINDDCPSVGGKYSKSNSNRRFTMTMASSRSSLLDISKPQASSSQRFLAFIQKGIHGSRNKSINKLDNPTFIKIVNEKKYLEALNEVVPIPIRETAIQGHSKILFHKIPKSNVRPRPLLKLGEETKFVLIHPSLLSKNIHHCVKIVSLSPSIYRNCSSGNQYELLLPTGTRSLGHTCQIIGTKKLQEQCPSCNSSRLSLFASAEQQNHLLAYVFSC SESERKKW+SVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAKTTTKTMTDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQ HLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHSNMSHSIISSTDSTPTSTLQSMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLL EMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKENGGYWENLSSTLSLDSIDISLCLAKLHRQFEEYLQVIPVQKYTGNIEMLINIIADINERLSAKPD+TEPVGVSYSHSYHD NGQQGVEVVQNDCNEICGTPTRNPDMDQCHHNAQINQPKKIKSMNLSFSTETSPIHTYIDRDSTSGN+LMTQSMIQDHKNYSHIPH DSIYREQVDKEWKEMVSESTYYHKISNINDKKKPKIER+HGISSDSSGYETLNRSNCKISNEDEIN+YDKLPLSPSVFKQSVKKCKQFRRKIEVVPNSDPLDGYYCDGAQLIALSRNFRSSSIDEMPNHTFYNDLLTRTEAIDNGSTETITTNTASRLNGNKYSMNTSISLPSFKIQDSNRDFSQSFTNVNLGTSNEHVDNKIKMKVTSDKISRH
Sbjct:   13 SDPVGYR----SQYDSCLDQIEEAYINDDCPSVGGKYSKSNSNRRFTMTMASSRSSLLDISKPQASSSQRFLAFIQKGIHGSRNKSINKLDNPTFIKIVNEKKYLEALNEVVPIPIRETAIQGHSKILFHKIPKSNVRPRPLLKLGEETKFVLIHPSLLSKNIHHCVKIVSLSPSIYRNCSSGNQYELLLPTGTRSLGHTCQIIGTKKLQEQCPSCNSSRLSLFASAEQQNHLLAYVFSCSSESERKKWMSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAKTTTKTMTDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQQHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHSNMSHSIISSTDSTPTSTLQSMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLQEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKENGGYWENLSSTLSLDSIDISLCLAKLHRQFEEYLQVIPVQKYTGNIEMLINIIADINERLSAKPDITEPVGVSYSHSYHDTNGQQGVEVVQNDCNEICGTPTRNPDMDQCHHNAQINQPKKIKSMNLSFSTETSPIHTYIDRDSTSGNHLMTQSMIQDHKNYSHIPHSDSIYREQVDKEWKEMVSESTYYHKISNINDKKKPKIERVHGISSDSSGYETLNRSNCKISNEDEINIYDKLPLSPSVFKQSVKKCKQFRRKIEVVPNSDPLDGYYCDGAQLIALSRNFRSSSIDEMPNHTFYNDLLTRTEAIDNGSTETITTNTASRLNGNKYSMNTSISLPSFKIQDSNRDFSQSFTNVNLGTSNEHVDNKIKMKVTSDKISRH 1144          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Planmine SMEST
Match: SMESG000037132.1 (SMESG000037132.1)

HSP 1 Score: 2132.45 bits (5524), Expect = 0.000e+0
Identity = 1098/1136 (96.65%), Postives = 1106/1136 (97.36%), Query Frame = 3
Query:  609 SKPSGFNLSKTASHDSCLDQIEEAYINDDCPSVGGKYSKSNSNRRFTMTMASSRSSLLDISKPQASSSQRFLAFIQKGIHGSRNKSINKLDNPTFIKIVNEKKYLEALNEVVPIPIRETAIQGHSKILFHKIPKSNVRPRPLLKLGEETKFVLIHPSLLSKNIHHCVKIVSLSPSIYRNCSSGNQYELLLPTGTRSLGHTCQIIGTKKLQEQCPSCNSSRLSLFASAEQQNHLLAYVFSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKENGGYWENXXXXXXXXXXXXXXXXAKLHRQFEEYLQVIPVQKYTGNIEMLINIIADINERLSAKPDVTEPVGVSYSHSYHDXXXXXXXXXXXXDCNEICGTPTRNPDMDQCHHNAQINQPKKIKSMNLSFSTETSPIHTYIDRDSTSGNYLMTQSMIQDHKNYSHIPHPDSIYREQVDKEWKEMVSESTYYHKISNINDKKKPKIERLHGISSDSSGYETLNRSNCKISNEDEINMYDKLPLSPSVFKQSVKKCKQFRRKIEVVPNSDPLDGYYCDGAQLIALSRNFRSSSIDEMPNHTFYNDLLTRTEAIDNGSTETITTNTASRLNGNKYSMNTSISLPSFKIQDSNRDFSQSFTNVNLGTSNEHVDNKIKMKVTSDKISRH 4016
            S P G+     + +DSCLDQIEEAYINDDCPSVGGKYSKSNSNRRFTMTMASSRSSLLDISKPQASSSQRFLAFIQKGIHGSRNKSINKLDNPTFIKIVNEKKYLEALNEVVPIPIRETAIQGHSKILFHKIPKSNVRPRPLLKLGEETKFVLIHPSLLSKNIHHCVKIVSLSPSIYRNCSSGNQYELLLPTGTRSLGHTCQIIGTKKLQEQCPSCNSSRLSLFASAEQQNHLLAYVFSC SESERKKW+SVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAKTTTKTMTDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQ HLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHSNMSHSIISSTDSTPTSTLQSMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLL EMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKENGGYWENLSSTLSLDSIDISLCLAKLHRQFEEYLQVIPVQKYTGNIEMLINIIADINERLSAKPD+TEPVGVSYSHSYHD NGQQGVEVVQNDCNEICGTPTRNPDMDQCHHNAQINQPKKIKSMNLSFSTETSPIHTYIDRDSTSGN+LMTQSMIQDHKNYSHIPH DSIYREQVDKEWKEM                 KPKIER+HGISSDSSGYETLNRSNCKISNEDEIN+YDKLPLSPSVFKQSVKKCKQFRRKIEVVPNSDPLDGYYCDGAQLIALSRNFRSSSIDEMPNHTFYNDLLTRTEAIDNGSTETITTNTASRLNGNKYSMNTSISLPSFKIQDSNRDFSQSFTNVNLGTSNEHVDNKIKMKVTSDKISRH
Sbjct:   13 SDPVGYR----SQYDSCLDQIEEAYINDDCPSVGGKYSKSNSNRRFTMTMASSRSSLLDISKPQASSSQRFLAFIQKGIHGSRNKSINKLDNPTFIKIVNEKKYLEALNEVVPIPIRETAIQGHSKILFHKIPKSNVRPRPLLKLGEETKFVLIHPSLLSKNIHHCVKIVSLSPSIYRNCSSGNQYELLLPTGTRSLGHTCQIIGTKKLQEQCPSCNSSRLSLFASAEQQNHLLAYVFSCSSESERKKWMSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAKTTTKTMTDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQQHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHSNMSHSIISSTDSTPTSTLQSMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLQEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKENGGYWENLSSTLSLDSIDISLCLAKLHRQFEEYLQVIPVQKYTGNIEMLINIIADINERLSAKPDITEPVGVSYSHSYHDTNGQQGVEVVQNDCNEICGTPTRNPDMDQCHHNAQINQPKKIKSMNLSFSTETSPIHTYIDRDSTSGNHLMTQSMIQDHKNYSHIPHSDSIYREQVDKEWKEM-----------------KPKIERVHGISSDSSGYETLNRSNCKISNEDEINIYDKLPLSPSVFKQSVKKCKQFRRKIEVVPNSDPLDGYYCDGAQLIALSRNFRSSSIDEMPNHTFYNDLLTRTEAIDNGSTETITTNTASRLNGNKYSMNTSISLPSFKIQDSNRDFSQSFTNVNLGTSNEHVDNKIKMKVTSDKISRH 1127          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Planmine SMEST
Match: SMESG000037132.1 (SMESG000037132.1)

HSP 1 Score: 2125.9 bits (5507), Expect = 0.000e+0
Identity = 1095/1136 (96.39%), Postives = 1102/1136 (97.01%), Query Frame = 3
Query:  609 SKPSGFNLSKTASHDSCLDQIEEAYINDDCPSVGGKYSKSNSNRRFTMTMASSRSSLLDISKPQASSSQRFLAFIQKGIHGSRNKSINKLDNPTFIKIVNEKKYLEALNEVVPIPIRETAIQGHSKILFHKIPKSNVRPRPLLKLGEETKFVLIHPSLLSKNIHHCVKIVSLSPSIYRNCSSGNQYELLLPTGTRSLGHTCQIIGTKKLQEQCPSCNSSRLSLFASAEQQNHLLAYVFSCFSESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKENGGYWENXXXXXXXXXXXXXXXXAKLHRQFEEYLQVIPVQKYTGNIEMLINIIADINERLSAKPDVTEPVGVSYSHSYHDXXXXXXXXXXXXDCNEICGTPTRNPDMDQCHHNAQINQPKKIKSMNLSFSTETSPIHTYIDRDSTSGNYLMTQSMIQDHKNYSHIPHPDSIYREQVDKEWKEMVSESTYYHKISNINDKKKPKIERLHGISSDSSGYETLNRSNCKISNEDEINMYDKLPLSPSVFKQSVKKCKQFRRKIEVVPNSDPLDGYYCDGAQLIALSRNFRSSSIDEMPNHTFYNDLLTRTEAIDNGSTETITTNTASRLNGNKYSMNTSISLPSFKIQDSNRDFSQSFTNVNLGTSNEHVDNKIKMKVTSDKISRH 4016
            S P G+     + +DSCLDQIEEAYINDDCPSVGGKYSKSNSNRRFTMTMASSRSSLLDISKPQASSSQRFLAFIQKGIHGSRNKSINKLDNPTFIKIVNEKKYLEALNEVVPIPIRETAIQGHSKILFHKIPKSNVRPRPLLKLGEETKFVLIHPSLLSKNIHHCVKIVSLSPSIYRNCSSGNQYELLLPTGTRSLGHTCQIIGTKKLQEQCPSCNSSRLSLFASAEQQNHLLAYVFSC SESERKKW+SVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAKTTTKTMTDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQ HLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHSNMSHSIISSTDSTPTSTLQSMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLL EMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKENGGYWENLSSTLSLDSIDISLCLAKLHRQFEEYLQVIPVQKYTGNIEMLINIIADINERLSAKPD+TEPVGVSYSHSYHD NGQQGVEVVQNDCNEICGTPTRNPDMDQCHHNAQINQPKKIKSMNLSFSTETSPIHTYIDRDSTSGN+LMTQSMIQDHKNYSHIPH DSIYREQVDKEWKEMVSESTYYHKISNINDKKKPKIER+HGISSDSSGYETLNRSN                     FKQSVKKCKQFRRKIEVVPNSDPLDGYYCDGAQLIALSRNFRSSSIDEMPNHTFYNDLLTRTEAIDNGSTETITTNTASRLNGNKYSMNTSISLPSFKIQDSNRDFSQSFTNVNLGTSNEHVDNKIKMKVTSDKISRH
Sbjct:   13 SDPVGYR----SQYDSCLDQIEEAYINDDCPSVGGKYSKSNSNRRFTMTMASSRSSLLDISKPQASSSQRFLAFIQKGIHGSRNKSINKLDNPTFIKIVNEKKYLEALNEVVPIPIRETAIQGHSKILFHKIPKSNVRPRPLLKLGEETKFVLIHPSLLSKNIHHCVKIVSLSPSIYRNCSSGNQYELLLPTGTRSLGHTCQIIGTKKLQEQCPSCNSSRLSLFASAEQQNHLLAYVFSCSSESERKKWMSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAKTTTKTMTDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQQHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHSNMSHSIISSTDSTPTSTLQSMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLQEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKENGGYWENLSSTLSLDSIDISLCLAKLHRQFEEYLQVIPVQKYTGNIEMLINIIADINERLSAKPDITEPVGVSYSHSYHDTNGQQGVEVVQNDCNEICGTPTRNPDMDQCHHNAQINQPKKIKSMNLSFSTETSPIHTYIDRDSTSGNHLMTQSMIQDHKNYSHIPHSDSIYREQVDKEWKEMVSESTYYHKISNINDKKKPKIERVHGISSDSSGYETLNRSN--------------------FFKQSVKKCKQFRRKIEVVPNSDPLDGYYCDGAQLIALSRNFRSSSIDEMPNHTFYNDLLTRTEAIDNGSTETITTNTASRLNGNKYSMNTSISLPSFKIQDSNRDFSQSFTNVNLGTSNEHVDNKIKMKVTSDKISRH 1124          
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Planmine SMEST
Match: SMESG000037132.1 (SMESG000037132.1)

HSP 1 Score: 1692.17 bits (4381), Expect = 0.000e+0
Identity = 876/886 (98.87%), Postives = 881/886 (99.44%), Query Frame = 3
Query: 1359 SVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAXXXXXXXXDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHXXXXXXXXXXXXXXXXXXXXXMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKENGGYWENXXXXXXXXXXXXXXXXAKLHRQFEEYLQVIPVQKYTGNIEMLINIIADINERLSAKPDVTEPVGVSYSHSYHDXXXXXXXXXXXXDCNEICGTPTRNPDMDQCHHNAQINQPKKIKSMNLSFSTETSPIHTYIDRDSTSGNYLMTQSMIQDHKNYSHIPHPDSIYREQVDKEWKEMVSESTYYHKISNINDKKKPKIERLHGISSDSSGYETLNRSNCKISNEDEINMYDKLPLSPSVFKQSVKKCKQFRRKIEVVPNSDPLDGYYCDGAQLIALSRNFRSSSIDEMPNHTFYNDLLTRTEAIDNGSTETITTNTASRLNGNKYSMNTSISLPSFKIQDSNRDFSQSFTNVNLGTSNEHVDNKIKMKVTSDKISRH 4016
            + LTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAKTTTKTMTDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQ HLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHSNMSHSIISSTDSTPTSTLQSMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLL EMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKENGGYWENLSSTLSLDSIDISLCLAKLHRQFEEYLQVIPVQKYTGNIEMLINIIADINERLSAKPD+TEPVGVSYSHSYHD NGQQGVEVVQNDCNEICGTPTRNPDMDQCHHNAQINQPKKIKSMNLSFSTETSPIHTYIDRDSTSGN+LMTQSMIQDHKNYSHIPH DSIYREQVDKEWKEMVSESTYYHKISNINDKKKPKIER+HGISSDSSGYETLNRSNCKISNEDEIN+YDKLPLSPSVFKQSVKKCKQFRRKIEVVPNSDPLDGYYCDGAQLIALSRNFRSSSIDEMPNHTFYNDLLTRTEAIDNGSTETITTNTASRLNGNKYSMNTSISLPSFKIQDSNRDFSQSFTNVNLGTSNEHVDNKIKMKVTSDKISRH
Sbjct:   71 ATLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIYLDETLHAKTTTKTMTDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKKKKSQQHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHSNMSHSIISSTDSTPTSTLQSMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPINKYSHLLEFLKQHAVQLLQEMDAHLKVKNKEDLAISLINVLHKQGIAAEFLSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVNRISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQESLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQSNLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQSLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKWNEPSSVDASKENGGYWENLSSTLSLDSIDISLCLAKLHRQFEEYLQVIPVQKYTGNIEMLINIIADINERLSAKPDITEPVGVSYSHSYHDTNGQQGVEVVQNDCNEICGTPTRNPDMDQCHHNAQINQPKKIKSMNLSFSTETSPIHTYIDRDSTSGNHLMTQSMIQDHKNYSHIPHSDSIYREQVDKEWKEMVSESTYYHKISNINDKKKPKIERVHGISSDSSGYETLNRSNCKISNEDEINIYDKLPLSPSVFKQSVKKCKQFRRKIEVVPNSDPLDGYYCDGAQLIALSRNFRSSSIDEMPNHTFYNDLLTRTEAIDNGSTETITTNTASRLNGNKYSMNTSISLPSFKIQDSNRDFSQSFTNVNLGTSNEHVDNKIKMKVTSDKISRH 956          
The following BLAST results are available for this feature:
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DAB2IP3.454e-9439.27DAB2 interacting protein [Source:HGNC Symbol;Acc:H... [more]
DAB2IP3.564e-9439.27DAB2 interacting protein [Source:HGNC Symbol;Acc:H... [more]
DAB2IP7.453e-9439.27DAB2 interacting protein [Source:HGNC Symbol;Acc:H... [more]
DAB2IP8.409e-9439.27DAB2 interacting protein [Source:HGNC Symbol;Acc:H... [more]
DAB2IP1.027e-9339.27DAB2 interacting protein [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gap-22.824e-9838.58Ras GTPase-activating protein gap-2 [Source:UniPr... [more]
gap-23.323e-9838.58Ras GTPase-activating protein gap-2 [Source:UniPr... [more]
gap-27.274e-9838.58Ras GTPase-activating protein gap-2 [Source:UniPr... [more]
gap-21.360e-9738.58Ras GTPase-activating protein gap-2 [Source:UniPr... [more]
gap-22.090e-9738.58Ras GTPase-activating protein gap-2 [Source:UniPr... [more]
back to top
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
raskol4.160e-8734.01gene:FBgn0261570 transcript:FBtr0302836[more]
raskol5.179e-8734.14gene:FBgn0261570 transcript:FBtr0340629[more]
raskol1.119e-8634.01gene:FBgn0261570 transcript:FBtr0302834[more]
raskol1.257e-8634.01gene:FBgn0261570 transcript:FBtr0340631[more]
raskol1.270e-8634.01gene:FBgn0261570 transcript:FBtr0302835[more]
back to top
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dab2ipa1.005e-9339.47DAB2 interacting protein a [Source:ZFIN;Acc:ZDB-GE... [more]
dab2ipa1.154e-9339.47DAB2 interacting protein a [Source:ZFIN;Acc:ZDB-GE... [more]
dab2ipb5.833e-9239.07DAB2 interacting protein b [Source:ZFIN;Acc:ZDB-GE... [more]
dab2ipb8.953e-9239.07DAB2 interacting protein b [Source:ZFIN;Acc:ZDB-GE... [more]
dab2ipb1.499e-9139.07DAB2 interacting protein b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DAB2IP1.216e-9340.08DAB2 interacting protein [Source:NCBI gene;Acc:100... [more]
DAB2IP1.618e-9340.08DAB2 interacting protein [Source:NCBI gene;Acc:100... [more]
DAB2IP1.975e-9340.08DAB2 interacting protein [Source:NCBI gene;Acc:100... [more]
DAB2IP2.022e-9340.08DAB2 interacting protein [Source:NCBI gene;Acc:100... [more]
DAB2IP2.228e-9340.08DAB2 interacting protein [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dab2ip1.585e-9439.07disabled 2 interacting protein [Source:MGI Symbol;... [more]
Dab2ip2.227e-9439.07disabled 2 interacting protein [Source:MGI Symbol;... [more]
Dab2ip2.426e-9439.07disabled 2 interacting protein [Source:MGI Symbol;... [more]
Dab2ip2.612e-9439.07disabled 2 interacting protein [Source:MGI Symbol;... [more]
Dab2ip3.622e-9439.07disabled 2 interacting protein [Source:MGI Symbol;... [more]
back to top
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8MLZ5|GAP2_CAEEL1.219e-9538.58Ras GTPase-activating protein gap-2 OS=Caenorhabdi... [more]
sp|Q3UHC7|DAB2P_MOUSE3.697e-9339.07Disabled homolog 2-interacting protein OS=Mus musc... [more]
sp|Q5VWQ8|DAB2P_HUMAN4.930e-9339.27Disabled homolog 2-interacting protein OS=Homo sap... [more]
sp|Q6P730|DAB2P_RAT8.736e-8838.83Disabled homolog 2-interacting protein OS=Rattus n... [more]
sp|Q9UJF2|NGAP_HUMAN1.002e-8638.06Ras GTPase-activating protein nGAP OS=Homo sapiens... [more]
back to top
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4ANY27.230e-10137.87Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A3Q1GA505.092e-9939.07Uncharacterized protein OS=Acanthochromis polyacan... [more]
A0A3Q1ER525.931e-9839.27Uncharacterized protein OS=Acanthochromis polyacan... [more]
A0A3S2UDU66.827e-9838.87Uncharacterized protein OS=Oryzias javanicus OX=12... [more]
A0A3B3DB071.331e-9738.87Uncharacterized protein OS=Oryzias melastigma OX=3... [more]
back to top
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dab2ipb6.773e-9539.47DAB2 interacting protein [Source:NCBI gene;Acc:103... [more]
dab2ipb1.188e-9439.47DAB2 interacting protein [Source:NCBI gene;Acc:103... [more]
dab2ipb2.210e-9439.47DAB2 interacting protein [Source:NCBI gene;Acc:103... [more]
dab2ipb1.535e-9339.47DAB2 interacting protein [Source:NCBI gene;Acc:103... [more]
dab2ipb1.198e-9239.27DAB2 interacting protein [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000945.11.779e-8137.07pep scaffold:Pmarinus_7.0:GL477254:323984:383899:1... [more]
back to top
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BUD21.215e-1727.11GTPase activating factor for Rsr1p/Bud1p; plays a ... [more]
back to top
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO357991.321e-8035.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361901.932e-2625.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434463.382e-2629.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409331.424e-1128.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000022035.25.066e-10138.87disabled homolog 2-interacting protein-like [Sourc... [more]
dab2ipb2.462e-9339.68DAB2 interacting protein [Source:NCBI gene;Acc:101... [more]
dab2ipb3.482e-9339.68DAB2 interacting protein [Source:NCBI gene;Acc:101... [more]
dab2ipb3.610e-9339.68DAB2 interacting protein [Source:NCBI gene;Acc:101... [more]
dab2ipb4.254e-9339.68DAB2 interacting protein [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of ras GTPase-activating protein nGAP isoform X8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037132.10.000e+099.13SMESG000037132.1[more]
SMESG000037132.10.000e+098.15SMESG000037132.1[more]
SMESG000037132.10.000e+096.65SMESG000037132.1[more]
SMESG000037132.10.000e+096.39SMESG000037132.1[more]
SMESG000037132.10.000e+098.87SMESG000037132.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017175 ID=SMED30017175|Name=ras GTPase-activating protein nGAP isoform X8|organism=Schmidtea mediterranea sexual|type=transcript|length=4815bp
AAAAATTTCATTTTAACATTTTCTAAATATTCAACAATAATTCCAATCGA
TATAAACAATAAATTGCACAATGTTTTCACACATTCAATCGAATGGCAAT
TACAAATTATGCCGTCGTCCTCGTCGTCGTCAATGCACGTGTTGGCTCAC
TATTAATAATATATTTATGCAAAAACTTCTCTCTCATTATTTCTAGCAAT
TTCTCAGCTGGTCAACACAAATGTTAGAATATCATCCAGGAATTTATGTT
CACAAATCATCGCAATTGTCAAAATGTTTAATAAAAGAAATTATTGCAAT
AATCAACTGACAGTAATATGCAGTGCCATTGTTGTCCCATACTTGTTGGA
ACACTTTCAATTTCACAGCCGGGATGTTTCGATGTGTGCGTGTGAGTGTG
TCTACGTGTGACAATACTATGCTAGTAGGTGTGCCACTCTTTTGATTGGC
AGCAGTCATTATTCCCACTTCCTATTATAACCTGCAAATGAATGGGTGTT
CCAATATTTTTTAATACATATTTACCTTATTATTTTACTGTATAATCGAT
TGGAGCACTTGAATAGCAAAAGTTTCATCAAGAAATGAAATCCCAGCAAC
GAACGTATTCCAAGCCCTCTGGATTCAATTTGTCAAAAACAGCTTCCCAT
GATTCCTGCCTGGATCAAATAGAGGAGGCATACATTAACGATGACTGCCC
TAGTGTGGGGGGCAAATATTCAAAATCAAATTCAAACAGGCGGTTCACGA
TGACTATGGCTTCATCTCGGTCATCCTTATTGGATATCAGCAAGCCGCAA
GCATCCAGTAGCCAACGATTTCTAGCCTTCATTCAGAAAGGTATCCATGG
CAGCAGAAACAAATCCATCAACAAATTAGATAATCCGACCTTTATCAAAA
TTGTAAATGAAAAGAAATACTTAGAAGCTCTAAATGAGGTCGTTCCTATT
CCGATTCGCGAAACTGCCATTCAAGGCCATTCTAAAATTCTCTTTCACAA
GATCCCAAAGTCAAATGTAAGACCAAGACCCCTGTTGAAACTTGGTGAAG
AGACTAAATTCGTTCTGATACATCCGAGTCTTCTGTCAAAAAATATTCAT
CATTGTGTAAAAATAGTGTCGTTATCACCGAGCATTTACAGGAACTGCAG
TTCTGGAAATCAGTACGAATTATTACTGCCAACGGGAACGCGTTCACTTG
GCCATACGTGCCAGATTATCGGAACCAAGAAATTGCAGGAACAATGCCCA
AGTTGCAATTCATCTCGGCTATCGTTATTTGCATCAGCGGAACAGCAAAA
TCATTTATTGGCCTACGTATTCTCATGCTTCAGCGAATCTGAAAGAAAAA
AATGGCTGAGCGTATTGACTCGAGTTGTCAGGCCAAACCTACAGAATGAA
CGCAGGCAGGAAATATCCCTAAACTTATGGATCCAGGAGGCCAAAAATGT
CCCTTTAAAGAAAAGATATTTCTGTGAGATTTATCTTGATGAAACTTTGC
ACGCAAAAACTACAACTAAGACAATGACAGACTTACTTTTCTGGGGCGAG
GAATTCAATTTATGCCATTTGGAACAAGTGAACACAGTCACCATTCTGCT
CTGGAAGGCTTCCAGTGACAACAGAGCCAAAAAGAAAAAGTCGCAACATC
ATCTAATTTGTCAGGTAAATATCGAAACCAAAGATATTTCAGCTCGAAAC
AATGTTGAAAGGTGGTATCCAGCGTCATGCAGTTATAATTCAAGCGGTAC
AGAAATTGTCCACTCAAATATGTCACATTCTATCATTTCTTCAACCGATT
CAACTCCTACATCCACCCTCCAATCAATGCATTCTACGAATCTCAGTCAG
TCAACCGCGTCGCTAAGCAATAGTGATCACTTGCCAATGATCAGGATCAA
AGCTCGATATCAGAATATCGATGTGCTGCCAATCAATAAATATTCACATC
TCTTAGAATTTCTCAAACAGCATGCCGTTCAATTGCTTCATGAAATGGAC
GCTCACTTAAAAGTTAAAAATAAAGAAGACTTAGCGATTAGTCTCATAAA
TGTTTTGCATAAACAAGGTATTGCGGCAGAATTCCTCAGTGACCTCTTAT
TTCAAGAAATCAAAAAATCAGATAATGAAAACATGATTTTGAGAGGAAAT
ACTATAGCTTCTAAAGCAATTGAAGTATATTTGAAATTGATAGGAGAAAA
ATATTTAAGCCTGATTTTGTCAGATTTTGTTAACAGAATATCTCAAGGAG
ATGAGGACTGCGAAGTTGATCCACAAAGGTCAAAATGCGAATTTTTCAGT
AATTCTTCTTTGAATGAATGTCAATCCTTGCAGAATGGCGATAAATCCAG
TCATTTTCACCCAATGCTCTTGCAGAGACAAGAAAGTCTAATGATGAATG
TTGACATGATTTGGGCCAAAATCTTGAGTAGTTCTATTTATTTTCCAAGG
GAGCTGAAATCTGTGTTTGTATCACTGAGGAAAAGACTTGAACAAATGGA
CCGGACCGCCAATCAAATGGATAATTCGCAATCTAATCTTTATGAACGCA
TTGTTTCTTCCTGTATTTTCCTTAGATTCATTTGTCCAGCTATTTTGACT
CCATCATTATTTGGACTTCTACCAGAATACCCAGATAATCCAAAAGTTTT
AAGAACATTTACTCTTGTTGCTAAATGTATACAAAGCTTGGCCAATTTCT
CAGACCTCACGGGATCTAAGGAATCCTACATGCTGTTTATGAATACTTTC
ATTGAAAATAAGTTCACCACCATGCAATCTTTCCTGAAAGAAATATCCTC
ATCAACCGATGATGACTACTCTAGGTCAAAATGGAATGAACCAAGTTCTG
TTGATGCTTCCAAAGAAAACGGAGGATATTGGGAAAATTTGAGCAGCACA
TTGTCTTTGGATTCCATCGATATATCACTCTGTTTAGCTAAACTTCATCG
ACAATTCGAAGAATACCTACAGGTGATCCCTGTACAAAAATATACGGGCA
ACATTGAGATGCTGATAAATATCATCGCCGATATCAATGAGAGACTGTCG
GCCAAACCTGATGTCACTGAACCGGTTGGCGTAAGCTACAGTCATTCATA
TCATGATGTCAATGGTCAGCAAGGTGTGGAAGTAGTACAAAATGATTGTA
ATGAGATCTGCGGGACGCCTACAAGAAACCCAGACATGGACCAGTGCCAC
CATAATGCACAAATTAATCAGCCAAAAAAAATTAAATCTATGAATCTTTC
TTTTTCTACAGAAACTTCACCGATACATACCTATATTGACAGAGATTCGA
CATCTGGAAATTACCTCATGACTCAGTCTATGATCCAGGATCATAAAAAT
TATTCACATATTCCTCATCCTGATAGCATATATCGTGAACAGGTTGACAA
AGAATGGAAAGAAATGGTAAGCGAATCAACTTATTATCACAAGATATCTA
ATATCAACGACAAAAAGAAACCAAAAATTGAAAGGCTTCATGGGATCAGC
AGCGATTCATCAGGATATGAAACTTTGAACCGTTCTAATTGTAAAATTTC
AAATGAGGATGAAATAAATATGTATGACAAACTTCCTTTGTCACCTTCAG
TTTTTAAGCAATCAGTGAAAAAATGCAAGCAGTTTAGGCGAAAAATAGAA
GTGGTACCTAATTCAGATCCTCTAGATGGTTATTATTGTGATGGGGCGCA
ATTAATTGCACTGAGCAGGAACTTCAGGTCAAGCAGCATTGACGAAATGC
CAAATCACACTTTCTATAATGATTTGTTAACCCGTACCGAAGCAATTGAT
AACGGATCTACGGAAACAATTACAACAAATACTGCATCTCGACTGAATGG
AAATAAATATTCAATGAATACATCTATCTCACTACCTTCCTTCAAAATCC
AGGACTCAAATCGTGACTTTTCCCAGTCTTTTACAAATGTCAACCTGGGA
ACTTCGAATGAACATGTTGATAATAAGATCAAAATGAAAGTGACGTCCGA
CAAAATTTCGAGACACCAACTGAAAACCTCTCCGACACTCAATTACAATT
CTGACGCAACATTTCAACGGCTGCTTCTTGCTGACCAGAAAACTGTTGAA
CTAGAACTAGAACGAGTGCGGCTTATGAAGCAAATATGCGATACGGCAGC
GAAATCGAATACCAACTTCGCTTCCGCAGAAATGGAGGAACAAAAGCAGT
TTATCCAACAGCATAATATCAACGGATTTAATGAAGTTTCCAAACTAAAC
CGTTCAAATCAACTTTCTGTTAAAAGGTATCTCGAAATAGCAGAAAATAT
TTTGCTGAATTGTCGAAAAAATCAGATTCCGAAATATTGTGATTTCCAGG
AAAAAGAAAATCTAATTATTCAGATATTTGAGATAAATCAAAGTTTGCAA
AACGCGTTGATCAAAAACATGCAAGGTTTAATTTTCAATTCAGAACCAGA
AAGGCCTGAAAAAATTGCCAGTTACGGGCCCCATCCTTGCACCAGTAATG
CGACAGCTATGATTTCCAACAGAATAATCACCCCTCGGTCATCAGCATCA
AGCAATGTCAATCAAATTTCCCCATCGAAACATTTTTCTATTAACAAGAG
GGATTCCTCATCTCCCCCCTCTGCAGCTGTTATCGAAATCATTGATGCCG
TATGAATTGAAACTAAATGATTTGTTTATTGAAATTTGTTAAATTGCACA
AACTAACATTTAATTTCTGTAAAGATTTTCTTTTTTATTATTTCAGAATA
ATTTAATTTTTTGCTAAACATAAATTTTAATCTCAAATTTAATAAATTCG
GCCGCTAGAAAAGGT
back to top

protein sequence of SMED30017175-orf-1

>SMED30017175-orf-1 ID=SMED30017175-orf-1|Name=SMED30017175-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1357bp
MKSQQRTYSKPSGFNLSKTASHDSCLDQIEEAYINDDCPSVGGKYSKSNS
NRRFTMTMASSRSSLLDISKPQASSSQRFLAFIQKGIHGSRNKSINKLDN
PTFIKIVNEKKYLEALNEVVPIPIRETAIQGHSKILFHKIPKSNVRPRPL
LKLGEETKFVLIHPSLLSKNIHHCVKIVSLSPSIYRNCSSGNQYELLLPT
GTRSLGHTCQIIGTKKLQEQCPSCNSSRLSLFASAEQQNHLLAYVFSCFS
ESERKKWLSVLTRVVRPNLQNERRQEISLNLWIQEAKNVPLKKRYFCEIY
LDETLHAKTTTKTMTDLLFWGEEFNLCHLEQVNTVTILLWKASSDNRAKK
KKSQHHLICQVNIETKDISARNNVERWYPASCSYNSSGTEIVHSNMSHSI
ISSTDSTPTSTLQSMHSTNLSQSTASLSNSDHLPMIRIKARYQNIDVLPI
NKYSHLLEFLKQHAVQLLHEMDAHLKVKNKEDLAISLINVLHKQGIAAEF
LSDLLFQEIKKSDNENMILRGNTIASKAIEVYLKLIGEKYLSLILSDFVN
RISQGDEDCEVDPQRSKCEFFSNSSLNECQSLQNGDKSSHFHPMLLQRQE
SLMMNVDMIWAKILSSSIYFPRELKSVFVSLRKRLEQMDRTANQMDNSQS
NLYERIVSSCIFLRFICPAILTPSLFGLLPEYPDNPKVLRTFTLVAKCIQ
SLANFSDLTGSKESYMLFMNTFIENKFTTMQSFLKEISSSTDDDYSRSKW
NEPSSVDASKENGGYWENLSSTLSLDSIDISLCLAKLHRQFEEYLQVIPV
QKYTGNIEMLINIIADINERLSAKPDVTEPVGVSYSHSYHDVNGQQGVEV
VQNDCNEICGTPTRNPDMDQCHHNAQINQPKKIKSMNLSFSTETSPIHTY
IDRDSTSGNYLMTQSMIQDHKNYSHIPHPDSIYREQVDKEWKEMVSESTY
YHKISNINDKKKPKIERLHGISSDSSGYETLNRSNCKISNEDEINMYDKL
PLSPSVFKQSVKKCKQFRRKIEVVPNSDPLDGYYCDGAQLIALSRNFRSS
SIDEMPNHTFYNDLLTRTEAIDNGSTETITTNTASRLNGNKYSMNTSISL
PSFKIQDSNRDFSQSFTNVNLGTSNEHVDNKIKMKVTSDKISRHQLKTSP
TLNYNSDATFQRLLLADQKTVELELERVRLMKQICDTAAKSNTNFASAEM
EEQKQFIQQHNINGFNEVSKLNRSNQLSVKRYLEIAENILLNCRKNQIPK
YCDFQEKENLIIQIFEINQSLQNALIKNMQGLIFNSEPERPEKIASYGPH
PCTSNATAMISNRIITPRSSASSNVNQISPSKHFSINKRDSSSPPSAAVI
EIIDAV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR039360Ras_GTPase
IPR001849PH_domain
IPR001936RasGAP_dom
IPR000008C2_dom
IPR023152RasGAP_CS
IPR008936Rho_GTPase_activation_prot
Vocabulary: biological process
TermDefinition
GO:0043087regulation of GTPase activity
GO:0007165signal transduction
GO:0046580negative regulation of Ras protein signal transduction
GO:0007614short-term memory
GO:0007616long-term memory
GO:0008285negative regulation of cell proliferation
GO:0008306associative learning
GO:0016525negative regulation of angiogenesis
GO:0030948negative regulation of vascular endothelial growth factor receptor signaling pathway
GO:0038026reelin-mediated signaling pathway
GO:0043065positive regulation of apoptotic process
GO:0043547positive regulation of GTPase activity
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005096GTPase activator activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0031235intrinsic component of the cytoplasmic side of the plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001936Ras GTPase-activating domainSMARTSM00323RasGAP_2coord: 428..802
e-value: 1.9E-67
score: 240.1
IPR001936Ras GTPase-activating domainPFAMPF00616RasGAPcoord: 500..704
e-value: 2.6E-29
score: 102.4
IPR001936Ras GTPase-activating domainPROSITEPS50018RAS_GTPASE_ACTIV_2coord: 479..704
score: 42.174
NoneNo IPR availableGENE3DG3DSA:1.10.506.10coord: 498..760
e-value: 2.0E-93
score: 315.1
NoneNo IPR availableGENE3DG3DSA:1.10.506.20coord: 448..822
e-value: 2.0E-93
score: 315.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 403..424
NoneNo IPR availablePANTHERPTHR10194:SF125RAS GTPASE-ACTIVATING PROTEIN-RELATEDcoord: 205..1220
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 279..380
IPR000008C2 domainPFAMPF00168C2coord: 279..379
e-value: 2.8E-4
score: 21.1
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 258..396
e-value: 3.0E-6
score: 29.1
IPR039360Ras GTPase-activating proteinPANTHERPTHR10194RAS GTPASE-ACTIVATING PROTEINScoord: 205..1220
IPR023152Ras GTPase-activating protein, conserved sitePROSITEPS00509RAS_GTPASE_ACTIV_1coord: 659..673
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 244..266
score: 6.855
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 453..769