Dynein heavy chain

Overview
NameDynein heavy chain
Smed IDSMED30017158
Length (bp)5668
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein heavy chain (SMED30017158) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein heavy chain (SMED30017158) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017158

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017158SMESG000073407.1 Contig5910uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017158SMESG000073407.1 Contig5910newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
muscle cellSMED30017158SMESG000073407.1 dd_Smed_v4_8201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30017158SMESG000073407.1 dd_Smed_v4_8201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017158SMESG000073407.1 dd_Smed_v4_8201_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30017158SMESG000073407.1 Contig40447uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30017158SMESG000073407.1 Contig40447newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30017158SMESG000073407.1 Contig33784uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30017158SMESG000073407.1 Contig33784newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein heavy chain vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1850.1 bits (4791), Expect = 0.000e+0
Identity = 956/1851 (51.65%), Postives = 1317/1851 (71.15%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLS-ITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPN-NSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI-WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+VF GL  +  +RF    QM+R+WR+ECLRVF+DR+I+  DK++VQ  + +++   F   +  V  +PIL+GD+     + EPR+YED+QDY   K+ FQE +E YNE    +++LVLFDDALEHL  +HRI+RMD GHALLVGV GSGK+SLSRLAAF A    FEI LS+GY E  FREDLK +Y KL  EN   +FLF D HVA+EGFLELINNMLT G+VP LF+++EKE +L  +  +  K G    KE +WQYF       LHIVL MSPVG TLR  CRNFPG+VNNT IDWF PWP QAL +VA   +   NP+IP++  E+V+ HVV +H+SV+  SQ F  KLRR NY+T  N++++I TY  LL+ K      + +RL  GLDKL+    Q+  LN K+AEQKI++ EK+ +CE L+ EI ++T  A  KKK+ EEK++EI +Q+KVI  EK EAE  L+  MP LEAAK  L +LDK+DVTEIR+FA PPK VQ V E + ++    E++WK+A+G+M+D NF++ L  +D ++I    +  +K  +     T E++ A SKAG G LKF+ +V+G+ DV REI+PK+E+V  LER F   ++ELER+Q E+  ++ +L+TL  +++ A  E ++L +E  IM+R+L+AA+KL  GL SE  RW++D+      RV LLGDCL+ +AFL+Y G FT+E+R  +V   W   +    IP S+ F++++LLT DVEIS+W SQGLP DELS+QN ILTT+++RFP+CIDPQ+QA+ WIK+     K+E  ++++++ ND  FL+ LE SIK+G P+LF D DE++DPVIDNVL KNI  S+GR++++LGD+EVD++  FRLYL +KL+NP++SPS++ +A +INYTVTL GLE QLLS LV  ERRELEE+RE+LI ETSENK +LK+LED LL ELAT TGN+LDN +L++TLE+TK+KA +V+++L  +   + DI+R RDGYRPAA+RGA+LFFVL+ ++++N+MYQ+SL ++L VF  ++++S+PDS L KRL NI+ TLTF +Y +GCTG+FE+HK+L S  + +++E+  G +   E+DFF+KGNI++     +    WL D  W+D+  LS +    F  + D V NN+  W+ WY L S E   +    + N   F+KL +LRC+R+DR+  A+TD+VT  MG+++V PP+ +F A F  STP  PIV I+SPGSDP T+++KLA    F  +++K+L+MGQGQEK AL L +TAV+RGQWLMLQN HLL+K++  +EK L+ + KPHPDFRLWLTT+P   FPIGILQKS K+V EPP+G+K N+  TY KI +E+    PHP ++  ++ LAF HA++QERR+FGKIGWN+ YDF ESDFQV ++IL TYLTKA +++   +PW ++KYLIGEVMYGGRAIDSFDRRIL  YMDEY GDF+FD FQ FHF+ +  ++Y IP   E     KE + E I++LP   +P VFGLH NA IGY T   +++W +++ELQPQT     E+    S++  + ++   I +K+P ++D++++++ L      +SPT+VVLLQEL+RFN L+ +M  SL  L++AL GEVGMS ELDD+++SL  G +PN WR LAP+T+K LG+W+ +  +R  QY  W+   +   PS+ WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T  +D    N       GC+V G+Y+EG  WD++ GC+I  K + L+  +PI+++ PIE+H+ K  NT + PVY TS RRNAMG+GLV   DL TT H SHW+LQG+ LTLNSD
Sbjct: 2763 PTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRLISETDKQLVQQHIGSLVVEHFKDDVEVVMRDPILFGDFQMALHEGEPRIYEDIQDYEAAKALFQEILEEYNE-SNTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLSRLAAFTASCEVFEILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKESVWQYFVNKSANNLHIVLGMSPVGDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLG-YNPMIPAENIENVVKHVVLVHQSVDHYSQQFLQKLRRSNYVTPKNYLDFINTYSKLLDEKTQCNIAQCKRLDGGLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAMEKAEAETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKGYKELNWKTAKGVMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNRIWQNDILEREIPLSQPFRLESLLTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKR-----KEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFRDVDEYIDPVIDNVLEKNIKVSQGRQFIILGDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVDLVHTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFRLSLKKSLPDSILMKRLRNIMDTLTFSIYNHGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGNISLEKSKRKKPCAWLSDQGWEDIILLSEMFSDNFGQLPDDVENNQTVWQEWYDLDSLEQFPVPLGYDNNITPFQKLLILRCFRVDRVYRAVTDYVTVTMGEKYVQPPMISFEAIFEQSTPHSPIVFILSPGSDPATDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEMLDQCPHPAFKPLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFDTFQPFHFFRNKEVDYKIPVGDE-----KEKFVEAIEALPLANTPEVFGLHPNAEIGYYTQAARDMWAHLLELQPQTG----ESSSGISRDDYIGQVAKEIENKMPKVFDLDQVRKRL---GTGLSPTSVVLLQELERFNKLVVRMTKSLAELQRALAGEVGMSNELDDVARSLFIGHIPNIWRRLAPDTLKSLGNWMVYFLRRFSQYMLWVTESE---PSVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLFTQVTKFQDADEVNERAGQ--GCFVSGLYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLFTTRHISHWVLQGVCLTLNSD 4589          
BLAST of Dynein heavy chain vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1850.1 bits (4791), Expect = 0.000e+0
Identity = 955/1851 (51.59%), Postives = 1320/1851 (71.31%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLS-ITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPN-NSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI-WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+VF GL  +  +RF    QM+R+WR+ECLRVF+DR+I+  DK++VQ  + +++   F   +  V  +PIL+GD+     + EPR+YED+QDY   K+ FQE +E YNE    +++LVLFDDALEHL  +HRI+RMD GHALLVGV GSGK+SLSRLAAF A    FEI LS+GY E  FREDLK +Y KL  EN   +FLF D HVA+EGFLELINNMLT G+VP LF+++EKE +L  +  +  K G    KE +WQYF       LHIVL MSPVG TLR  CRNFPG+VNNT IDWF PWP QAL +VA   +   NP+IP++  E+V+ HVV +H+SV+  SQ F  KLRR NY+T  N++++I TY  LL+ K      + +RL  GLDKL+    Q+  LN K+AEQKI++ EK+ +CE L+ EI ++T  A  KKK+ EEK++EI +Q+KVI  EK EAE  L+  MP LEAAK  L +LDK+DVTEIR+FA PPK VQ V E + ++    E++WK+A+G+M+D NF++ L  +D ++I    +  +K  +     T E++ A SKAG G LKF+ +V+G+ DV REI+PK+E+V  LER F   ++ELER+Q E+  ++ +L+TL  +++ A  E ++L +E  IM+R+L+AA+KL  GL SE  RW++D+      RV LLGDCL+ +AFL+Y G FT+E+R  +V   W   +    IP S+ F++++LLT DVEIS+W SQGLP DELS+QN ILTT+++RFP+CIDPQ+QA+ WIK+     K+E  ++++++ ND  FL+ LE SIK+G P+LF D DE++DPVIDNVL KNI  S+GR++++LGD+EVD++  FRLYL +KL+NP++SPS++ +A +INYTVTL GLE QLLS LV  ERRELEE+RE+LI ETSENK +LK+LED LL ELAT TGN+LDN +L++TLE+TK+KA +V+++L  +   + DI+R RDGYRPAA+RGA+LFFVL+ ++++N+MYQ+SL ++L VF  ++++S+PDS L KRL NI+ TLTF +Y +GCTG+FE+HK+L S  + +++E+  G +   E+DFF+KGNI++     +    WL D  W+D+  LS +    F  + D V NN+  W+ WY L S E   +    + N   F+KL +LRC+R+DR+  A+TD+VT  MG+++V PP+ +F A F  STP  PIV I+SPGSDP T+++KLA    F  +++K+L+MGQGQEK AL L +TAV+RGQWLMLQN HLL+K++  +EK L+ + KPHPDFRLWLTT+P   FPIGILQKS K+V EPP+G+K N+  TY KI +E+    PHP ++  ++ LAF HA++QERR+FGKIGWN+ YDF ESDFQV ++IL TYLTKA +++   +PW ++KYLIGEVMYGGRAIDSFDRRIL  YMDEY GDF+FD FQ FHF+ +  ++Y IP   E     KE + E I++LP   +P VFGLH NA IGY T   +++W +++ELQPQT     E+    S++  + ++   I +K+P ++D++++++ L      +SPT+VVLLQEL+RFN L+ +M  SL  L++AL GEVGMS ELDD+++SL  G +PN WR LAP+T+K LG+W+ +  +R  QY  W+   +   PS+ WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T  +D  ++ +   +  GC+V G+Y+EG  WD++ GC+I  K + L+  +PI+++ PIE+H+ K  NT + PVY TS RRNAMG+GLV   DL TT H SHW+LQG+ LTLNSD
Sbjct: 2706 PTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRLISETDKQLVQQHIGSLVVEHFKDDVEVVMRDPILFGDFQMALHEGEPRIYEDIQDYEAAKALFQEILEEYNE-SNTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLSRLAAFTASCEVFEILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKESVWQYFVNKSANNLHIVLGMSPVGDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLG-YNPMIPAENIENVVKHVVLVHQSVDHYSQQFLQKLRRSNYVTPKNYLDFINTYSKLLDEKTQCNIAQCKRLDGGLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAMEKAEAETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKGYKELNWKTAKGVMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNRIWQNDILEREIPLSQPFRLESLLTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKR-----KEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFRDVDEYIDPVIDNVLEKNIKVSQGRQFIILGDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVDLVHTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFRLSLKKSLPDSILMKRLRNIMDTLTFSIYNHGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGNISLEKSKRKKPCAWLSDQGWEDIILLSEMFSDNFGQLPDDVENNQTVWQEWYDLDSLEQFPVPLGYDNNITPFQKLLILRCFRVDRVYRAVTDYVTVTMGEKYVQPPMISFEAIFEQSTPHSPIVFILSPGSDPATDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEMLDQCPHPAFKPLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFDTFQPFHFFRNKEVDYKIPVGDE-----KEKFVEAIEALPLANTPEVFGLHPNAEIGYYTQAARDMWAHLLELQPQTG----ESSSGISRDDYIGQVAKEIENKMPKVFDLDQVRKRL---GTGLSPTSVVLLQELERFNKLVVRMTKSLAELQRALAGEVGMSNELDDVARSLFIGHIPNIWRRLAPDTLKSLGNWMVYFLRRFSQYMLWVTESE---PSVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLFTQVTKFQD--ADEVNERAGQGCFVSGLYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLFTTRHISHWVLQGVCLTLNSD 4532          
BLAST of Dynein heavy chain vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1849.33 bits (4789), Expect = 0.000e+0
Identity = 956/1851 (51.65%), Postives = 1317/1851 (71.15%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLS-ITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPN-NSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI-WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+VF GL  +  +RF    QM+R+WR+ECLRVF+DR+I+  DK++VQ  + +++   F   +  V  +PIL+GD+     + EPR+YED+QDY   K+ FQE +E YNE    +++LVLFDDALEHL  +HRI+RMD GHALLVGV GSGK+SLSRLAAF A    FEI LS+GY E  FREDLK +Y KL  EN   +FLF D HVA+EGFLELINNMLT G+VP LF+++EKE +L  +  +  K G    KE +WQYF       LHIVL MSPVG TLR  CRNFPG+VNNT IDWF PWP QAL +VA   +   NP+IP++  E+V+ HVV +H+SV+  SQ F  KLRR NY+T  N++++I TY  LL+ K      + +RL  GLDKL+    Q+  LN K+AEQKI++ EK+ +CE L+ EI ++T  A  KKK+ EEK++EI +Q+KVI  EK EAE  L+  MP LEAAK  L +LDK+DVTEIR+FA PPK VQ V E + ++    E++WK+A+G+M+D NF++ L  +D ++I    +  +K  +     T E++ A SKAG G LKF+ +V+G+ DV REI+PK+E+V  LER F   ++ELER+Q E+  ++ +L+TL  +++ A  E ++L +E  IM+R+L+AA+KL  GL SE  RW++D+      RV LLGDCL+ +AFL+Y G FT+E+R  +V   W   +    IP S+ F++++LLT DVEIS+W SQGLP DELS+QN ILTT+++RFP+CIDPQ+QA+ WIK+     K+E  ++++++ ND  FL+ LE SIK+G P+LF D DE++DPVIDNVL KNI  S+GR++++LGD+EVD++  FRLYL +KL+NP++SPS++ +A +INYTVTL GLE QLLS LV  ERRELEE+RE+LI ETSENK +LK+LED LL ELAT TGN+LDN +L++TLE+TK+KA +V+++L  +   + DI+R RDGYRPAA+RGA+LFFVL+ ++++N+MYQ+SL ++L VF  ++++S+PDS L KRL NI+ TLTF +Y +GCTG+FE+HK+L S  + +++E+  G +   E+DFF+KGNI++     +    WL D  W+D+  LS +    F  + D V NN+  W+ WY L S E   +    + N   F+KL +LRC+R+DR+  A+TD+VT  MG+++V PP+ +F A F  STP  PIV I+SPGSDP T+++KLA    F  +++K+L+MGQGQEK AL L +TAV+RGQWLMLQN HLL+K++  +EK L+ + KPHPDFRLWLTT+P   FPIGILQKS K+V EPP+G+K N+  TY KI +E+    PHP ++  ++ LAF HA++QERR+FGKIGWN+ YDF ESDFQV ++IL TYLTKA +++   +PW ++KYLIGEVMYGGRAIDSFDRRIL  YMDEY GDF+FD FQ FHF+ +  ++Y IP   E     KE + E I++LP   +P VFGLH NA IGY T   +++W +++ELQPQT     E+    S++  + ++   I +K+P ++D++++++ L      +SPT+VVLLQEL+RFN L+ +M  SL  L++AL GEVGMS ELDD+++SL  G +PN WR LAP+T+K LG+W+ +  +R  QY  W+   +   PS+ WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T  +D    N       GC+V G+Y+EG  WD++ GC+I  K + L+  +PI+++ PIE+H+ K  NT + PVY TS RRNAMG+GLV   DL TT H SHW+LQG+ LTLNSD
Sbjct: 2645 PTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRLISETDKQLVQQHIGSLVVEHFKDDVEVVMRDPILFGDFQMALHEGEPRIYEDIQDYEAAKALFQEILEEYNE-SNTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLSRLAAFTASCEVFEILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKESVWQYFVNKSANNLHIVLGMSPVGDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLG-YNPMIPAENIENVVKHVVLVHQSVDHYSQQFLQKLRRSNYVTPKNYLDFINTYSKLLDEKTQCNIAQCKRLDGGLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAMEKAEAETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKGYKELNWKTAKGVMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNRIWQNDILEREIPLSQPFRLESLLTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKR-----KEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFRDVDEYIDPVIDNVLEKNIKVSQGRQFIILGDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVDLVHTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFRLSLKKSLPDSILMKRLRNIMDTLTFSIYNHGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGNISLEKSKRKKPCAWLSDQGWEDIILLSEMFSDNFGQLPDDVENNQTVWQEWYDLDSLEQFPVPLGYDNNITPFQKLLILRCFRVDRVYRAVTDYVTVTMGEKYVQPPMISFEAIFEQSTPHSPIVFILSPGSDPATDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEMLDQCPHPAFKPLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFDTFQPFHFFRNKEVDYKIPVGDE-----KEKFVEAIEALPLANTPEVFGLHPNAEIGYYTQAARDMWAHLLELQPQTG----ESSSGISRDDYIGQVAKEIENKMPKVFDLDQVRKRL---GTGLSPTSVVLLQELERFNKLVVRMTKSLAELQRALAGEVGMSNELDDVARSLFIGHIPNIWRRLAPDTLKSLGNWMVYFLRRFSQYMLWVTESE---PSVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLFTQVTKFQDADEVNERAGQ--GCFVSGLYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLFTTRHISHWVLQGVCLTLNSD 4471          
BLAST of Dynein heavy chain vs. Ensembl Human
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1848.17 bits (4786), Expect = 0.000e+0
Identity = 956/1851 (51.65%), Postives = 1317/1851 (71.15%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLS-ITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPN-NSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI-WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+VF GL  +  +RF    QM+R+WR+ECLRVF+DR+I+  DK++VQ  + +++   F   +  V  +PIL+GD+     + EPR+YED+QDY   K+ FQE +E YNE    +++LVLFDDALEHL  +HRI+RMD GHALLVGV GSGK+SLSRLAAF A    FEI LS+GY E  FREDLK +Y KL  EN   +FLF D HVA+EGFLELINNMLT G+VP LF+++EKE +L  +  +  K G    KE +WQYF       LHIVL MSPVG TLR  CRNFPG+VNNT IDWF PWP QAL +VA   +   NP+IP++  E+V+ HVV +H+SV+  SQ F  KLRR NY+T  N++++I TY  LL+ K      + +RL  GLDKL+    Q+  LN K+AEQKI++ EK+ +CE L+ EI ++T  A  KKK+ EEK++EI +Q+KVI  EK EAE  L+  MP LEAAK  L +LDK+DVTEIR+FA PPK VQ V E + ++    E++WK+A+G+M+D NF++ L  +D ++I    +  +K  +     T E++ A SKAG G LKF+ +V+G+ DV REI+PK+E+V  LER F   ++ELER+Q E+  ++ +L+TL  +++ A  E ++L +E  IM+R+L+AA+KL  GL SE  RW++D+      RV LLGDCL+ +AFL+Y G FT+E+R  +V   W   +    IP S+ F++++LLT DVEIS+W SQGLP DELS+QN ILTT+++RFP+CIDPQ+QA+ WIK+     K+E  ++++++ ND  FL+ LE SIK+G P+LF D DE++DPVIDNVL KNI  S+GR++++LGD+EVD++  FRLYL +KL+NP++SPS++ +A +INYTVTL GLE QLLS LV  ERRELEE+RE+LI ETSENK +LK+LED LL ELAT TGN+LDN +L++TLE+TK+KA +V+++L  +   + DI+R RDGYRPAA+RGA+LFFVL+ ++++N+MYQ+SL ++L VF  ++++S+PDS L KRL NI+ TLTF +Y +GCTG+FE+HK+L S  + +++E+  G +   E+DFF+KGNI++     +    WL D  W+D+  LS +    F  + D V NN+  W+ WY L S E   +    + N   F+KL +LRC+R+DR+  A+TD+VT  MG+++V PP+ +F A F  STP  PIV I+SPGSDP T+++KLA    F  +++K+L+MGQGQEK AL L +TAV+RGQWLMLQN HLL+K++  +EK L+ + KPHPDFRLWLTT+P   FPIGILQKS K+V EPP+G+K N+  TY KI +E+    PHP ++  ++ LAF HA++QERR+FGKIGWN+ YDF ESDFQV ++IL TYLTKA +++   +PW ++KYLIGEVMYGGRAIDSFDRRIL  YMDEY GDF+FD FQ FHF+ +  ++Y IP   E     KE + E I++LP   +P VFGLH NA IGY T   +++W +++ELQPQT     E+    S++  + ++   I +K+P ++D++++++ L      +SPT+VVLLQEL+RFN L+ +M  SL  L++AL GEVGMS ELDD+++SL  G +PN WR LAP+T+K LG+W+ +  +R  QY  W+   +   PS+ WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T  +D    N       GC+V G+Y+EG  WD++ GC+I  K + L+  +PI+++ PIE+H+ K  NT + PVY TS RRNAMG+GLV   DL TT H SHW+LQG+ LTLNSD
Sbjct: 1370 PTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRLISETDKQLVQQHIGSLVVEHFKDDVEVVMRDPILFGDFQMALHEGEPRIYEDIQDYEAAKALFQEILEEYNE-SNTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLSRLAAFTASCEVFEILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKESVWQYFVNKSANNLHIVLGMSPVGDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLG-YNPMIPAENIENVVKHVVLVHQSVDHYSQQFLQKLRRSNYVTPKNYLDFINTYSKLLDEKTQCNIAQCKRLDGGLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAMEKAEAETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKGYKELNWKTAKGVMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNRIWQNDILEREIPLSQPFRLESLLTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKR-----KEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFRDVDEYIDPVIDNVLEKNIKVSQGRQFIILGDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVDLVHTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFRLSLKKSLPDSILMKRLRNIMDTLTFSIYNHGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGNISLEKSKRKKPCAWLSDQGWEDIILLSEMFSDNFGQLPDDVENNQTVWQEWYDLDSLEQFPVPLGYDNNITPFQKLLILRCFRVDRVYRAVTDYVTVTMGEKYVQPPMISFEAIFEQSTPHSPIVFILSPGSDPATDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEMLDQCPHPAFKPLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFDTFQPFHFFRNKEVDYKIPVGDE-----KEKFVEAIEALPLANTPEVFGLHPNAEIGYYTQAARDMWAHLLELQPQTG----ESSSGISRDDYIGQVAKEIENKMPKVFDLDQVRKRL---GTGLSPTSVVLLQELERFNKLVVRMTKSLAELQRALAGEVGMSNELDDVARSLFIGHIPNIWRRLAPDTLKSLGNWMVYFLRRFSQYMLWVTESE---PSVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLFTQVTKFQDADEVNERAGQ--GCFVSGLYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLFTTRHISHWVLQGVCLTLNSD 3196          
BLAST of Dynein heavy chain vs. Ensembl Human
Match: DNAH2 (dynein axonemal heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:2948])

HSP 1 Score: 1064.29 bits (2751), Expect = 0.000e+0
Identity = 638/1863 (34.25%), Postives = 1015/1863 (54.48%), Query Frame = 1
Query:   82 KMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPK--HMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYN-ELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININH--VFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFI-DYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLI--KPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHP-KYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI-WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMG-IGLVTVLDLATTEHN-SHWILQGIALTLNSD 5634
            + LPTPTK HY  NLRD+SKVFQG+ ++  D     + + RLW HEC RVF+DR++   D E    I+ + + + F    H       P ++GD+  E     P++YEDL D  V+K+  +  +  YN       + LVLF +A+EH+  I R++    G+ LLVG+ GSG++SL+RLA+   D + F+I ++K Y ++EFR+D+K +Y +   E     F+F D  +A E FLE INN+L+ G VP L+  DE EE+  H+ D       PE+ + ++ Y        LHIVL +SP+G   RN  R +P +VN T I+WF  WP++AL  VA   +   +          V    VT+H SV   SQ   L+LRR NY+T T ++  +  Y  LL  K  +L  +  +L  GL K++ T  ++ +++ ++ + K  V E    CE  ++ I     EA  ++K     S +I  +          A++ L  A+PALE A R+L+ L+K D+ EI+++  PP  V+IV + + ++L+  E +W  A+  + + NFIK L   D + I  K +  +    A+     + +   S A      ++ ++  +  + R + PK+ R+     +  + +  L   QE++R++  +L+ LKKQ+D+   + E L K+   M+ +L  A  L  GLA EK RW   V G +++   L+GDCL+A+AFL+Y+GPF   YR  +V   W+  +  + +P S +F I N L +  ++  WN QGLP D  S +N I+ T+  R+ + IDPQ QA+KWIK ME       + +KI +L  S +LR LE++I FG P L ++  E++DP ++ +L+K++ +  GR  + +GD+EV++   FR Y+T+KLSNP +SP   ++  I+N+ V   GLE QLL  +V+ ER ELEE++++L++  +  KR LKELED++L  L   TG++LD+ +L+NTL  +K  A +V +QL  S     + +  R+ YRP A+R ++LFFVL ++  I+ MYQFSL +Y+ +F+ +I +S   + L  R++ +    T+ VY Y C  +FE+HK+L S  +  ++ E  G +  +E +FF++G + ++         ++WL D  W ++ +L   +  F  +++       +W  WY   +PE   +   ++   N  +++ ++R  R DR+   +T F+   +G  F+ PP+    +    STP  P+V I+SPG DP + +++LA  +     +   LS+GQGQ   A  L    V++G W+ L N HL + ++  ++K ++ L    PHP FRLWL++ P   FPI ILQ S K+  EPP G+K N+T  Y  +    F     P KY++ +F L F H++L ER++F ++GWNI Y F +SDF+VS  +L  YL +  E      PW+ +KYLI  + YGG   D +DRR+L TY+++YF D             +    Y+IP +    S     Y EYI  LP    P  FG H NA +       + L+  ++ LQPQ       AG    +EKVL E+   +  K+P + D    ++ L   + + SP  VVLLQE+ R+N L++ +  SL  L+K + G + MS  L++I   + +  +P  W    P + K L +W   L  R  Q+E W  A +   P I WLSG   P  +LTA++Q + R+NN ++D+ +   I++  +D    NL    + G +V G+Y+EG GWD KN C++  +  QL+  MP I   P ES K         P Y    R  +      V  +DL +      HWI +G AL ++ D
Sbjct: 2602 RFLPTPTKMHYLFNLRDISKVFQGMLRANKDFHDTKSSITRLWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPSKRPPIFGDFLKE-----PKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFVDTQIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVEQVPESSDSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAEKCLIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAVEEIKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAV-MILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNME-----GGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCSSWLADAYWDNITELD-KLTNFHGLMNSFEQYPRDWHLWYTNAAPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPGVDPTSALLQLAEHMGMA-QRFHALSLGQGQAPIAARLLREGVTQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSIPHPDFPISILQVSIKMTTEPPKGLKANMTRLYQLMSEPQFSRCSKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEE-----TPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLSTPFHRLSALET---YFIPKDGSLAS-----YKEYISLLPGMDPPEAFGQHPNADVASQITEAQTLFDTLLSLQPQITPT--RAGGQTREEKVL-ELAADVKQKIPEMIDYEGTQKLL---ALDPSPLNVVLLQEIQRYNTLMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKAYP-SQKPLAAWTRDLAMRVEQFELW--ASRARPPVIFWLSGFTFPTGFLTAVLQSSARQNNVSVDSLSWEFIVSTVDD---SNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSSDRASFVIGIDLRSGAMTPDHWIKRGTALLMSLD 4426          
BLAST of Dynein heavy chain vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 600.127 bits (1546), Expect = 4.326e-177
Identity = 473/1789 (26.44%), Postives = 880/1789 (49.19%), Query Frame = 1
Query:  109 HYTLNLRDLSKVFQGLCQS-TVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPK--HMPYVQINPILYGDYWTETLDDEPRLYEDLQDY--AVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYP-ENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSV----------------ACYAIDPKNPLIPSQ--YWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVL-QSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNF-KIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSS--LAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSL---QIALRLE------EDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCL-------LRCWRIDRIPIAITDFVTAVMGKEFVSPP--ITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSM-GQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTA----VPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECS------SLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKV-------LSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCW-RILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTL 5280
            HY  + R+L++  +G+ ++ T      A Q++RLW HE +R+F DR++T E++E    ++    +  F     +      P+LY  + +      P   E+LQDY  A +K F++E      ELD   + LVLFD  L+H+  I RI R   GH LL+G +G+GK +LSR  A+   LS F++ +   Y   +F ED++ +  +    N    F+  + ++   GFLE +N +L  G VP LF  DE   L+  + +   + G   ++ + ++++F    +  LH+V  M+P G  LR R    P + N   ++WF  W E AL+ V                    + P   L+PSQ  Y + V+  +  +H++V+  +++   K  R    T  +F+++IK ++SL   K  DLE ++  L +GL+K+  T  Q+  L   +  +   ++EK  +    + E+    ++A  +KK +E+   E+ +Q K + ++K   E  L+   PA+  A+ ++  + K+ + E+++ ++PP  V++  E +C++L ++    WK+ R +M   +F+  +   D E +  + +  ++  I      ++ V  AS A    +K+  + L +  +  ++ P +  +K LE+E  K  +E + +   + +LE  +   K+++     + E + +++  +Q ++  + +L   L SE++RW S  AGF Q+  +L+GD L++SAFL Y G +    R  +    W   + +  +    +  +I+ L T D  + +W    LP+D+L  +NAI+  +  R+P+ IDP  QAV++I K     +   K+I+ ++  D  F + LE++++FG   L +D + + DP+++ VL++ + ++ GR  + +GD+++D  P F++++ ++ S  +FSP + SR   +N+TVT S L  Q L+ ++++ER ++++KR +L+    E    L+ LE  LL  L    G ILD+  +I TLE  K +A +VA++ +++  V A+++     Y+  +   + ++  L  L+ I+ +Y +SL   + +F   ++     S+   AKRL  I T+L   V+     G+    K+LL+L   +I +R        E   ++     DF  K N   +   P  L ++L   + K + + +  +  F ++   + +N     +W    +PES     + + +     LC+       +   R DR+  +    V+      F+     +          +P  P+++  + G D   +I  LA   + ++  I   S  G  Q  +AL    TA   G+W++L+N HL   ++A +EK+L  + KPH  FRL+LT E     P  IL+ S  +V EP +G+K NL  + + IP +    +P  + R  +  + +LHA++QER R+  +GW+ +Y+F+++D +V+   L   +    + +       +PW T++ L+ + +YGG+  + FD+ +L   ++                +E DH+   IP    + S      S K+    +++ L  EQ P   GL  NA     T   + + +NM+++   T++E+  A     KE+V       L E+    L  LP   +I K++R +    N   P      +E++  + LLK +   LN +      E   + E   ++ SL  G +P  W R   P  + ++  W+  L +R  Q      A  +   + WL G   P++Y+TA  Q+  + N W+L+   L
Sbjct: 2733 HYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALKRPLLYSCWLSRNY--VPVTREELQDYVSARLKGFYEE------ELD---VKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHK-WFNHVVNAGLHFRHDLARIEYLSTVDDRL-QWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMK-----QFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVEAY-DPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAK-NDEADSTIPGGL-DFLTVENKKSIAK-ARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALG---TATKSGRWVLLKNVHLAPSWLAQLEKRLHSM-KPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERSRLYLL-VCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENL---------FTAKSFEQDHV--LIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKV---TDEEL--AFNEDGKEEVKPQWMAQLGELAKQWLQLLP--KEIVKMRRTV---ENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVM-DWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNL 4472          
BLAST of Dynein heavy chain vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 600.127 bits (1546), Expect = 4.326e-177
Identity = 473/1789 (26.44%), Postives = 880/1789 (49.19%), Query Frame = 1
Query:  109 HYTLNLRDLSKVFQGLCQS-TVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPK--HMPYVQINPILYGDYWTETLDDEPRLYEDLQDY--AVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYP-ENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSV----------------ACYAIDPKNPLIPSQ--YWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVL-QSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNF-KIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSS--LAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSL---QIALRLE------EDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCL-------LRCWRIDRIPIAITDFVTAVMGKEFVSPP--ITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSM-GQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTA----VPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECS------SLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKV-------LSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCW-RILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTL 5280
            HY  + R+L++  +G+ ++ T      A Q++RLW HE +R+F DR++T E++E    ++    +  F     +      P+LY  + +      P   E+LQDY  A +K F++E      ELD   + LVLFD  L+H+  I RI R   GH LL+G +G+GK +LSR  A+   LS F++ +   Y   +F ED++ +  +    N    F+  + ++   GFLE +N +L  G VP LF  DE   L+  + +   + G   ++ + ++++F    +  LH+V  M+P G  LR R    P + N   ++WF  W E AL+ V                    + P   L+PSQ  Y + V+  +  +H++V+  +++   K  R    T  +F+++IK ++SL   K  DLE ++  L +GL+K+  T  Q+  L   +  +   ++EK  +    + E+    ++A  +KK +E+   E+ +Q K + ++K   E  L+   PA+  A+ ++  + K+ + E+++ ++PP  V++  E +C++L ++    WK+ R +M   +F+  +   D E +  + +  ++  I      ++ V  AS A    +K+  + L +  +  ++ P +  +K LE+E  K  +E + +   + +LE  +   K+++     + E + +++  +Q ++  + +L   L SE++RW S  AGF Q+  +L+GD L++SAFL Y G +    R  +    W   + +  +    +  +I+ L T D  + +W    LP+D+L  +NAI+  +  R+P+ IDP  QAV++I K     +   K+I+ ++  D  F + LE++++FG   L +D + + DP+++ VL++ + ++ GR  + +GD+++D  P F++++ ++ S  +FSP + SR   +N+TVT S L  Q L+ ++++ER ++++KR +L+    E    L+ LE  LL  L    G ILD+  +I TLE  K +A +VA++ +++  V A+++     Y+  +   + ++  L  L+ I+ +Y +SL   + +F   ++     S+   AKRL  I T+L   V+     G+    K+LL+L   +I +R        E   ++     DF  K N   +   P  L ++L   + K + + +  +  F ++   + +N     +W    +PES     + + +     LC+       +   R DR+  +    V+      F+     +          +P  P+++  + G D   +I  LA   + ++  I   S  G  Q  +AL    TA   G+W++L+N HL   ++A +EK+L  + KPH  FRL+LT E     P  IL+ S  +V EP +G+K NL  + + IP +    +P  + R  +  + +LHA++QER R+  +GW+ +Y+F+++D +V+   L   +    + +       +PW T++ L+ + +YGG+  + FD+ +L   ++                +E DH+   IP    + S      S K+    +++ L  EQ P   GL  NA     T   + + +NM+++   T++E+  A     KE+V       L E+    L  LP   +I K++R +    N   P      +E++  + LLK +   LN +      E   + E   ++ SL  G +P  W R   P  + ++  W+  L +R  Q      A  +   + WL G   P++Y+TA  Q+  + N W+L+   L
Sbjct: 2733 HYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALKRPLLYSCWLSRNY--VPVTREELQDYVSARLKGFYEE------ELD---VKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHK-WFNHVVNAGLHFRHDLARIEYLSTVDDRL-QWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMK-----QFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVEAY-DPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAK-NDEADSTIPGGL-DFLTVENKKSIAK-ARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALG---TATKSGRWVLLKNVHLAPSWLAQLEKRLHSM-KPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERSRLYLL-VCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENL---------FTAKSFEQDHV--LIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKV---TDEEL--AFNEDGKEEVKPQWMAQLGELAKQWLQLLP--KEIVKMRRTV---ENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVM-DWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNL 4472          
BLAST of Dynein heavy chain vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 599.356 bits (1544), Expect = 5.802e-177
Identity = 473/1789 (26.44%), Postives = 880/1789 (49.19%), Query Frame = 1
Query:  109 HYTLNLRDLSKVFQGLCQS-TVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPK--HMPYVQINPILYGDYWTETLDDEPRLYEDLQDY--AVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYP-ENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSV----------------ACYAIDPKNPLIPSQ--YWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVL-QSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNF-KIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSS--LAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSL---QIALRLE------EDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCL-------LRCWRIDRIPIAITDFVTAVMGKEFVSPP--ITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSM-GQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTA----VPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECS------SLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKV-------LSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCW-RILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTL 5280
            HY  + R+L++  +G+ ++ T      A Q++RLW HE +R+F DR++T E++E    ++    +  F     +      P+LY  + +      P   E+LQDY  A +K F++E      ELD   + LVLFD  L+H+  I RI R   GH LL+G +G+GK +LSR  A+   LS F++ +   Y   +F ED++ +  +    N    F+  + ++   GFLE +N +L  G VP LF  DE   L+  + +   + G   ++ + ++++F    +  LH+V  M+P G  LR R    P + N   ++WF  W E AL+ V                    + P   L+PSQ  Y + V+  +  +H++V+  +++   K  R    T  +F+++IK ++SL   K  DLE ++  L +GL+K+  T  Q+  L   +  +   ++EK  +    + E+    ++A  +KK +E+   E+ +Q K + ++K   E  L+   PA+  A+ ++  + K+ + E+++ ++PP  V++  E +C++L ++    WK+ R +M   +F+  +   D E +  + +  ++  I      ++ V  AS A    +K+  + L +  +  ++ P +  +K LE+E  K  +E + +   + +LE  +   K+++     + E + +++  +Q ++  + +L   L SE++RW S  AGF Q+  +L+GD L++SAFL Y G +    R  +    W   + +  +    +  +I+ L T D  + +W    LP+D+L  +NAI+  +  R+P+ IDP  QAV++I K     +   K+I+ ++  D  F + LE++++FG   L +D + + DP+++ VL++ + ++ GR  + +GD+++D  P F++++ ++ S  +FSP + SR   +N+TVT S L  Q L+ ++++ER ++++KR +L+    E    L+ LE  LL  L    G ILD+  +I TLE  K +A +VA++ +++  V A+++     Y+  +   + ++  L  L+ I+ +Y +SL   + +F   ++     S+   AKRL  I T+L   V+     G+    K+LL+L   +I +R        E   ++     DF  K N   +   P  L ++L   + K + + +  +  F ++   + +N     +W    +PES     + + +     LC+       +   R DR+  +    V+      F+     +          +P  P+++  + G D   +I  LA   + ++  I   S  G  Q  +AL    TA   G+W++L+N HL   ++A +EK+L  + KPH  FRL+LT E     P  IL+ S  +V EP +G+K NL  + + IP +    +P  + R  +  + +LHA++QER R+  +GW+ +Y+F+++D +V+   L   +    + +       +PW T++ L+ + +YGG+  + FD+ +L   ++                +E DH+   IP    + S      S K+    +++ L  EQ P   GL  NA     T   + + +NM+++   T++E+  A     KE+V       L E+    L  LP   +I K++R +    N   P      +E++  + LLK +   LN +      E   + E   ++ SL  G +P  W R   P  + ++  W+  L +R  Q      A  +   + WL G   P++Y+TA  Q+  + N W+L+   L
Sbjct: 1801 HYVYSPRELTRWVRGISEAITPLESLSAEQLVRLWAHEAIRLFQDRLVTEEEREWTDKLVDTTAERYFGNACRLDEALKRPLLYSCWLSRNY--VPVTREELQDYVSARLKGFYEE------ELD---VKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGAQRQGLILDSHDELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGENVGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQMEKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHK-WFNHVVNAGLHFRHDLARIEYLSTVDDRL-QWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMK-----QFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDVEAY-DPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLLMRIHIRSNPSAPAYEQHFDLLLGRSDFVAK-NDEADSTIPGGL-DFLTVENKKSIAK-ARKVVGFENVFAHLQHNSAAVTSWLTNDNPESNVPVVWDDADGKLSPLCIAMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKIEDLAVETNRQLTSIAIGSAEGFNQADSALG---TATKSGRWVLLKNVHLAPSWLAQLEKRLHSM-KPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIPPQRLTKAPTERSRLYLL-VCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENL---------FTAKSFEQDHV--LIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKV---TDEEL--AFNEDGKEEVKPQWMAQLGELAKQWLQLLP--KEIVKMRRTV---ENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVM-DWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNL 3540          
BLAST of Dynein heavy chain vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 394.045 bits (1011), Expect = 2.260e-110
Identity = 432/1808 (23.89%), Postives = 796/1808 (44.03%), Query Frame = 1
Query:  217 ECLRVFNDRMITNEDKEIVQTILLNIM----KNE--FPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNEL--DQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARL-HIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYED--VRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSD---ILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEE------CSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGR---IGSKEKVLSE------MVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRIL---APETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWD--VKNGCIIPQKSRQLLQSMPIIQLH-PIESHKYKTTNTIQVPVYVTSQRRN 5535
            E  R+F DR+ T  DK   + IL N++     NE    K   YV    ++ G+  T      P    ++ D      F Q   +S N    +    +  L          I R+L   GGH  L G  G G+R   RL A   ++  F   ++  +  ++F  +LK    +  T N   + +  D  + +  FL+ IN++L  G VP LFT  E + L+  V +   ++ +     G  Q F    I  L H+VL +       +      P I+ + N+ +   +   +L  +    ++ +                +T   ++        + L     I    +  +++ +  LL  K   L  + +RL  G+ KL     ++  +  K  ++  ++ EK    +  +  I  S   A  +K   E+      +++  I ++K + +E L    P ++ A+R++  +    ++EIR+   PP+ V+ + + + L +   + SW++ R  ++ +    ++   D   I  +    V   + ++  ++E+   + AS A A    ++ + L +  +  +I P +     L +   KA K++E L + ++ ++  +  LK++F+    E  ++  ++   Q  +  A  L + L+ E  RW   +  F +E+  +    LI SAF+ YLG  + + R +L+++      +  N+P +  FK  +  + + E   W ++GLP D+LS++N  +   S   P+ ID   Q   ++ K      ++S++ K +  +    +  +E +I+FG   + +D  E  D  +  +L K++     R+ +  G + +D+ P F++Y  ++       P+ Y + NI+N+T T+S L  QLL   +  E+ ELEE+  +L+ +    K  L+ LE  LL +LA+  GN+L+N  L+++L  +K  A  + K + +S  +  ++  Q+D Y P +   + LFF  +NL   N MY +S+ + + +F K I+     SS   R+  +   +   V+ +   GIF + +++ +  +A             E + F    ++ +         W+  +  + L ++   +P   +   I D  T     W  + K    E+ F    +     F+K+  ++  + +R+   + DFV   +    ++PP       F  S    PI+ I++ G+DP  E+ + A+S++   H I   SMGQGQE  A      + S+G+WL L N HL+++ +  I K L  L  PH +FRLWLTTE  + FP  +LQ+S KI  EPP G++ NL  TY +I       + +    Q IF LA+LHA+LQERR F   GW   Y+F  SD +V+   ++       +       W  ++ ++  V+YGGR  + FD ++L +Y++                + D+ I      +  +       ++++E      KS+P    P +FGL EN  I YS       WQ ++E      D    + R   +G  +  LS+       ++ +  KL    D+   KR L  +     P + VL  E      L+K++  S+  + K++      S  +    +SL     P+ W  +     +    L   ++        +E+  ++  +  P I  S L  P  +L AL Q   R+    LD   L++  T  +        + ++    V G+ ++G  +D  ++   +    S       PI+ L    ES    T   IQVPVY +S+R +
Sbjct: 2450 EARRIFADRLPTENDKLKFEEILRNVIPISQANETVIFKEKVYVTTGTVVPGESNTGL----PLTPINMSD------FNQLLAKSINRFAFEIANFNCPLTSQLAFFCACIDRVLTGPGGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPVTANFSAKQFDNELKNAITQAVTNNEHVVLILEDHQLRKNIFLQAINSLLASGNVPGLFTQQELDGLVALVSEAANQASFT----GALQQFLAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNVIFADRFDRNSLVEIPKIQMESQG---------------ITTTDAILTGFNDVLVNLPEHLSIQPIKYRQFVENFFQLLGYKRLTLSVRLERLKGGVSKLNEARDEVAKMQKKAGKKSKLLAEKQAEADEALKAITESMSGAEDQKLSMEQLKAATEKENVRIEEQKAKIDEQLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVLLFMGILDTSWEAMRKFLSKSGVKDDIMNFDANRITNEIHKKVTALVKQKSNSFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGEKNKLVKNLKKAEKQMENLSKGLQSVDEVVGELKRKFEVLMKEATQIKVDLDREQDTIRIAGTLVESLSGEFERWKIQIETFGEEQSKMELCSLITSAFITYLGGCSEKDRKSLLKSM----CKMFNMPPT--FKPLSFASLETEQLNWKTKGLPADQLSLENGSILFTSCHAPLIIDRSGQVSLFLSKF----LEKSETFKAAQPD---LMTQIELAIRFGKTIIIDDIVE-FDSALIPILRKDLSSQGPRQVISFGGKSIDFNPDFKIYFCTRDEKVDIRPNSYVQLNIVNFTTTISALSAQLLDVAIHLEKPELEERSSSLLRDAELKKLELEGLEQLLLQQLASSQGNLLENTALLDSLNKSKESAEIITKSIVESEQLHKELTTQKDIYVPLSLFTSSLFFSFSNLQFHNPMYNYSVNTIMHLFGKTIKSCEDKSS--TRVETLARQMQLTVFYHISRGIFRQDRLMFA--VAFINATMPKMFQPKEWELFTGVLVDESTDLSALRVQWISPDRLQSLARIRTHLPSLFNNFQIQDDAT-----WNEFSKTLQCENAFPKNVELKMTHFQKVLFIQAVKPERLYNCLMDFVLKTLNIPSINPPAFELKHIFQESESTEPILFILADGADPSQELSEFASSMNVPYHSI---SMGQGQEIAAYEAIRESASKGEWLCLNNLHLMLQAVPSIFKHL-SLTTPHENFRLWLTTEGDARFPSMMLQQSLKITFEPPPGVRNNLLRTYTQIDR----STKNVITCQSIFVLAWLHALLQERRTFIPQGWTKFYEFGASDVRVAKSFVEQLTANKAD-------WEFVRGILKFVIYGGRIENDFDFKVLDSYLN--------------VLFCDEKINGRAGSQLVKGIDLLATTNVQEYIGHISKSVPSVDEPYLFGLPEN--IKYS-------WQ-IVE-----ADRTISSIRTLALGDTKNALSDQSDKISQIVSLWKKLCQSDDLP--KRELPTAIRSADPISEVLCLETINALSLIKQLHRSIGHVAKSMKTPSLASPAVQKTIQSLVFQQTPDEWDSMWAGPSDPADYLNVVVKKTRGTLQLFESSKSSSLLSSP-IDFSDLFYPNIFLNALRQTTSRQIKIPLDQLILSSAWTPSQ--------LPAKQCVQVQGLLLQGATFDSFLRETTV----SSAAYSQAPIVFLAWTSESSSTITGEQIQVPVYSSSERSD 4146          
BLAST of Dynein heavy chain vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 98.5969 bits (244), Expect = 5.276e-20
Identity = 68/311 (21.86%), Postives = 160/311 (51.45%), Query Frame = 1
Query: 1312 GLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEI---NISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVL---------QSGEIS---WKSARGLMADANFIKELQTLDVEAIPLKNINAVKDT-IAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQE 2196
            G++K++    Q+  +  ++   +  +   +I    LM  I    I  E A       E K+ E   +++ +   K E+E  L+ A+PALE+A  +L+ + ++DV+ ++    PP  V++  E +C++L         + GE+    W S + L++D +F+ ++++   + +  K +  +++  ++K +   E+V+  S A  G  ++++++  +  +++ + PK+ER++  E    +  K+LE  ++ + K+  +L+ L  QF     + + L  +++  + ++  AE+L + L+ EK++W + +     E
Sbjct: 2128 GMEKMKRAEEQVAGMQGELLRLQPQLVRTSIETSMLMSTIEKETIDVENAREVVAANENKANEAATKAQSL---KAESEAELASAIPALESAVEALETMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVKPAKITNEIGEVVNDYWVSGQKLLSDIHFLAKIRSFARDTVSKKTVKLIREKYLSKEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAEVLVKQHLKQLEVKRKALLKVTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKWKNKITYITHE 2435          
BLAST of Dynein heavy chain vs. Ensembl Fly
Match: Dhc98D (gene:FBgn0013813 transcript:FBtr0301303)

HSP 1 Score: 1633.62 bits (4229), Expect = 0.000e+0
Identity = 881/1913 (46.05%), Postives = 1245/1913 (65.08%), Query Frame = 1
Query:   61 ILREIKLKMLPTPTKFHYTLNLRDLSKV-----------FQGL-----------CQSTVDRFTKANQMLRLWRHECLRV-------------FND----------RMITNEDKEIVQTILLNIMKNEFPKHMP--------YVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPK-FSDILDQVTNNEDEWRNWYKLQSPES-EFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            + + + + + PTP+KFHY  NL+DLS++           F+GL            +   DR    N +  + R+  + V             F D          R++    K  +        + E  +  P        YV  +P+L+GD+   T + EPRLYEDL DY  +   F E +E Y E  Q ++ LVLF+D LEHL  +HR LRM+ GH LL+GV GSGK+ ++RLAAFAA+   FEI++S+GY E  FREDLKV+Y     +    +FLF    VA+EGFLELINN+LT+G VP LF D++K+ ++  V     + G   +K+ +W YF   C   LH+VL MSP G  LRNRCRNFPG++ +T IDW +PWP QAL++VA   +  ++ LIP+ + E ++ HVV +H S++  S+ +  KLRR+N++T  ++++YI TY  LLE K   +  +R RL  G+ K+E  + QI  L   V EQK  V   +  CE +++ I  ST++A +KK    EKSVE+  + K I  EK EAEE L+ AMPALE A+ +L +L+K  +TEIR+FATPP  VQ+V E + ++    EI+WKSA+G+M+D NF+K L  +D EA+  K I   +  +    L  ED+   S AGAG L+F+ +VLGF+DV +E++PKKER+  L  E     K L  L  E++KLE +L  L + +  +  +M  L + M   +R+L+A++KL  GL SE  RW  ++A   Q+ ++ +G CLI+++FL Y G FT+E+R  +V + WL  + S+ IP    FKI   LT+DVEIS+W+++GLP DELSIQN ILT +++RFP+CIDPQ QA++WI+K E        ++K+ + +DS FL+ LE +I +G P LFED D+++DPVID++L KNI    GR++VMLGD+EVDW+P FR+YLT+K SNPKF P++Y++A +INYTVT +GLE QLLS +V  ER +LE +RE+LI +TSENK++L++LED LL EL+T TGN+LDN ELI TLE+TK KA  V +QL  +   +ADIE  R+GYRPAAKRGAVLFF L++++ +N+MYQ++L +YL VF+ ++R+++PD+SL KRLNNII TLT +VYCYGCTGIFE+HK+L S QIA +L +  G +  +E+DFFIKG+I +      N   WL + SW+D+ +L+   P  F  + D       EW+ W+ L++PE       Y    N+F+KL  LRC+R+DRI  +I  ++   M + ++ PP+ +F A +  ++  +P+  ++S GSDP  +++KLA++I   +    ++S+GQGQEK AL L D A+ +G WLMLQN HLLI+F+  +EK LD +  PHPDFRLW+TT+P  TFPIGILQKS K+V EPP+G+K NL  TY K+  E      H  +R  ++ LAF HA++QERR++ K+GWNI+YDF ++DF V  +IL+TYLT+    K   +PWN++KYLIGEVMYGGR ID FDRRI   YM+EY GDFLFD+F++FHFYEDD+++Y +   PEE + LKE Y  +I  LP    P VFGLH NA IGY T   + +W ++IELQPQT +     G I S++  +  +  GIL KLP  ++  +I++ +  S   +SPT VVLLQELDRFN+L+ ++  +L  L+KA+ GE+GM   LD+I+ SL NG++P  W  LAP T K L SWLEHL  R +QY+ W  +G+  +  +WLSGLH+PQSYLTALVQ ACRRN W LD  TL T +T   D   +++      GC V G+YIEG  +D+    +     + L++ + I+ + PIE+H+ K  NT   PVY TS RRNAMG+GLV   +LAT+E  SHWILQG+ LTLN+D
Sbjct: 3187 LFKMVIVDLPPTPSKFHYIFNLKDLSRIFAGMLLIEPTCFKGLRDLIRVWRNEYTRIICDRLITDNDIANVRRNLAVEVAERFPPTFEEEHGFIDAAAAEAEAQARLLYEPSKADIDGGEEEGEEEEEGEEAPQVILSLKDYVLRDPLLFGDFRNFTNESEPRLYEDLLDYNSVYFLFTEILEEYCERKQ-KMTLVLFEDCLEHLTRVHRTLRMNRGHVLLIGVGGSGKKCITRLAAFAAECDVFEITISRGYNEAAFREDLKVLYTIAGVKRKKVVFLFTGAQVAEEGFLELINNILTVGQVPALFPDEDKDGIVNQVRKFAEEDGVSASKDAVWGYFLRTCAENLHVVLCMSPAGDALRNRCRNFPGLIGSTYIDWVFPWPRQALYAVAKLFL-TEHRLIPASHREAIVEHVVHVHTSIQQYSKDYLAKLRRNNFVTPKHYLDYINTYRGLLEEKAKFITQQRSRLGEGIKKIEEASVQIDELRIIVTEQKKNVAVASEECEAMLVTIESSTQKANVKKAEASEKSVEVEIKGKQIAIEKDEAEEILAEAMPALEEARLALSQLEKAQITEIRSFATPPAAVQVVCECVAILKGYKEINWKSAKGMMSDVNFLKSLMEMDCEALTQKQITQCRQHMKTGNL--EDMAKISVAGAGLLRFVRAVLGFFDVYKEVKPKKERLDFLVEEQEVQIKLLNHLNGEIQKLEEKLNELNENYATSMKQMRALTEMMQQAERRLIASDKLISGLTSELIRWSKEMASLGQQLIDSVGGCLISASFLAYTGAFTWEFRKAMVFDDWLEDIASLGIPIQLPFKIDGYLTTDVEISQWSNEGLPPDELSIQNGILTMRASRFPLCIDPQLQALQWIRKREFK-----NNLKVLSFSDSDFLKQLEMAIMYGTPVLFEDVDDYIDPVIDDILQKNIRIQGGRKFVMLGDKEVDWDPSFRVYLTTKFSNPKFDPAVYAKALVINYTVTQTGLEDQLLSVVVGTERPDLEAQRESLIAQTSENKQLLQQLEDSLLRELSTSTGNMLDNVELIETLENTKTKAGVVMEQLKLAADTAADIEVLRNGYRPAAKRGAVLFFALSDMATVNSMYQYALAAYLDVFVYSLRKAVPDASLNKRLNNIIKTLTENVYCYGCTGIFERHKLLFSFQIATKLAQRDGILLQSELDFFIKGSIALTKSERSNPCKWLSEKSWEDVLKLAFDFPDIFGTLPDHFGRYLTEWKEWFDLENPEEVPCPGDYNIKCNAFQKLMFLRCFRVDRIFRSINQYIVETMDEFYIMPPVVSFSAIYEQTSSTIPVCFVLSAGSDPTNDLIKLADTI-VGMSNFCHISLGQGQEKAALRLLDGAIKQGMWLMLQNGHLLIRFVRELEKHLDRIENPHPDFRLWITTDPTPTFPIGILQKSLKVVTEPPNGLKLNLRSTYFKVRQERLESCSHVAFRPLVYVLAFFHAVVQERRKYDKLGWNIAYDFNDTDFDVCTEILRTYLTRCGTGK---IPWNSLKYLIGEVMYGGRVIDDFDRRITNCYMNEYMGDFLFDEFKVFHFYEDDNVDYCL---PEEETILKEDYIAHIDKLPLVNKPDVFGLHPNAEIGYYTMAARNIWNSLIELQPQTGE---GTGGI-SRDDFIDSVAAGILKKLPPAFETWRIRKQIQMS---LSPTGVVLLQELDRFNLLVVRIKKTLELLRKAIAGEIGMDNVLDNIANSLFNGLLPAAWSKLAPATCKQLASWLEHLRLRAVQYKYWTLSGEPLV--MWLSGLHIPQSYLTALVQIACRRNAWPLDRSTLFTYVTKFAD--PDDVEERPVTGCLVHGLYIEGGRFDLATNQLARSHPKVLVEELAILAVEPIEAHRLKLQNTYLAPVYTTSLRRNAMGVGLVFEANLATSEDLSHWILQGVCLTLNTD 5072          
BLAST of Dynein heavy chain vs. Ensembl Fly
Match: Dhc98D (gene:FBgn0013813 transcript:FBtr0301302)

HSP 1 Score: 1633.23 bits (4228), Expect = 0.000e+0
Identity = 881/1913 (46.05%), Postives = 1245/1913 (65.08%), Query Frame = 1
Query:   61 ILREIKLKMLPTPTKFHYTLNLRDLSKV-----------FQGL-----------CQSTVDRFTKANQMLRLWRHECLRV-------------FND----------RMITNEDKEIVQTILLNIMKNEFPKHMP--------YVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPK-FSDILDQVTNNEDEWRNWYKLQSPES-EFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            + + + + + PTP+KFHY  NL+DLS++           F+GL            +   DR    N +  + R+  + V             F D          R++    K  +        + E  +  P        YV  +P+L+GD+   T + EPRLYEDL DY  +   F E +E Y E  Q ++ LVLF+D LEHL  +HR LRM+ GH LL+GV GSGK+ ++RLAAFAA+   FEI++S+GY E  FREDLKV+Y     +    +FLF    VA+EGFLELINN+LT+G VP LF D++K+ ++  V     + G   +K+ +W YF   C   LH+VL MSP G  LRNRCRNFPG++ +T IDW +PWP QAL++VA   +  ++ LIP+ + E ++ HVV +H S++  S+ +  KLRR+N++T  ++++YI TY  LLE K   +  +R RL  G+ K+E  + QI  L   V EQK  V   +  CE +++ I  ST++A +KK    EKSVE+  + K I  EK EAEE L+ AMPALE A+ +L +L+K  +TEIR+FATPP  VQ+V E + ++    EI+WKSA+G+M+D NF+K L  +D EA+  K I   +  +    L  ED+   S AGAG L+F+ +VLGF+DV +E++PKKER+  L  E     K L  L  E++KLE +L  L + +  +  +M  L + M   +R+L+A++KL  GL SE  RW  ++A   Q+ ++ +G CLI+++FL Y G FT+E+R  +V + WL  + S+ IP    FKI   LT+DVEIS+W+++GLP DELSIQN ILT +++RFP+CIDPQ QA++WI+K E        ++K+ + +DS FL+ LE +I +G P LFED D+++DPVID++L KNI    GR++VMLGD+EVDW+P FR+YLT+K SNPKF P++Y++A +INYTVT +GLE QLLS +V  ER +LE +RE+LI +TSENK++L++LED LL EL+T TGN+LDN ELI TLE+TK KA  V +QL  +   +ADIE  R+GYRPAAKRGAVLFF L++++ +N+MYQ++L +YL VF+ ++R+++PD+SL KRLNNII TLT +VYCYGCTGIFE+HK+L S QIA +L +  G +  +E+DFFIKG+I +      N   WL + SW+D+ +L+   P  F  + D       EW+ W+ L++PE       Y    N+F+KL  LRC+R+DRI  +I  ++   M + ++ PP+ +F A +  ++  +P+  ++S GSDP  +++KLA++I   +    ++S+GQGQEK AL L D A+ +G WLMLQN HLLI+F+  +EK LD +  PHPDFRLW+TT+P  TFPIGILQKS K+V EPP+G+K NL  TY K+  E      H  +R  ++ LAF HA++QERR++ K+GWNI+YDF ++DF V  +IL+TYLT+    K   +PWN++KYLIGEVMYGGR ID FDRRI   YM+EY GDFLFD+F++FHFYEDD+++Y +   PEE + LKE Y  +I  LP    P VFGLH NA IGY T   + +W ++IELQPQT +     G I S++  +  +  GIL KLP  ++  +I++ +  S   +SPT VVLLQELDRFN+L+ ++  +L  L+KA+ GE+GM   LD+I+ SL NG++P  W  LAP T K L SWLEHL  R +QY+ W  +G+  +  +WLSGLH+PQSYLTALVQ ACRRN W LD  TL T +T   D   +++      GC V G+YIEG  +D+    +     + L++ + I+ + PIE+H+ K  NT   PVY TS RRNAMG+GLV   +LAT+E  SHWILQG+ LTLN+D
Sbjct: 3194 LFKMVIVDLPPTPSKFHYIFNLKDLSRIFAGMLLIEPTCFKGLRDLIRVWRNEYTRIICDRLITDNDIANVRRNLAVEVAERFPPTFEEEHGFIDAAAAEAEAQARLLYEPSKADIDGGEEEGEEEEEGEEAPQVILSLKDYVLRDPLLFGDFRNFTNESEPRLYEDLLDYNSVYFLFTEILEEYCERKQ-KMTLVLFEDCLEHLTRVHRTLRMNRGHVLLIGVGGSGKKCITRLAAFAAECDVFEITISRGYNEAAFREDLKVLYTIAGVKRKKVVFLFTGAQVAEEGFLELINNILTVGQVPALFPDEDKDGIVNQVRKFAEEDGVSASKDAVWGYFLRTCAENLHVVLCMSPAGDALRNRCRNFPGLIGSTYIDWVFPWPRQALYAVAKLFL-TEHRLIPASHREAIVEHVVHVHTSIQQYSKDYLAKLRRNNFVTPKHYLDYINTYRGLLEEKAKFITQQRSRLGEGIKKIEEASVQIDELRIIVTEQKKNVAVASEECEAMLVTIESSTQKANVKKAEASEKSVEVEIKGKQIAIEKDEAEEILAEAMPALEEARLALSQLEKAQITEIRSFATPPAAVQVVCECVAILKGYKEINWKSAKGMMSDVNFLKSLMEMDCEALTQKQITQCRQHMKTGNL--EDMAKISVAGAGLLRFVRAVLGFFDVYKEVKPKKERLDFLVEEQEVQIKLLNHLNGEIQKLEEKLNELNENYATSMKQMRALTEMMQQAERRLIASDKLISGLTSELIRWSKEMASLGQQLIDSVGGCLISASFLAYTGAFTWEFRKAMVFDDWLEDIASLGIPIQLPFKIDGYLTTDVEISQWSNEGLPPDELSIQNGILTMRASRFPLCIDPQLQALQWIRKREFK-----NNLKVLSFSDSDFLKQLEMAIMYGTPVLFEDVDDYIDPVIDDILQKNIRIQGGRKFVMLGDKEVDWDPSFRVYLTTKFSNPKFDPAVYAKALVINYTVTQTGLEDQLLSVVVGTERPDLEAQRESLIAQTSENKQLLQQLEDSLLRELSTSTGNMLDNVELIETLENTKTKAGVVMEQLKLAADTAADIEVLRNGYRPAAKRGAVLFFALSDMATVNSMYQYALAAYLDVFVYSLRKAVPDASLNKRLNNIIKTLTENVYCYGCTGIFERHKLLFSFQIATKLAQRDGILLQSELDFFIKGSIALTKSERSNPCKWLSEKSWEDVLKLAFDFPDIFGTLPDHFGRYLTEWKEWFDLENPEEVPCPGDYNIKCNAFQKLMFLRCFRVDRIFRSINQYIVETMDEFYIMPPVVSFSAIYEQTSSTIPVCFVLSAGSDPTNDLIKLADTI-VGMSNFCHISLGQGQEKAALRLLDGAIKQGMWLMLQNGHLLIRFVRELEKHLDRIENPHPDFRLWITTDPTPTFPIGILQKSLKVVTEPPNGLKLNLRSTYFKVRQERLESCSHVAFRPLVYVLAFFHAVVQERRKYDKLGWNIAYDFNDTDFDVCTEILRTYLTRCGTGK---IPWNSLKYLIGEVMYGGRVIDDFDRRITNCYMNEYMGDFLFDEFKVFHFYEDDNVDYCL---PEEETILKEDYIAHIDKLPLVNKPDVFGLHPNAEIGYYTMAARNIWNSLIELQPQTGE---GTGGI-SRDDFIDSVAAGILKKLPPAFETWRIRKQIQMS---LSPTGVVLLQELDRFNLLVVRIKKTLELLRKAIAGEIGMDNVLDNIANSLFNGLLPAAWSKLAPATCKQLASWLEHLRLRAVQYKYWTLSGEPLV--MWLSGLHIPQSYLTALVQIACRRNAWPLDRSTLFTYVTKFAD--PDDVEERPVTGCLVHGLYIEGGRFDLATNQLARSHPKVLVEELAILAVEPIEAHRLKLQNTYLAPVYTTSLRRNAMGVGLVFEANLATSEDLSHWILQGVCLTLNTD 5079          
BLAST of Dynein heavy chain vs. Ensembl Fly
Match: Dhc98D (gene:FBgn0013813 transcript:FBtr0337034)

HSP 1 Score: 1632.08 bits (4225), Expect = 0.000e+0
Identity = 881/1913 (46.05%), Postives = 1245/1913 (65.08%), Query Frame = 1
Query:   61 ILREIKLKMLPTPTKFHYTLNLRDLSKV-----------FQGL-----------CQSTVDRFTKANQMLRLWRHECLRV-------------FND----------RMITNEDKEIVQTILLNIMKNEFPKHMP--------YVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPK-FSDILDQVTNNEDEWRNWYKLQSPES-EFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            + + + + + PTP+KFHY  NL+DLS++           F+GL            +   DR    N +  + R+  + V             F D          R++    K  +        + E  +  P        YV  +P+L+GD+   T + EPRLYEDL DY  +   F E +E Y E  Q ++ LVLF+D LEHL  +HR LRM+ GH LL+GV GSGK+ ++RLAAFAA+   FEI++S+GY E  FREDLKV+Y     +    +FLF    VA+EGFLELINN+LT+G VP LF D++K+ ++  V     + G   +K+ +W YF   C   LH+VL MSP G  LRNRCRNFPG++ +T IDW +PWP QAL++VA   +  ++ LIP+ + E ++ HVV +H S++  S+ +  KLRR+N++T  ++++YI TY  LLE K   +  +R RL  G+ K+E  + QI  L   V EQK  V   +  CE +++ I  ST++A +KK    EKSVE+  + K I  EK EAEE L+ AMPALE A+ +L +L+K  +TEIR+FATPP  VQ+V E + ++    EI+WKSA+G+M+D NF+K L  +D EA+  K I   +  +    L  ED+   S AGAG L+F+ +VLGF+DV +E++PKKER+  L  E     K L  L  E++KLE +L  L + +  +  +M  L + M   +R+L+A++KL  GL SE  RW  ++A   Q+ ++ +G CLI+++FL Y G FT+E+R  +V + WL  + S+ IP    FKI   LT+DVEIS+W+++GLP DELSIQN ILT +++RFP+CIDPQ QA++WI+K E        ++K+ + +DS FL+ LE +I +G P LFED D+++DPVID++L KNI    GR++VMLGD+EVDW+P FR+YLT+K SNPKF P++Y++A +INYTVT +GLE QLLS +V  ER +LE +RE+LI +TSENK++L++LED LL EL+T TGN+LDN ELI TLE+TK KA  V +QL  +   +ADIE  R+GYRPAAKRGAVLFF L++++ +N+MYQ++L +YL VF+ ++R+++PD+SL KRLNNII TLT +VYCYGCTGIFE+HK+L S QIA +L +  G +  +E+DFFIKG+I +      N   WL + SW+D+ +L+   P  F  + D       EW+ W+ L++PE       Y    N+F+KL  LRC+R+DRI  +I  ++   M + ++ PP+ +F A +  ++  +P+  ++S GSDP  +++KLA++I   +    ++S+GQGQEK AL L D A+ +G WLMLQN HLLI+F+  +EK LD +  PHPDFRLW+TT+P  TFPIGILQKS K+V EPP+G+K NL  TY K+  E      H  +R  ++ LAF HA++QERR++ K+GWNI+YDF ++DF V  +IL+TYLT+    K   +PWN++KYLIGEVMYGGR ID FDRRI   YM+EY GDFLFD+F++FHFYEDD+++Y +   PEE + LKE Y  +I  LP    P VFGLH NA IGY T   + +W ++IELQPQT +     G I S++  +  +  GIL KLP  ++  +I++ +  S   +SPT VVLLQELDRFN+L+ ++  +L  L+KA+ GE+GM   LD+I+ SL NG++P  W  LAP T K L SWLEHL  R +QY+ W  +G+  +  +WLSGLH+PQSYLTALVQ ACRRN W LD  TL T +T   D   +++      GC V G+YIEG  +D+    +     + L++ + I+ + PIE+H+ K  NT   PVY TS RRNAMG+GLV   +LAT+E  SHWILQG+ LTLN+D
Sbjct: 2559 LFKMVIVDLPPTPSKFHYIFNLKDLSRIFAGMLLIEPTCFKGLRDLIRVWRNEYTRIICDRLITDNDIANVRRNLAVEVAERFPPTFEEEHGFIDAAAAEAEAQARLLYEPSKADIDGGEEEGEEEEEGEEAPQVILSLKDYVLRDPLLFGDFRNFTNESEPRLYEDLLDYNSVYFLFTEILEEYCERKQ-KMTLVLFEDCLEHLTRVHRTLRMNRGHVLLIGVGGSGKKCITRLAAFAAECDVFEITISRGYNEAAFREDLKVLYTIAGVKRKKVVFLFTGAQVAEEGFLELINNILTVGQVPALFPDEDKDGIVNQVRKFAEEDGVSASKDAVWGYFLRTCAENLHVVLCMSPAGDALRNRCRNFPGLIGSTYIDWVFPWPRQALYAVAKLFL-TEHRLIPASHREAIVEHVVHVHTSIQQYSKDYLAKLRRNNFVTPKHYLDYINTYRGLLEEKAKFITQQRSRLGEGIKKIEEASVQIDELRIIVTEQKKNVAVASEECEAMLVTIESSTQKANVKKAEASEKSVEVEIKGKQIAIEKDEAEEILAEAMPALEEARLALSQLEKAQITEIRSFATPPAAVQVVCECVAILKGYKEINWKSAKGMMSDVNFLKSLMEMDCEALTQKQITQCRQHMKTGNL--EDMAKISVAGAGLLRFVRAVLGFFDVYKEVKPKKERLDFLVEEQEVQIKLLNHLNGEIQKLEEKLNELNENYATSMKQMRALTEMMQQAERRLIASDKLISGLTSELIRWSKEMASLGQQLIDSVGGCLISASFLAYTGAFTWEFRKAMVFDDWLEDIASLGIPIQLPFKIDGYLTTDVEISQWSNEGLPPDELSIQNGILTMRASRFPLCIDPQLQALQWIRKREFK-----NNLKVLSFSDSDFLKQLEMAIMYGTPVLFEDVDDYIDPVIDDILQKNIRIQGGRKFVMLGDKEVDWDPSFRVYLTTKFSNPKFDPAVYAKALVINYTVTQTGLEDQLLSVVVGTERPDLEAQRESLIAQTSENKQLLQQLEDSLLRELSTSTGNMLDNVELIETLENTKTKAGVVMEQLKLAADTAADIEVLRNGYRPAAKRGAVLFFALSDMATVNSMYQYALAAYLDVFVYSLRKAVPDASLNKRLNNIIKTLTENVYCYGCTGIFERHKLLFSFQIATKLAQRDGILLQSELDFFIKGSIALTKSERSNPCKWLSEKSWEDVLKLAFDFPDIFGTLPDHFGRYLTEWKEWFDLENPEEVPCPGDYNIKCNAFQKLMFLRCFRVDRIFRSINQYIVETMDEFYIMPPVVSFSAIYEQTSSTIPVCFVLSAGSDPTNDLIKLADTI-VGMSNFCHISLGQGQEKAALRLLDGAIKQGMWLMLQNGHLLIRFVRELEKHLDRIENPHPDFRLWITTDPTPTFPIGILQKSLKVVTEPPNGLKLNLRSTYFKVRQERLESCSHVAFRPLVYVLAFFHAVVQERRKYDKLGWNIAYDFNDTDFDVCTEILRTYLTRCGTGK---IPWNSLKYLIGEVMYGGRVIDDFDRRITNCYMNEYMGDFLFDEFKVFHFYEDDNVDYCL---PEEETILKEDYIAHIDKLPLVNKPDVFGLHPNAEIGYYTMAARNIWNSLIELQPQTGE---GTGGI-SRDDFIDSVAAGILKKLPPAFETWRIRKQIQMS---LSPTGVVLLQELDRFNLLVVRIKKTLELLRKAIAGEIGMDNVLDNIANSLFNGLLPAAWSKLAPATCKQLASWLEHLRLRAVQYKYWTLSGEPLV--MWLSGLHIPQSYLTALVQIACRRNAWPLDRSTLFTYVTKFAD--PDDVEERPVTGCLVHGLYIEGGRFDLATNQLARSHPKVLVEELAILAVEPIEAHRLKLQNTYLAPVYTTSLRRNAMGVGLVFEANLATSEDLSHWILQGVCLTLNTD 4444          
BLAST of Dynein heavy chain vs. Ensembl Fly
Match: Dhc93AB (gene:FBgn0013812 transcript:FBtr0273236)

HSP 1 Score: 1024.23 bits (2647), Expect = 0.000e+0
Identity = 637/1868 (34.10%), Postives = 1042/1868 (55.78%), Query Frame = 1
Query:   85 MLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQIN-PILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPV-QIVGELLCLVLQSGEI----SWKSARGLMADAN-FIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSIN--IPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDF--EIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIK-PHPDFRLWLTTEPVST-----FPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVF-LDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPS-IWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNS 5631
             LPT  K HY  NLRD+S VFQGL  S+ +  T +  ++RLW+HE  RV++D++  ++D +    +  +I+K  F +    V  + P +Y  +     D  P+ Y  ++ +  +    QE + SYN+L    ++LVLF+DA+ H+  I+RIL    G ALLVGV GSGK+SL+RLAAF + L   +I L KGYG  + + +   +Y K   +N   MFL  D  +  E FL LIN+ML  G +P LF DDE E ++  V ++   +G  + +E  W++F      +L IVL  SPVG TLR R R FP I+N T+I+WF+ WP++AL SVA   +  +N ++P  + + V   +  +H SV   S+++    RR NY T  +++  I  Y+ LL  K+ DL++K +RL  GL+KL +TA Q+  L  K+A Q+I ++EK  + + L+  + I TE+   +K + +E+ +++   +  ++K++ + EE L  A PAL AA+ +L+ L+K ++TE+++F +PP  V  +   ++ L+ Q G++    SWK+A+  MA  + F+  L   D E I  +   A++  +   +   E VR+ S A AG   ++I+++ FY+V  ++ PK++ +     E   A+ +L  ++ +V  LE QL  L   F+ A  +  R  +E    Q  +  A +L  GLASE  RW   V  F ++ + L GD L+ +AF++Y+G FT  +R +L+   W   L+SI+  IP + N    +LLT D  I+ W ++GLP D +SI+NA + + S R+P+ IDPQ Q VKWIK      +   + +K+  L    +L  +E SI  G   L E+ DE++DPV+D++L +N+IK KG+  + +GD+E+++   FRL L +KL+NP + P + ++  +IN+TVT  GLE QLL+ +VK ER +LEE + +L  + ++ K +LK+LED LL  L++   NIL +  L+  LE TK+ A ++ ++++++ I S +I++ R+ YRPAA R ++L+F+L  L+ IN +YQFSL ++ VVF KAI ++ P  +L  R++N+I  +T+ V+ Y   G+FE  K++ + Q+  ++      +T  E+DF ++  I  +   P    ++L + SW  +  L+ +  +F ++   +  +   W+   + + PE E      +   + ++LC++R  R DR+  A+ DF+   +G ++V      F  ++  ++P  PI  I+SPG +P  ++  L   + F  ++     +S+GQGQE  A A  DTA   G W++LQN HL+ K++ V+EKKL+   +  HPD+R++L+ EP ST      P GIL+ S KI  EPP+G+  NL         E   +     +++  +F L + HA++ ERR+FG  GWN  Y F   D  +S+ +L  YL          VPW  ++YL GE+MYGG   D +DRR+  TY++EY    L            D   +  P  P   ++  + Y  Y+  +   +SP ++GLH NA IG+ T   + +++ + E+QP+  D     G   ++E  + ++V  I+ KLP  +++ +I   +     E +P  +V  QE +R N L  +M  SL  L   L GE+ ++ +++ +  SL    +P  W   A  ++  L +W   L  R  + ETW  +    +PS +WL+G   PQS LTA++Q   RRN+  LD   L   +T    +  E  T +   GC V GI++EG  WD++ G I+  + ++L  SMP+I +  I   K    N  + PVY T  R        V+ L+L T +    WIL G+AL L +
Sbjct: 2666 FLPTAIKSHYIFNLRDISNVFQGLLFSSTECLTGSTDLIRLWQHETQRVYSDKLTDDKDIDSFTKMQHDIVKKSFEEIDESVIFDKPNIYCHFAGGIGD--PK-YMPIKGWPELHKLLQEAMSSYNDL-VAAMNLVLFEDAMMHVCRINRILESPRGSALLVGVGGSGKQSLARLAAFISSLEVVQIQLKKGYGVNDLKNEFSGLYLKAGLKNVGIMFLMTDAQIPSEDFLVLINDMLATGEIPDLFPDDEIENIIAGVRNEVKGAGLVDTRENCWKFFIDRVRKQLKIVLCFSPVGSTLRVRSRKFPAIINATSINWFHEWPQEALISVAMNFL-AQNKVLPENHRDSVAKFMAYVHTSVNTTSKVYLQNERRYNYTTPKSYLEQINLYIKLLNHKNEDLQSKIERLENGLEKLRSTALQVADLKVKLAVQEIELKEKNEAADALIEIVGIETEKVQTEKAVADEEEMKVALIADEVSKKQRDCEEDLLKAEPALMAAQDALNTLNKANLTELKSFGSPPGAVTNVTAAVMVLLSQGGKVPKDRSWKAAKIAMAKVDTFLDSLINYDKENIHPEITKAIQPYLKDPEFEPEFVRSKSGAAAGLCAWVINIIKFYEVYCDVEPKRKALAAANAELAAAQDKLAGIKRKVMSLEEQLGKLTADFEKATADKLRCQQEADATQATIALANRLVGGLASENVRWAEAVNNFVKQGITLPGDILLITAFISYVGCFTKGFRIDLLLKMWTPFLKSIDPPIPTTENLDPLSLLTDDTTIAIWTNEGLPSDRMSIENATILSNSDRWPLMIDPQLQGVKWIK------QKYGEDLKVIRLGQRSYLDIIEKSINAGCNVLIENIDENLDPVLDSLLGRNLIK-KGKA-IKIGDKEIEYNSNFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKAERPDLEELKADLTKQQNDFKIMLKKLEDDLLSRLSSAGENILGDTALVENLETTKSTASEIEQKVAEAKITSKEIDKAREYYRPAAARASLLYFILNELNTINPIYQFSLKAFSVVFQKAIAKAEPGDTLDLRVSNLIDCITYSVFQYTSRGLFECDKLIFASQMTFQILLMNEEVTSAELDFLLRFPIKPHVTSP---VDFLTNQSWGGICSLA-SKDEFRNLDRDIETSSKRWKKLVESELPEKEKFPQEWKNKTALQRLCMIRALRPDRMTYALADFIEEKLGSKYVESRAMEFAKSYEEASPSTPIFFILSPGVNPLKDVEALGKQMGFSMDLGNFHNVSLGQGQEAIAEAAMDTAAKHGHWVVLQNIHLVRKWLPVLEKKLEYYAEDSHPDYRMFLSAEPASTPSAHIIPQGILESSIKITNEPPTGMLANLHKALDNFTQETLEMSGKEAEFKAILFSLCYFHAVVAERRKFGPQGWNKIYPFNVGDLNISVSVLYNYL-----EANAKVPWEDLRYLFGEIMYGGHITDDWDRRLCITYLEEYMQPDLV-----------DGELFLAPSFPAPPNTDYQGYHTYVDEMMPAESPYLYGLHPNAEIGFLTTRAENIFRTVFEMQPR--DAGAGGGATVTREDKVKQIVDEIIEKLPEEFNMVEIMNKV----EERTPYVIVAFQECERMNFLTSEMKRSLKELDLGLKGELTITSDMEVLENSLFLDQVPPIWTQRAYPSLLGLNNWFIDLCLRLRELETW--STDFVLPSCVWLAGFFNPQSLLTAIMQSTARRNDLPLDKMCLQCDVTK---KQKEEFTTAPRDGCCVHGIFMEGARWDIQQGIIMESRLKELYPSMPVINIRAITQDKQDLRNMYECPVYKTRTRGPTT---YVSNLNLKTKDKPGKWILAGVALLLQT 4486          
BLAST of Dynein heavy chain vs. Ensembl Fly
Match: Dhc93AB (gene:FBgn0013812 transcript:FBtr0336774)

HSP 1 Score: 1024.23 bits (2647), Expect = 0.000e+0
Identity = 637/1868 (34.10%), Postives = 1042/1868 (55.78%), Query Frame = 1
Query:   85 MLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQIN-PILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPV-QIVGELLCLVLQSGEI----SWKSARGLMADAN-FIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSIN--IPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDF--EIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIK-PHPDFRLWLTTEPVST-----FPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVF-LDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPS-IWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNS 5631
             LPT  K HY  NLRD+S VFQGL  S+ +  T +  ++RLW+HE  RV++D++  ++D +    +  +I+K  F +    V  + P +Y  +     D  P+ Y  ++ +  +    QE + SYN+L    ++LVLF+DA+ H+  I+RIL    G ALLVGV GSGK+SL+RLAAF + L   +I L KGYG  + + +   +Y K   +N   MFL  D  +  E FL LIN+ML  G +P LF DDE E ++  V ++   +G  + +E  W++F      +L IVL  SPVG TLR R R FP I+N T+I+WF+ WP++AL SVA   +  +N ++P  + + V   +  +H SV   S+++    RR NY T  +++  I  Y+ LL  K+ DL++K +RL  GL+KL +TA Q+  L  K+A Q+I ++EK  + + L+  + I TE+   +K + +E+ +++   +  ++K++ + EE L  A PAL AA+ +L+ L+K ++TE+++F +PP  V  +   ++ L+ Q G++    SWK+A+  MA  + F+  L   D E I  +   A++  +   +   E VR+ S A AG   ++I+++ FY+V  ++ PK++ +     E   A+ +L  ++ +V  LE QL  L   F+ A  +  R  +E    Q  +  A +L  GLASE  RW   V  F ++ + L GD L+ +AF++Y+G FT  +R +L+   W   L+SI+  IP + N    +LLT D  I+ W ++GLP D +SI+NA + + S R+P+ IDPQ Q VKWIK      +   + +K+  L    +L  +E SI  G   L E+ DE++DPV+D++L +N+IK KG+  + +GD+E+++   FRL L +KL+NP + P + ++  +IN+TVT  GLE QLL+ +VK ER +LEE + +L  + ++ K +LK+LED LL  L++   NIL +  L+  LE TK+ A ++ ++++++ I S +I++ R+ YRPAA R ++L+F+L  L+ IN +YQFSL ++ VVF KAI ++ P  +L  R++N+I  +T+ V+ Y   G+FE  K++ + Q+  ++      +T  E+DF ++  I  +   P    ++L + SW  +  L+ +  +F ++   +  +   W+   + + PE E      +   + ++LC++R  R DR+  A+ DF+   +G ++V      F  ++  ++P  PI  I+SPG +P  ++  L   + F  ++     +S+GQGQE  A A  DTA   G W++LQN HL+ K++ V+EKKL+   +  HPD+R++L+ EP ST      P GIL+ S KI  EPP+G+  NL         E   +     +++  +F L + HA++ ERR+FG  GWN  Y F   D  +S+ +L  YL          VPW  ++YL GE+MYGG   D +DRR+  TY++EY    L            D   +  P  P   ++  + Y  Y+  +   +SP ++GLH NA IG+ T   + +++ + E+QP+  D     G   ++E  + ++V  I+ KLP  +++ +I   +     E +P  +V  QE +R N L  +M  SL  L   L GE+ ++ +++ +  SL    +P  W   A  ++  L +W   L  R  + ETW  +    +PS +WL+G   PQS LTA++Q   RRN+  LD   L   +T    +  E  T +   GC V GI++EG  WD++ G I+  + ++L  SMP+I +  I   K    N  + PVY T  R        V+ L+L T +    WIL G+AL L +
Sbjct: 2676 FLPTAIKSHYIFNLRDISNVFQGLLFSSTECLTGSTDLIRLWQHETQRVYSDKLTDDKDIDSFTKMQHDIVKKSFEEIDESVIFDKPNIYCHFAGGIGD--PK-YMPIKGWPELHKLLQEAMSSYNDL-VAAMNLVLFEDAMMHVCRINRILESPRGSALLVGVGGSGKQSLARLAAFISSLEVVQIQLKKGYGVNDLKNEFSGLYLKAGLKNVGIMFLMTDAQIPSEDFLVLINDMLATGEIPDLFPDDEIENIIAGVRNEVKGAGLVDTRENCWKFFIDRVRKQLKIVLCFSPVGSTLRVRSRKFPAIINATSINWFHEWPQEALISVAMNFL-AQNKVLPENHRDSVAKFMAYVHTSVNTTSKVYLQNERRYNYTTPKSYLEQINLYIKLLNHKNEDLQSKIERLENGLEKLRSTALQVADLKVKLAVQEIELKEKNEAADALIEIVGIETEKVQTEKAVADEEEMKVALIADEVSKKQRDCEEDLLKAEPALMAAQDALNTLNKANLTELKSFGSPPGAVTNVTAAVMVLLSQGGKVPKDRSWKAAKIAMAKVDTFLDSLINYDKENIHPEITKAIQPYLKDPEFEPEFVRSKSGAAAGLCAWVINIIKFYEVYCDVEPKRKALAAANAELAAAQDKLAGIKRKVMSLEEQLGKLTADFEKATADKLRCQQEADATQATIALANRLVGGLASENVRWAEAVNNFVKQGITLPGDILLITAFISYVGCFTKGFRIDLLLKMWTPFLKSIDPPIPTTENLDPLSLLTDDTTIAIWTNEGLPSDRMSIENATILSNSDRWPLMIDPQLQGVKWIK------QKYGEDLKVIRLGQRSYLDIIEKSINAGCNVLIENIDENLDPVLDSLLGRNLIK-KGKA-IKIGDKEIEYNSNFRLILHTKLANPHYKPEMQAQTTLINFTVTRDGLEDQLLAEVVKAERPDLEELKADLTKQQNDFKIMLKKLEDDLLSRLSSAGENILGDTALVENLETTKSTASEIEQKVAEAKITSKEIDKAREYYRPAAARASLLYFILNELNTINPIYQFSLKAFSVVFQKAIAKAEPGDTLDLRVSNLIDCITYSVFQYTSRGLFECDKLIFASQMTFQILLMNEEVTSAELDFLLRFPIKPHVTSP---VDFLTNQSWGGICSLA-SKDEFRNLDRDIETSSKRWKKLVESELPEKEKFPQEWKNKTALQRLCMIRALRPDRMTYALADFIEEKLGSKYVESRAMEFAKSYEEASPSTPIFFILSPGVNPLKDVEALGKQMGFSMDLGNFHNVSLGQGQEAIAEAAMDTAAKHGHWVVLQNIHLVRKWLPVLEKKLEYYAEDSHPDYRMFLSAEPASTPSAHIIPQGILESSIKITNEPPTGMLANLHKALDNFTQETLEMSGKEAEFKAILFSLCYFHAVVAERRKFGPQGWNKIYPFNVGDLNISVSVLYNYL-----EANAKVPWEDLRYLFGEIMYGGHITDDWDRRLCITYLEEYMQPDLV-----------DGELFLAPSFPAPPNTDYQGYHTYVDEMMPAESPYLYGLHPNAEIGFLTTRAENIFRTVFEMQPR--DAGAGGGATVTREDKVKQIVDEIIEKLPEEFNMVEIMNKV----EERTPYVIVAFQECERMNFLTSEMKRSLKELDLGLKGELTITSDMEVLENSLFLDQVPPIWTQRAYPSLLGLNNWFIDLCLRLRELETW--STDFVLPSCVWLAGFFNPQSLLTAIMQSTARRNDLPLDKMCLQCDVTK---KQKEEFTTAPRDGCCVHGIFMEGARWDIQQGIIMESRLKELYPSMPVINIRAITQDKQDLRNMYECPVYKTRTRGPTT---YVSNLNLKTKDKPGKWILAGVALLLQT 4496          
BLAST of Dynein heavy chain vs. Ensembl Zebrafish
Match: si:dkeyp-86b9.1 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 1833.54 bits (4748), Expect = 0.000e+0
Identity = 956/1852 (51.62%), Postives = 1329/1852 (71.76%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIP-KFSDILDQVTNNEDEWRNWYKLQSPE-SEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIIT--NEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+V+ GL  +  +RF    Q +R+WR+ECLRVF+DR+I   DK +VQ  + N+++  F   +     +PIL+GDY T  L  EPR+YED+ DY   K+ FQE +E YNE ++ +++LVLFDDALEHL  IHRI+RMD GHALLVGV GSGK+SL++LAAF A    FEI LS+GY E  FR+DLK +Y KL  EN   +FLF D HVA+EGFLELINNMLT GMVP LF DDEKE +L  + D+  KSG   +KE IWQYF       LHIVLAMSPVG TLR RCRNFPG+VNNT+IDWF PWP QAL++VA   +  ++P+IP  + E VI HV  +H SV   S++F   LRR NY+T  N++++I TY +LLE KD  +  + +RL  GLDKL+  + Q+  LN K+ EQK+++ EKT +CE L+ EI  +T  A  KK + EEK+ EI +Q+KVI  EK +AE +L+ A+PALEAA+ +L +LDK+DVTEIR+F  PPK VQ V E + ++    EI+WK+A+G+M++ NF++ L  +D ++I    +  VK  +     + E+++  SKAG+G L+F+ +V+G+ +VAR+I+PK+E+V  LER F+++++ELER+Q E+  ++ +L+ L  +++ A  E + L +E  +M+R+L+AA+KL  GLASE  RWI D+   +Q RV LLGDCLI +AFL+Y G F++++R+ +V   W A +    IP S+ F+I+NLLT +VEIS+W S+GLP DELS+QN ILTT+S+RFP+CIDPQ+QA+ W+KK E     E  ++KIS+ ND  FL+ LE +IK+G P+LF+D DE++DPVIDNVL KNI  ++GR+ V+LGD+EVD++P F+LYL +KL+NPKF P+++ +A +INYTVTL GLE QLLS +V  ER+ELEE+RE LILETSENKR+LK+LED LL ELAT TGN+LDN ELI TL++TK+KA +V ++L  +   + DI+  RDGYRPAAKRGAVLFFVL  ++++++MYQ+SL S+L VF  ++ +S+P+  L  RL NII TLT +VY YGCTG+FE+HK+L S  + +++E+  G    +E++FF KGN+++     + L +WLPD  W+D+ +L    P +F  + D +  N +EW+NWY L +PE + F   YKE  + F+KL L+RC+R+DR+  A++D+VT  MG+++V PP+ +F A F  S+P  PIV I+SPGS+P ++++KLA    F ++++K+L+MGQGQEK A  L DTAV+RGQWLMLQN HLL+K++  +EK L+ + KPHPDFRLWLTTEP+  FPIGILQKS K+V EPP+G+K N+  TY KI ++  ++  HP +R  ++ LAF HA++QERR++GKIGWN+ YDF ESDF V ++IL TYLTKA  +    +PW ++KYLIGEVMYGGR IDSFDRRIL  Y DEY GDF+FD FQ FHF+ +  ++Y IP         K++Y + I+SLP   +  VFGLH NA IGY T   +++W ++IELQPQT D    +G   S+++ +S++   I  KLP ++D++ I++ L     EISPT+VVLLQEL+RFN L  +M  SL  L++AL GEVGMS ELD+++++L NG +P  WR LAP+T+K LG+W+ H ++R  QY +W+  G+  +  +WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T  + ED+  E        GC+V G+Y+EG  WD+ NGC++  K R L+  +PI+++ PIE+ + K  NT++ PVY TS RRNAMG+GLV   DL TT+H SHW+L+G+ L LNSD
Sbjct: 2801 PTPSKFHYIFNLRDLSRVYHGLTLTNPERFCTVTQFVRVWRNECLRVFHDRLINETDKIMVQGHVKNLVEEHFKSDLDSAMRDPILFGDYRT-ALKSEPRVYEDILDYDASKALFQEILEEYNE-NKTKMNLVLFDDALEHLTVIHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGYEVFEIVLSRGYSETNFRDDLKTLYLKLGIENKKMVFLFTDAHVAEEGFLELINNMLTSGMVPALFADDEKESVLNQLRDEAMKSGCGPSKESIWQYFVNKSANNLHIVLAMSPVGDTLRTRCRNFPGLVNNTSIDWFSPWPLQALYAVAKSFLG-ESPMIPKSHSEAVIDHVCMVHSSVGDYSKLFLQTLRRSNYVTPKNYLDFINTYSNLLEDKDKYILAQYKRLEGGLDKLKEASGQLAELNVKLDEQKVVLAEKTSACEILLEEICANTAVAEEKKTLAEEKAKEIEEQNKVIVVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFTKPPKQVQTVCECILVIRGYKEINWKTAKGMMSEGNFLRSLMEMDCDSINANQVKHVKAYLRNLNTSLEEMQGISKAGSGMLRFVEAVMGYCEVARDIKPKREKVARLERNFHQSKRELERIQNELGAIQKELRALGDKYEGAMTEKQLLQEEAEVMERRLVAADKLISGLASENKRWIKDLEELKQRRVRLLGDCLICAAFLSYEGAFSWDFRNEMVYKVWQADVLERGIPLSQPFRIENLLTDEVEISRWGSEGLPPDELSVQNGILTTRSSRFPLCIDPQQQALNWVKKKE-----EKNNLKISSFNDPDFLKGLELAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAEGRQVVVLGDKEVDYDPNFKLYLNTKLANPKFLPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLILETSENKRLLKDLEDSLLRELATSTGNMLDNVELIQTLDETKSKANEVFEKLKLAEKTAVDIDTLRDGYRPAAKRGAVLFFVLAEMALVSSMYQYSLASFLEVFDLSLSKSLPNPILPSRLKNIIDTLTQNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQDELEFFFKGNLSLEKSKRKKLLDWLPDQGWEDIIRLMELFPNEFGTLADDIEKNPEEWKNWYDLDAPEQASFPMKYKENLSPFQKLLLIRCFRLDRVYRAVSDYVTLTMGEKYVQPPVISFEAIFDQSSPNSPIVFILSPGSEPASDLMKLAKHSGFGVNRLKFLAMGQGQEKVAFQLLDTAVARGQWLMLQNCHLLVKWLRDLEKTLERITKPHPDFRLWLTTEPIKDFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHDKLMNCAHPAFRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILDTYLTKAQNQGDEIIPWGSLKYLIGEVMYGGRVIDSFDRRILTVYTDEYLGDFIFDTFQPFHFFHNADVDYKIP-----ALGPKQVYVDEIESLPLANTAEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGD----SGGGISRDEYISQVARDIQSKLPEVFDLDVIRKKL---GLEISPTSVVLLQELERFNKLTVRMSRSLAELQRALAGEVGMSSELDEVARALFNGQIPVIWRKLAPDTLKSLGNWMIHFKRRHEQYSSWVNEGEPYV--MWLSGLHIPESYLTALVQATCRKNGWPLDHSTLYTQVTQYSSEDQVKER----PGQGCFVSGLYLEGADWDIDNGCLVRSKPRVLVSQLPILKIIPIEARRLKLQNTLRTPVYTTSMRRNAMGVGLVFEADLYTTKHISHWVLEGVCLCLNSD 4626          
BLAST of Dynein heavy chain vs. Ensembl Zebrafish
Match: DNAH10 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 1833.54 bits (4748), Expect = 0.000e+0
Identity = 956/1852 (51.62%), Postives = 1329/1852 (71.76%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIP-KFSDILDQVTNNEDEWRNWYKLQSPE-SEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIIT--NEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+V+ GL  +  +RF    Q +R+WR+ECLRVF+DR+I   DK +VQ  + N+++  F   +     +PIL+GDY T  L  EPR+YED+ DY   K+ FQE +E YNE ++ +++LVLFDDALEHL  IHRI+RMD GHALLVGV GSGK+SL++LAAF A    FEI LS+GY E  FR+DLK +Y KL  EN   +FLF D HVA+EGFLELINNMLT GMVP LF DDEKE +L  + D+  KSG   +KE IWQYF       LHIVLAMSPVG TLR RCRNFPG+VNNT+IDWF PWP QAL++VA   +  ++P+IP  + E VI HV  +H SV   S++F   LRR NY+T  N++++I TY +LLE KD  +  + +RL  GLDKL+  + Q+  LN K+ EQK+++ EKT +CE L+ EI  +T  A  KK + EEK+ EI +Q+KVI  EK +AE +L+ A+PALEAA+ +L +LDK+DVTEIR+F  PPK VQ V E + ++    EI+WK+A+G+M++ NF++ L  +D ++I    +  VK  +     + E+++  SKAG+G L+F+ +V+G+ +VAR+I+PK+E+V  LER F+++++ELER+Q E+  ++ +L+ L  +++ A  E + L +E  +M+R+L+AA+KL  GLASE  RWI D+   +Q RV LLGDCLI +AFL+Y G F++++R+ +V   W A +    IP S+ F+I+NLLT +VEIS+W S+GLP DELS+QN ILTT+S+RFP+CIDPQ+QA+ W+KK E     E  ++KIS+ ND  FL+ LE +IK+G P+LF+D DE++DPVIDNVL KNI  ++GR+ V+LGD+EVD++P F+LYL +KL+NPKF P+++ +A +INYTVTL GLE QLLS +V  ER+ELEE+RE LILETSENKR+LK+LED LL ELAT TGN+LDN ELI TL++TK+KA +V ++L  +   + DI+  RDGYRPAAKRGAVLFFVL  ++++++MYQ+SL S+L VF  ++ +S+P+  L  RL NII TLT +VY YGCTG+FE+HK+L S  + +++E+  G    +E++FF KGN+++     + L +WLPD  W+D+ +L    P +F  + D +  N +EW+NWY L +PE + F   YKE  + F+KL L+RC+R+DR+  A++D+VT  MG+++V PP+ +F A F  S+P  PIV I+SPGS+P ++++KLA    F ++++K+L+MGQGQEK A  L DTAV+RGQWLMLQN HLL+K++  +EK L+ + KPHPDFRLWLTTEP+  FPIGILQKS K+V EPP+G+K N+  TY KI ++  ++  HP +R  ++ LAF HA++QERR++GKIGWN+ YDF ESDF V ++IL TYLTKA  +    +PW ++KYLIGEVMYGGR IDSFDRRIL  Y DEY GDF+FD FQ FHF+ +  ++Y IP         K++Y + I+SLP   +  VFGLH NA IGY T   +++W ++IELQPQT D    +G   S+++ +S++   I  KLP ++D++ I++ L     EISPT+VVLLQEL+RFN L  +M  SL  L++AL GEVGMS ELD+++++L NG +P  WR LAP+T+K LG+W+ H ++R  QY +W+  G+  +  +WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T  + ED+  E        GC+V G+Y+EG  WD+ NGC++  K R L+  +PI+++ PIE+ + K  NT++ PVY TS RRNAMG+GLV   DL TT+H SHW+L+G+ L LNSD
Sbjct: 2801 PTPSKFHYIFNLRDLSRVYHGLTLTNPERFCTVTQFVRVWRNECLRVFHDRLINETDKIMVQGHVKNLVEEHFKSDLDSAMRDPILFGDYRT-ALKSEPRVYEDILDYDASKALFQEILEEYNE-NKTKMNLVLFDDALEHLTVIHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGYEVFEIVLSRGYSETNFRDDLKTLYLKLGIENKKMVFLFTDAHVAEEGFLELINNMLTSGMVPALFADDEKESVLNQLRDEAMKSGCGPSKESIWQYFVNKSANNLHIVLAMSPVGDTLRTRCRNFPGLVNNTSIDWFSPWPLQALYAVAKSFLG-ESPMIPKSHSEAVIDHVCMVHSSVGDYSKLFLQTLRRSNYVTPKNYLDFINTYSNLLEDKDKYILAQYKRLEGGLDKLKEASGQLAELNVKLDEQKVVLAEKTSACEILLEEICANTAVAEEKKTLAEEKAKEIEEQNKVIVVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFTKPPKQVQTVCECILVIRGYKEINWKTAKGMMSEGNFLRSLMEMDCDSINANQVKHVKAYLRNLNTSLEEMQGISKAGSGMLRFVEAVMGYCEVARDIKPKREKVARLERNFHQSKRELERIQNELGAIQKELRALGDKYEGAMTEKQLLQEEAEVMERRLVAADKLISGLASENKRWIKDLEELKQRRVRLLGDCLICAAFLSYEGAFSWDFRNEMVYKVWQADVLERGIPLSQPFRIENLLTDEVEISRWGSEGLPPDELSVQNGILTTRSSRFPLCIDPQQQALNWVKKKE-----EKNNLKISSFNDPDFLKGLELAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAEGRQVVVLGDKEVDYDPNFKLYLNTKLANPKFLPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLILETSENKRLLKDLEDSLLRELATSTGNMLDNVELIQTLDETKSKANEVFEKLKLAEKTAVDIDTLRDGYRPAAKRGAVLFFVLAEMALVSSMYQYSLASFLEVFDLSLSKSLPNPILPSRLKNIIDTLTQNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQDELEFFFKGNLSLEKSKRKKLLDWLPDQGWEDIIRLMELFPNEFGTLADDIEKNPEEWKNWYDLDAPEQASFPMKYKENLSPFQKLLLIRCFRLDRVYRAVSDYVTLTMGEKYVQPPVISFEAIFDQSSPNSPIVFILSPGSEPASDLMKLAKHSGFGVNRLKFLAMGQGQEKVAFQLLDTAVARGQWLMLQNCHLLVKWLRDLEKTLERITKPHPDFRLWLTTEPIKDFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHDKLMNCAHPAFRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILDTYLTKAQNQGDEIIPWGSLKYLIGEVMYGGRVIDSFDRRILTVYTDEYLGDFIFDTFQPFHFFHNADVDYKIP-----ALGPKQVYVDEIESLPLANTAEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGD----SGGGISRDEYISQVARDIQSKLPEVFDLDVIRKKL---GLEISPTSVVLLQELERFNKLTVRMSRSLAELQRALAGEVGMSSELDEVARALFNGQIPVIWRKLAPDTLKSLGNWMIHFKRRHEQYSSWVNEGEPYV--MWLSGLHIPESYLTALVQATCRKNGWPLDHSTLYTQVTQYSSEDQVKER----PGQGCFVSGLYLEGADWDIDNGCLVRSKPRVLVSQLPILKIIPIEARRLKLQNTLRTPVYTTSMRRNAMGVGLVFEADLYTTKHISHWVLEGVCLCLNSD 4626          
BLAST of Dynein heavy chain vs. Ensembl Zebrafish
Match: DNAH10 (si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-163])

HSP 1 Score: 1831.22 bits (4742), Expect = 0.000e+0
Identity = 956/1852 (51.62%), Postives = 1329/1852 (71.76%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIP-KFSDILDQVTNNEDEWRNWYKLQSPE-SEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIIT--NEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+V+ GL  +  +RF    Q +R+WR+ECLRVF+DR+I   DK +VQ  + N+++  F   +     +PIL+GDY T  L  EPR+YED+ DY   K+ FQE +E YNE ++ +++LVLFDDALEHL  IHRI+RMD GHALLVGV GSGK+SL++LAAF A    FEI LS+GY E  FR+DLK +Y KL  EN   +FLF D HVA+EGFLELINNMLT GMVP LF DDEKE +L  + D+  KSG   +KE IWQYF       LHIVLAMSPVG TLR RCRNFPG+VNNT+IDWF PWP QAL++VA   +  ++P+IP  + E VI HV  +H SV   S++F   LRR NY+T  N++++I TY +LLE KD  +  + +RL  GLDKL+  + Q+  LN K+ EQK+++ EKT +CE L+ EI  +T  A  KK + EEK+ EI +Q+KVI  EK +AE +L+ A+PALEAA+ +L +LDK+DVTEIR+F  PPK VQ V E + ++    EI+WK+A+G+M++ NF++ L  +D ++I    +  VK  +     + E+++  SKAG+G L+F+ +V+G+ +VAR+I+PK+E+V  LER F+++++ELER+Q E+  ++ +L+ L  +++ A  E + L +E  +M+R+L+AA+KL  GLASE  RWI D+   +Q RV LLGDCLI +AFL+Y G F++++R+ +V   W A +    IP S+ F+I+NLLT +VEIS+W S+GLP DELS+QN ILTT+S+RFP+CIDPQ+QA+ W+KK E     E  ++KIS+ ND  FL+ LE +IK+G P+LF+D DE++DPVIDNVL KNI  ++GR+ V+LGD+EVD++P F+LYL +KL+NPKF P+++ +A +INYTVTL GLE QLLS +V  ER+ELEE+RE LILETSENKR+LK+LED LL ELAT TGN+LDN ELI TL++TK+KA +V ++L  +   + DI+  RDGYRPAAKRGAVLFFVL  ++++++MYQ+SL S+L VF  ++ +S+P+  L  RL NII TLT +VY YGCTG+FE+HK+L S  + +++E+  G    +E++FF KGN+++     + L +WLPD  W+D+ +L    P +F  + D +  N +EW+NWY L +PE + F   YKE  + F+KL L+RC+R+DR+  A++D+VT  MG+++V PP+ +F A F  S+P  PIV I+SPGS+P ++++KLA    F ++++K+L+MGQGQEK A  L DTAV+RGQWLMLQN HLL+K++  +EK L+ + KPHPDFRLWLTTEP+  FPIGILQKS K+V EPP+G+K N+  TY KI ++  ++  HP +R  ++ LAF HA++QERR++GKIGWN+ YDF ESDF V ++IL TYLTKA  +    +PW ++KYLIGEVMYGGR IDSFDRRIL  Y DEY GDF+FD FQ FHF+ +  ++Y IP         K++Y + I+SLP   +  VFGLH NA IGY T   +++W ++IELQPQT D    +G   S+++ +S++   I  KLP ++D++ I++ L     EISPT+VVLLQEL+RFN L  +M  SL  L++AL GEVGMS ELD+++++L NG +P  WR LAP+T+K LG+W+ H ++R  QY +W+  G+  +  +WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T  + ED+  E        GC+V G+Y+EG  WD+ NGC++  K R L+  +PI+++ PIE+ + K  NT++ PVY TS RRNAMG+GLV   DL TT+H SHW+L+G+ L LNSD
Sbjct: 2437 PTPSKFHYIFNLRDLSRVYHGLTLTNPERFCTVTQFVRVWRNECLRVFHDRLINETDKIMVQGHVKNLVEEHFKSDLDSAMRDPILFGDYRT-ALKSEPRVYEDILDYDASKALFQEILEEYNE-NKTKMNLVLFDDALEHLTVIHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGYEVFEIVLSRGYSETNFRDDLKTLYLKLGIENKKMVFLFTDAHVAEEGFLELINNMLTSGMVPALFADDEKESVLNQLRDEAMKSGCGPSKESIWQYFVNKSANNLHIVLAMSPVGDTLRTRCRNFPGLVNNTSIDWFSPWPLQALYAVAKSFLG-ESPMIPKSHSEAVIDHVCMVHSSVGDYSKLFLQTLRRSNYVTPKNYLDFINTYSNLLEDKDKYILAQYKRLEGGLDKLKEASGQLAELNVKLDEQKVVLAEKTSACEILLEEICANTAVAEEKKTLAEEKAKEIEEQNKVIVVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFTKPPKQVQTVCECILVIRGYKEINWKTAKGMMSEGNFLRSLMEMDCDSINANQVKHVKAYLRNLNTSLEEMQGISKAGSGMLRFVEAVMGYCEVARDIKPKREKVARLERNFHQSKRELERIQNELGAIQKELRALGDKYEGAMTEKQLLQEEAEVMERRLVAADKLISGLASENKRWIKDLEELKQRRVRLLGDCLICAAFLSYEGAFSWDFRNEMVYKVWQADVLERGIPLSQPFRIENLLTDEVEISRWGSEGLPPDELSVQNGILTTRSSRFPLCIDPQQQALNWVKKKE-----EKNNLKISSFNDPDFLKGLELAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAEGRQVVVLGDKEVDYDPNFKLYLNTKLANPKFLPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLILETSENKRLLKDLEDSLLRELATSTGNMLDNVELIQTLDETKSKANEVFEKLKLAEKTAVDIDTLRDGYRPAAKRGAVLFFVLAEMALVSSMYQYSLASFLEVFDLSLSKSLPNPILPSRLKNIIDTLTQNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQDELEFFFKGNLSLEKSKRKKLLDWLPDQGWEDIIRLMELFPNEFGTLADDIEKNPEEWKNWYDLDAPEQASFPMKYKENLSPFQKLLLIRCFRLDRVYRAVSDYVTLTMGEKYVQPPVISFEAIFDQSSPNSPIVFILSPGSEPASDLMKLAKHSGFGVNRLKFLAMGQGQEKVAFQLLDTAVARGQWLMLQNCHLLVKWLRDLEKTLERITKPHPDFRLWLTTEPIKDFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHDKLMNCAHPAFRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILDTYLTKAQNQGDEIIPWGSLKYLIGEVMYGGRVIDSFDRRILTVYTDEYLGDFIFDTFQPFHFFHNADVDYKIP-----ALGPKQVYVDEIESLPLANTAEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGD----SGGGISRDEYISQVARDIQSKLPEVFDLDVIRKKL---GLEISPTSVVLLQELERFNKLTVRMSRSLAELQRALAGEVGMSSELDEVARALFNGQIPVIWRKLAPDTLKSLGNWMIHFKRRHEQYSSWVNEGEPYV--MWLSGLHIPESYLTALVQATCRKNGWPLDHSTLYTQVTQYSSEDQVKER----PGQGCFVSGLYLEGADWDIDNGCLVRSKPRVLVSQLPILKIIPIEARRLKLQNTLRTPVYTTSMRRNAMGVGLVFEADLYTTKHISHWVLEGVCLCLNSD 4262          
BLAST of Dynein heavy chain vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 1097.42 bits (2837), Expect = 0.000e+0
Identity = 644/1870 (34.44%), Postives = 1026/1870 (54.87%), Query Frame = 1
Query:   73 IKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEF--PKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQG--QLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGN--ININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPE-SEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDL--IKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHP-KYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQ-TEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI--WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMG-IGLVTVLDLATTE-HNSHWILQGIALTLNSDD 5637
            I  + LPTP K HY  NLRD+SKVFQGL ++  D       + RLW HEC RVF+DR++ + D E    +L   + + F  P H       P L+GD+  E+     ++YEDL D+  +K   +  +E YN L  G   + LVLF DA++H+  + R++    G+ LLVG+ GSG++SL+RLAA+    + F++ ++K Y ++EFRED+K +Y     EN   +FLF D  +  E FLE INN+L+ G VP L+  DE +E+   + D   K    E  + ++ Y        LHIVL MSPVG   RNR R +P +VN T IDWF  WP  AL  VA   +D  +          V +  VT+H+SV   S   +++L+R NY+T TN++  +  Y  LL  K  +L  +  +L  GL K+++T  ++  ++ ++ E K  V E    CE  ++ I     EA  ++K     S +I  +          A+  L  A+PALE A ++L+ L+K D+TEI+++  PP  V+ V + + ++L+  E +W  A+  + + NFIK+L   D + I  + +  +     +     E +   S A      ++ ++  +  + R + PK+ R+     +  + +  L   Q ++R++  +L  LK+Q+D+   + E L ++   M+ +L  A KL  GLA E+ RW   V G ++    L+GDCL+A+AFL+Y+GPF   +R  LV + W+  +R + +P S  F     L+    + +WN QGLP D  S +N ++ T+  R+P+ +DPQ QA+KWIK ME       + +K+ +L    FLR LEN+++FG P L ++  E +DP +  +L+K++ +  GR  + LGD+E+++ P FR Y+T+KLSNP ++P + S+  I+N+ V   GLE QLL  +V+ ER ELEE++++L++  +  KR L+ELED++L  L   TG++LD+ +L+NTL+ +K  A +VA+QL  S +  + I+  R+ YRP A+R ++LFFVL +L  I+ MYQFSL +Y+ +F+ +I  S     L +R+NN+    T+ VY Y C G+FE HK+L S  +  ++ E  G +  +E +FF++G   ++         ++WL D++W ++ +L   +  F +++        +W +WY    PE +     ++   N  +K+ ++R  R DR+ + +T FV   +G +FV PPI    A    ST   P++ ++SPG DP   +++LA +      +   LS+GQGQ   A  L    V+ G W+ L N HL + ++  ++K +D+L   + HPDFRLWL++ P   FPI ILQ   KI  EPP G+K N+   Y ++    FL    P  YR+ +F L F H+++ ERR+F ++GWNI Y F +SDF+VS  +L  YL +  E     +PW+ +K+LI  + YGG   D +DRR+L TY+++YF   + D            + YY+P +  + S     Y +YI  LP  + P +FG + NA I       + L+  ++ LQPQ T  +   AG   S+E  + E+   +L K+P   D    ++ L    +++SP  VVLLQE+ R+N LL  +  SL  L+K + G V MS  L++    + +  +P  W    P ++K L SW   L QR  Q+  W    +   P +  WLSG   P  +LTA++Q + R+NN ++DT +    +T  ED    NL    + G  + G+++EG GWD K  C++  +  QL+  MP I   P+ES K    N    P Y    R  + G    V  +DL +      HWI +G AL ++ D+
Sbjct: 2556 ITSRFLPTPAKIHYLFNLRDISKVFQGLLRAHKDFHDTKQSITRLWIHECFRVFSDRLVDHADMETFVGVLSEKLASHFDVPFHTICPNKQPPLFGDFLRES-----QIYEDLLDFKALKVHMENQLEDYN-LTPGVVPMSLVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQYRKQEFREDIKKLYRLTGVENKPTVFLFNDTQIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARKDNILETPDAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAERCLDGLSLGSDDGIQTKVASIFVTVHQSVAQFSHRMKVELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMSVELEEAKKKVAEFQKQCEEYLVVIVQQKREADEQQKAVGAHSEKIEAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAV-MILRGCEPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELEVPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFK-----QGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIESSPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHMCAKILEASGKLNMDEYNFFLRGGLVLDTKKQMDNPCSHWLSDSNWDNITELD-KLTNFHELMASFEQYPRDWHHWYTNPEPEKAPLPGEWENSCNELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVVADSTTRTPLIFVLSPGVDPTAALLQLAETSGMG-QRFFALSLGQGQAPIATRLIKEGVANGHWVFLANCHLSLSWMCELDKLVDELQVQECHPDFRLWLSSSPHPEFPIAILQTGIKITTEPPRGVKWNMKRLYQRVSETQFLRCSRPLLYRKLLFSLCFFHSVILERRKFLQLGWNIIYSFNDSDFEVSENLLSLYLDEYEE-----IPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFCPAVIDTPFFKV---SSLVSYYVPRDGSQSS-----YVDYISQLPALEHPELFGQNPNADIASQITEARTLFHTLLSLQPQVTSTDTTSAG--ASREDKVLELSADVLQKIPAEIDYEGTRKLL---KDDLSPLNVVLLQEIQRYNTLLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEKAYP-SLKPLASWTRDLCQRVEQFARWAETAR---PPVLFWLSGFTFPTGFLTAVLQSSARQNNVSVDTLSWEFSVTTVED---NNLLFPPKDGVLIQGLFLEGAGWDKKASCLVEAEPMQLVCPMPTIHFKPVESRKRLAKNMYSCPCYYYPVRSGSSGRQSFVVAVDLKSGAVPYDHWIKRGTALLMSLDN 4386          
BLAST of Dynein heavy chain vs. Ensembl Zebrafish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 1096.65 bits (2835), Expect = 0.000e+0
Identity = 644/1870 (34.44%), Postives = 1026/1870 (54.87%), Query Frame = 1
Query:   73 IKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEF--PKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQG--QLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGN--ININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPE-SEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDL--IKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHP-KYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQ-TEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI--WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMG-IGLVTVLDLATTE-HNSHWILQGIALTLNSDD 5637
            I  + LPTP K HY  NLRD+SKVFQGL ++  D       + RLW HEC RVF+DR++ + D E    +L   + + F  P H       P L+GD+  E+     ++YEDL D+  +K   +  +E YN L  G   + LVLF DA++H+  + R++    G+ LLVG+ GSG++SL+RLAA+    + F++ ++K Y ++EFRED+K +Y     EN   +FLF D  +  E FLE INN+L+ G VP L+  DE +E+   + D   K    E  + ++ Y        LHIVL MSPVG   RNR R +P +VN T IDWF  WP  AL  VA   +D  +          V +  VT+H+SV   S   +++L+R NY+T TN++  +  Y  LL  K  +L  +  +L  GL K+++T  ++  ++ ++ E K  V E    CE  ++ I     EA  ++K     S +I  +          A+  L  A+PALE A ++L+ L+K D+TEI+++  PP  V+ V + + ++L+  E +W  A+  + + NFIK+L   D + I  + +  +     +     E +   S A      ++ ++  +  + R + PK+ R+     +  + +  L   Q ++R++  +L  LK+Q+D+   + E L ++   M+ +L  A KL  GLA E+ RW   V G ++    L+GDCL+A+AFL+Y+GPF   +R  LV + W+  +R + +P S  F     L+    + +WN QGLP D  S +N ++ T+  R+P+ +DPQ QA+KWIK ME       + +K+ +L    FLR LEN+++FG P L ++  E +DP +  +L+K++ +  GR  + LGD+E+++ P FR Y+T+KLSNP ++P + S+  I+N+ V   GLE QLL  +V+ ER ELEE++++L++  +  KR L+ELED++L  L   TG++LD+ +L+NTL+ +K  A +VA+QL  S +  + I+  R+ YRP A+R ++LFFVL +L  I+ MYQFSL +Y+ +F+ +I  S     L +R+NN+    T+ VY Y C G+FE HK+L S  +  ++ E  G +  +E +FF++G   ++         ++WL D++W ++ +L   +  F +++        +W +WY    PE +     ++   N  +K+ ++R  R DR+ + +T FV   +G +FV PPI    A    ST   P++ ++SPG DP   +++LA +      +   LS+GQGQ   A  L    V+ G W+ L N HL + ++  ++K +D+L   + HPDFRLWL++ P   FPI ILQ   KI  EPP G+K N+   Y ++    FL    P  YR+ +F L F H+++ ERR+F ++GWNI Y F +SDF+VS  +L  YL +  E     +PW+ +K+LI  + YGG   D +DRR+L TY+++YF   + D            + YY+P +  + S     Y +YI  LP  + P +FG + NA I       + L+  ++ LQPQ T  +   AG   S+E  + E+   +L K+P   D    ++ L    +++SP  VVLLQE+ R+N LL  +  SL  L+K + G V MS  L++    + +  +P  W    P ++K L SW   L QR  Q+  W    +   P +  WLSG   P  +LTA++Q + R+NN ++DT +    +T  ED    NL    + G  + G+++EG GWD K  C++  +  QL+  MP I   P+ES K    N    P Y    R  + G    V  +DL +      HWI +G AL ++ D+
Sbjct: 2676 ITSRFLPTPAKIHYLFNLRDISKVFQGLLRAHKDFHDTKQSITRLWIHECFRVFSDRLVDHADMETFVGVLSEKLASHFDVPFHTICPNKQPPLFGDFLRES-----QIYEDLLDFKALKVHMENQLEDYN-LTPGVVPMSLVLFRDAIDHVTRLVRVISQLRGNMLLVGIGGSGRQSLTRLAAYICRFTVFQVEVTKQYRKQEFREDIKKLYRLTGVENKPTVFLFNDTQIVDESFLEDINNILSSGEVPNLYKADELDEIQSALSDSARKDNILETPDAMFNYLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPRDALLEVAERCLDGLSLGSDDGIQTKVASIFVTVHQSVAQFSHRMKVELKRHNYVTPTNYLELVSGYKKLLSEKRDELGEQVSKLRNGLFKIDDTRTKVEAMSVELEEAKKKVAEFQKQCEEYLVVIVQQKREADEQQKAVGAHSEKIEAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAV-MILRGCEPTWAEAKRQLGEGNFIKQLVNFDKDNISDRVLKTIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIFRVVEPKRARLHGAMTQLAEKQAALAEAQGKLREVGEKLDHLKRQYDEKLAQKEELRRKSEDMELKLDRAGKLVSGLAGERVRWKETVDGLEKNMSCLVGDCLLAAAFLSYMGPFLSNHRDELVTDIWMKQVRELEVPCSPGFSFAVFLSKPTAVREWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMEFK-----QGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSLTRVGGRFLLKLGDKEIEYSPEFRFYMTTKLSNPHYTPEISSKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKVTATEVAEQLEISELTESQIDTAREAYRPCAQRASILFFVLNDLGCIDPMYQFSLDAYINLFILSIESSPRSHKLEERINNLNRHHTYAVYRYTCRGLFECHKLLFSFHMCAKILEASGKLNMDEYNFFLRGGLVLDTKKQMDNPCSHWLSDSNWDNITELD-KLTNFHELMASFEQYPRDWHHWYTNPEPEKAPLPGEWENSCNELQKMLIVRSLRQDRVSLCVTAFVINNLGSQFVEPPILDMKAVVADSTTRTPLIFVLSPGVDPTAALLQLAETSGMG-QRFFALSLGQGQAPIATRLIKEGVANGHWVFLANCHLSLSWMCELDKLVDELQVQECHPDFRLWLSSSPHPEFPIAILQTGIKITTEPPRGVKWNMKRLYQRVSETQFLRCSRPLLYRKLLFSLCFFHSVILERRKFLQLGWNIIYSFNDSDFEVSENLLSLYLDEYEE-----IPWDALKFLIAGINYGGHVTDDWDRRLLTTYINQYFCPAVIDTPFFKV---SSLVSYYVPRDGSQSS-----YVDYISQLPALEHPELFGQNPNADIASQITEARTLFHTLLSLQPQVTSTDTTSAG--ASREDKVLELSADVLQKIPAEIDYEGTRKLL---KDDLSPLNVVLLQEIQRYNTLLHTIRLSLLELEKGIKGLVVMSSSLEETFNCIHDARVPPLWEKAYP-SLKPLASWTRDLCQRVEQFARWAETAR---PPVLFWLSGFTFPTGFLTAVLQSSARQNNVSVDTLSWEFSVTTVED---NNLLFPPKDGVLIQGLFLEGAGWDKKASCLVEAEPMQLVCPMPTIHFKPVESRKRLAKNMYSCPCYYYPVRSGSSGRQSFVVAVDLKSGAVPYDHWIKRGTALLMSLDN 4506          
BLAST of Dynein heavy chain vs. Ensembl Xenopus
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:100492440])

HSP 1 Score: 1900.56 bits (4922), Expect = 0.000e+0
Identity = 973/1850 (52.59%), Postives = 1341/1850 (72.49%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPK-FSDILDQVTNNEDEWRNWYKLQSPES-EFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+V+ GL  +T +RF    QM+R+WR+E LRVF+DR++  EDK +VQ  + ++++  F   + +   +PIL+GDY T   + EPR+YED+QDY   K+ FQE +E YNE  + +++LVLFDDALEHL  IHRI+RMD GHALLVGV GSGK+SL+RLAA+AA    FEI LS+GYGE  FREDL+ +Y KL  EN   +FLF D HVA+EGFLELINNMLT GMVP LF DDEKE +L  + D+  K G    KE IWQ+F       LHIVL MSPVG TLR RCRNFPG+VNNT IDWF PWP QAL++VA   +   N LIPSQ+ E V  HVV +H SV   S+ FQ KLRR NY+T  N++++I TY  LLE K+     + +RL  GLDKL+    Q+  LN K+AEQK+++ EK+ +CE L+ EI+ +T  A  K+K+ EEK+ EI +Q+KVI  EK EAE AL+ A+P LEAAK  L +LDK+DVTEIR+FA PP+ VQ+V E + ++    EISWKSA+G+M+D +F+K L  +D +AI    + AV+  +     T+E++ A SKAG G LKF+ +V+G+ DVA+EI+PK+E+V  LER +  ++++LE++Q E+  ++ +LK L ++++ A  E ++L +E  +M+R+L+AA+KL  GL SE  RW +D+   +  RV LLGDCL+ SAFL+Y G F +++R  +V   W   + +  IP S+ F+I++LLT DVEIS+W S+GLP DELSIQN ILTT+++RFP+CIDPQ+QA+ WIK+     K+E  ++KIS+ ND  FL+ LE +IK+G P+LF+D DE++DPVIDNVL KNI  ++GR++++LGD+EVD++P F+LYL +KLSNPK+SPS++ +A +INYTVTL GLE QLLS +V  ERRELEE+RENLI ETSENK++LK+LED LL ELAT TGN+LDN EL++TLE+TKAKA +V+++L  +   + DI++ RDGYRPAAKRGA+LFFVL+ ++++N+MYQ+SL S+L VF  ++R+S+PD  L KRL NI+ TLT++VY YGCTG+FEKHK+L S  + +++E+  G +   E+DFF+KGNI++     +   +W+PD  W+D+ +LS   P  F  +   V   E EW+ WY L + E   +   Y +  + F+KL LLRC+R+DR+  A++D+VT  MG+++V PP+ +F A F  S P  PIV I+SPGSDP ++++KLA    F  +++K+L+MGQGQEK AL L +TAV RGQWLMLQN HLL+K++  +EK L+ + KPHPDFRLWLTT+P   FPIGILQKS K+V EPP+G+K N+  TY KI +E      H  ++  ++ LAF HA++QERR+FGKIGWN+ YDF ESDFQV ++IL TYLTKA ++  T +PW ++KYLIGEVMYGGRAIDSFDRRIL TYMDEY GDF+FD FQLFHFY+++ ++Y IP+      + K+ + E I+SLP   +P VFGLH NA IGY T   +++W +++ELQPQT     E+    S+++ + ++   I +KLP ++D+++I++NL     EISPTTVVLLQEL+RFN L+ +M  SL  L++AL GEVGMS ELD+++++L NG +PN WR LAP+T+K LG+W+ H  +R  QY +W+   + ++  +WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T+   R+ E +T     GC++ G+Y+EG  WD+ N C+I  K + L+  +P++++ PIE+H+ K  NT + PVY TS RRNAMG+GLV   DL TT+HNSHW+LQG+ LTLNSD
Sbjct: 2714 PTPSKFHYIFNLRDLSRVYNGLVLTTPERFQTVAQMVRVWRNENLRVFHDRLVNEEDK-LVQGHIKHLIEEHFQASLEHATRDPILFGDYRTAMSEGEPRVYEDIQDYEAAKALFQEILEEYNE-SKTKMNLVLFDDALEHLTRIHRIIRMDRGHALLVGVGGSGKQSLARLAAYAAGYEVFEIVLSRGYGENSFREDLRNLYIKLGLENKKMIFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLSQIRDEATKHGVGPAKESIWQFFVNKSANNLHIVLGMSPVGDTLRTRCRNFPGLVNNTGIDWFLPWPPQALYAVANSFLG-DNSLIPSQHSEPVTGHVVMVHDSVGKFSKKFQQKLRRSNYVTPKNYLDFINTYSRLLEEKNQYNLAQCKRLEGGLDKLKEATVQLAELNVKLAEQKVVLAEKSSACEALLDEISTNTTIAEEKRKLAEEKAAEIEEQNKVIAVEKQEAESALAEALPILEAAKLELQKLDKSDVTEIRSFAKPPRAVQVVCECILVMRGYKEISWKSAKGMMSDPSFLKSLMEIDFDAITQHQVKAVRGFLKTLNTTFEEMEAISKAGLGMLKFVEAVMGYCDVAKEIKPKREKVAKLERNYYMSKRDLEKIQAELSTIQNELKALGEKYEAAITEKQKLQEEAEVMERRLIAADKLISGLGSENKRWTNDLEELKVRRVKLLGDCLLCSAFLSYEGAFNWDFRKEMVYTEWQQDILAREIPLSQPFRIESLLTDDVEISRWGSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIKR-----KEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAQGRQFIILGDKEVDYDPNFKLYLNTKLSNPKYSPSVFGKAMVINYTVTLKGLEDQLLSVIVGFERRELEEQRENLIQETSENKKLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKAKATEVSEKLKLAEKTAVDIDKLRDGYRPAAKRGAILFFVLSEMALVNSMYQYSLSSFLAVFDHSLRKSLPDGILMKRLKNIMDTLTYNVYNYGCTGLFEKHKLLFSFNMTVKIEQADGRVPQEELDFFLKGNISLEKSKRKKPCSWIPDQGWEDIIRLSELFPSMFGSLPSDVERCEAEWKAWYDLDTLEQYPYPLGYNDKLSDFQKLLLLRCFRVDRVYRAVSDYVTVTMGEKYVQPPVISFEAIFEQSVPTSPIVFILSPGSDPASDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVFRGQWLMLQNCHLLVKWLKDLEKALEMIKKPHPDFRLWLTTDPTKEFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEALDSCQHSAFKSLVYVLAFFHAVVQERRKFGKIGWNVPYDFNESDFQVCMEILNTYLTKAFQQHDTKIPWGSLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFIFDTFQLFHFYKNEEVDYRIPE-----GTTKDAFVEAIESLPLANTPEVFGLHSNAEIGYYTQAARDMWTHLLELQPQTG----ESSTGISRDEYIGQVAKDIENKLPQIFDLDQIRKNL---GLEISPTTVVLLQELERFNKLIIRMSRSLVELQRALAGEVGMSSELDEVARALFNGQIPNIWRRLAPDTLKSLGNWMIHFRRRFNQYTSWVNESEPNV--MWLSGLHIPESYLTALVQATCRKNGWPLDRSTLYTQVTSF--RTPEEVTERPGQGCFISGLYLEGADWDIANSCLIKSKPKVLVVELPVLKVIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLYTTKHNSHWVLQGVCLTLNSD 4539          
BLAST of Dynein heavy chain vs. Ensembl Xenopus
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:100492440])

HSP 1 Score: 1900.18 bits (4921), Expect = 0.000e+0
Identity = 973/1850 (52.59%), Postives = 1341/1850 (72.49%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPK-FSDILDQVTNNEDEWRNWYKLQSPES-EFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+V+ GL  +T +RF    QM+R+WR+E LRVF+DR++  EDK +VQ  + ++++  F   + +   +PIL+GDY T   + EPR+YED+QDY   K+ FQE +E YNE  + +++LVLFDDALEHL  IHRI+RMD GHALLVGV GSGK+SL+RLAA+AA    FEI LS+GYGE  FREDL+ +Y KL  EN   +FLF D HVA+EGFLELINNMLT GMVP LF DDEKE +L  + D+  K G    KE IWQ+F       LHIVL MSPVG TLR RCRNFPG+VNNT IDWF PWP QAL++VA   +   N LIPSQ+ E V  HVV +H SV   S+ FQ KLRR NY+T  N++++I TY  LLE K+     + +RL  GLDKL+    Q+  LN K+AEQK+++ EK+ +CE L+ EI+ +T  A  K+K+ EEK+ EI +Q+KVI  EK EAE AL+ A+P LEAAK  L +LDK+DVTEIR+FA PP+ VQ+V E + ++    EISWKSA+G+M+D +F+K L  +D +AI    + AV+  +     T+E++ A SKAG G LKF+ +V+G+ DVA+EI+PK+E+V  LER +  ++++LE++Q E+  ++ +LK L ++++ A  E ++L +E  +M+R+L+AA+KL  GL SE  RW +D+   +  RV LLGDCL+ SAFL+Y G F +++R  +V   W   + +  IP S+ F+I++LLT DVEIS+W S+GLP DELSIQN ILTT+++RFP+CIDPQ+QA+ WIK+     K+E  ++KIS+ ND  FL+ LE +IK+G P+LF+D DE++DPVIDNVL KNI  ++GR++++LGD+EVD++P F+LYL +KLSNPK+SPS++ +A +INYTVTL GLE QLLS +V  ERRELEE+RENLI ETSENK++LK+LED LL ELAT TGN+LDN EL++TLE+TKAKA +V+++L  +   + DI++ RDGYRPAAKRGA+LFFVL+ ++++N+MYQ+SL S+L VF  ++R+S+PD  L KRL NI+ TLT++VY YGCTG+FEKHK+L S  + +++E+  G +   E+DFF+KGNI++     +   +W+PD  W+D+ +LS   P  F  +   V   E EW+ WY L + E   +   Y +  + F+KL LLRC+R+DR+  A++D+VT  MG+++V PP+ +F A F  S P  PIV I+SPGSDP ++++KLA    F  +++K+L+MGQGQEK AL L +TAV RGQWLMLQN HLL+K++  +EK L+ + KPHPDFRLWLTT+P   FPIGILQKS K+V EPP+G+K N+  TY KI +E      H  ++  ++ LAF HA++QERR+FGKIGWN+ YDF ESDFQV ++IL TYLTKA ++  T +PW ++KYLIGEVMYGGRAIDSFDRRIL TYMDEY GDF+FD FQLFHFY+++ ++Y IP+      + K+ + E I+SLP   +P VFGLH NA IGY T   +++W +++ELQPQT     E+    S+++ + ++   I +KLP ++D+++I++NL     EISPTTVVLLQEL+RFN L+ +M  SL  L++AL GEVGMS ELD+++++L NG +PN WR LAP+T+K LG+W+ H  +R  QY +W+   + ++  +WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T+   R+ E +T     GC++ G+Y+EG  WD+ N C+I  K + L+  +P++++ PIE+H+ K  NT + PVY TS RRNAMG+GLV   DL TT+HNSHW+LQG+ LTLNSD
Sbjct: 2657 PTPSKFHYIFNLRDLSRVYNGLVLTTPERFQTVAQMVRVWRNENLRVFHDRLVNEEDK-LVQGHIKHLIEEHFQASLEHATRDPILFGDYRTAMSEGEPRVYEDIQDYEAAKALFQEILEEYNE-SKTKMNLVLFDDALEHLTRIHRIIRMDRGHALLVGVGGSGKQSLARLAAYAAGYEVFEIVLSRGYGENSFREDLRNLYIKLGLENKKMIFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLSQIRDEATKHGVGPAKESIWQFFVNKSANNLHIVLGMSPVGDTLRTRCRNFPGLVNNTGIDWFLPWPPQALYAVANSFLG-DNSLIPSQHSEPVTGHVVMVHDSVGKFSKKFQQKLRRSNYVTPKNYLDFINTYSRLLEEKNQYNLAQCKRLEGGLDKLKEATVQLAELNVKLAEQKVVLAEKSSACEALLDEISTNTTIAEEKRKLAEEKAAEIEEQNKVIAVEKQEAESALAEALPILEAAKLELQKLDKSDVTEIRSFAKPPRAVQVVCECILVMRGYKEISWKSAKGMMSDPSFLKSLMEIDFDAITQHQVKAVRGFLKTLNTTFEEMEAISKAGLGMLKFVEAVMGYCDVAKEIKPKREKVAKLERNYYMSKRDLEKIQAELSTIQNELKALGEKYEAAITEKQKLQEEAEVMERRLIAADKLISGLGSENKRWTNDLEELKVRRVKLLGDCLLCSAFLSYEGAFNWDFRKEMVYTEWQQDILAREIPLSQPFRIESLLTDDVEISRWGSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIKR-----KEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAQGRQFIILGDKEVDYDPNFKLYLNTKLSNPKYSPSVFGKAMVINYTVTLKGLEDQLLSVIVGFERRELEEQRENLIQETSENKKLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKAKATEVSEKLKLAEKTAVDIDKLRDGYRPAAKRGAILFFVLSEMALVNSMYQYSLSSFLAVFDHSLRKSLPDGILMKRLKNIMDTLTYNVYNYGCTGLFEKHKLLFSFNMTVKIEQADGRVPQEELDFFLKGNISLEKSKRKKPCSWIPDQGWEDIIRLSELFPSMFGSLPSDVERCEAEWKAWYDLDTLEQYPYPLGYNDKLSDFQKLLLLRCFRVDRVYRAVSDYVTVTMGEKYVQPPVISFEAIFEQSVPTSPIVFILSPGSDPASDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVFRGQWLMLQNCHLLVKWLKDLEKALEMIKKPHPDFRLWLTTDPTKEFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEALDSCQHSAFKSLVYVLAFFHAVVQERRKFGKIGWNVPYDFNESDFQVCMEILNTYLTKAFQQHDTKIPWGSLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFIFDTFQLFHFYKNEEVDYRIPE-----GTTKDAFVEAIESLPLANTPEVFGLHSNAEIGYYTQAARDMWTHLLELQPQTG----ESSTGISRDEYIGQVAKDIENKLPQIFDLDQIRKNL---GLEISPTTVVLLQELERFNKLIIRMSRSLVELQRALAGEVGMSSELDEVARALFNGQIPNIWRRLAPDTLKSLGNWMIHFRRRFNQYTSWVNESEPNV--MWLSGLHIPESYLTALVQATCRKNGWPLDRSTLYTQVTSF--RTPEEVTERPGQGCFISGLYLEGADWDIANSCLIKSKPKVLVVELPVLKVIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLYTTKHNSHWVLQGVCLTLNSD 4482          
BLAST of Dynein heavy chain vs. Ensembl Xenopus
Match: DNAH10 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:100492440])

HSP 1 Score: 1899.4 bits (4919), Expect = 0.000e+0
Identity = 973/1850 (52.59%), Postives = 1341/1850 (72.49%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPK-FSDILDQVTNNEDEWRNWYKLQSPES-EFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+V+ GL  +T +RF    QM+R+WR+E LRVF+DR++  EDK +VQ  + ++++  F   + +   +PIL+GDY T   + EPR+YED+QDY   K+ FQE +E YNE  + +++LVLFDDALEHL  IHRI+RMD GHALLVGV GSGK+SL+RLAA+AA    FEI LS+GYGE  FREDL+ +Y KL  EN   +FLF D HVA+EGFLELINNMLT GMVP LF DDEKE +L  + D+  K G    KE IWQ+F       LHIVL MSPVG TLR RCRNFPG+VNNT IDWF PWP QAL++VA   +   N LIPSQ+ E V  HVV +H SV   S+ FQ KLRR NY+T  N++++I TY  LLE K+     + +RL  GLDKL+    Q+  LN K+AEQK+++ EK+ +CE L+ EI+ +T  A  K+K+ EEK+ EI +Q+KVI  EK EAE AL+ A+P LEAAK  L +LDK+DVTEIR+FA PP+ VQ+V E + ++    EISWKSA+G+M+D +F+K L  +D +AI    + AV+  +     T+E++ A SKAG G LKF+ +V+G+ DVA+EI+PK+E+V  LER +  ++++LE++Q E+  ++ +LK L ++++ A  E ++L +E  +M+R+L+AA+KL  GL SE  RW +D+   +  RV LLGDCL+ SAFL+Y G F +++R  +V   W   + +  IP S+ F+I++LLT DVEIS+W S+GLP DELSIQN ILTT+++RFP+CIDPQ+QA+ WIK+     K+E  ++KIS+ ND  FL+ LE +IK+G P+LF+D DE++DPVIDNVL KNI  ++GR++++LGD+EVD++P F+LYL +KLSNPK+SPS++ +A +INYTVTL GLE QLLS +V  ERRELEE+RENLI ETSENK++LK+LED LL ELAT TGN+LDN EL++TLE+TKAKA +V+++L  +   + DI++ RDGYRPAAKRGA+LFFVL+ ++++N+MYQ+SL S+L VF  ++R+S+PD  L KRL NI+ TLT++VY YGCTG+FEKHK+L S  + +++E+  G +   E+DFF+KGNI++     +   +W+PD  W+D+ +LS   P  F  +   V   E EW+ WY L + E   +   Y +  + F+KL LLRC+R+DR+  A++D+VT  MG+++V PP+ +F A F  S P  PIV I+SPGSDP ++++KLA    F  +++K+L+MGQGQEK AL L +TAV RGQWLMLQN HLL+K++  +EK L+ + KPHPDFRLWLTT+P   FPIGILQKS K+V EPP+G+K N+  TY KI +E      H  ++  ++ LAF HA++QERR+FGKIGWN+ YDF ESDFQV ++IL TYLTKA ++  T +PW ++KYLIGEVMYGGRAIDSFDRRIL TYMDEY GDF+FD FQLFHFY+++ ++Y IP+      + K+ + E I+SLP   +P VFGLH NA IGY T   +++W +++ELQPQT     E+    S+++ + ++   I +KLP ++D+++I++NL     EISPTTVVLLQEL+RFN L+ +M  SL  L++AL GEVGMS ELD+++++L NG +PN WR LAP+T+K LG+W+ H  +R  QY +W+   + ++  +WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T+   R+ E +T     GC++ G+Y+EG  WD+ N C+I  K + L+  +P++++ PIE+H+ K  NT + PVY TS RRNAMG+GLV   DL TT+HNSHW+LQG+ LTLNSD
Sbjct: 2585 PTPSKFHYIFNLRDLSRVYNGLVLTTPERFQTVAQMVRVWRNENLRVFHDRLVNEEDK-LVQGHIKHLIEEHFQASLEHATRDPILFGDYRTAMSEGEPRVYEDIQDYEAAKALFQEILEEYNE-SKTKMNLVLFDDALEHLTRIHRIIRMDRGHALLVGVGGSGKQSLARLAAYAAGYEVFEIVLSRGYGENSFREDLRNLYIKLGLENKKMIFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLSQIRDEATKHGVGPAKESIWQFFVNKSANNLHIVLGMSPVGDTLRTRCRNFPGLVNNTGIDWFLPWPPQALYAVANSFLG-DNSLIPSQHSEPVTGHVVMVHDSVGKFSKKFQQKLRRSNYVTPKNYLDFINTYSRLLEEKNQYNLAQCKRLEGGLDKLKEATVQLAELNVKLAEQKVVLAEKSSACEALLDEISTNTTIAEEKRKLAEEKAAEIEEQNKVIAVEKQEAESALAEALPILEAAKLELQKLDKSDVTEIRSFAKPPRAVQVVCECILVMRGYKEISWKSAKGMMSDPSFLKSLMEIDFDAITQHQVKAVRGFLKTLNTTFEEMEAISKAGLGMLKFVEAVMGYCDVAKEIKPKREKVAKLERNYYMSKRDLEKIQAELSTIQNELKALGEKYEAAITEKQKLQEEAEVMERRLIAADKLISGLGSENKRWTNDLEELKVRRVKLLGDCLLCSAFLSYEGAFNWDFRKEMVYTEWQQDILAREIPLSQPFRIESLLTDDVEISRWGSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIKR-----KEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGAQGRQFIILGDKEVDYDPNFKLYLNTKLSNPKYSPSVFGKAMVINYTVTLKGLEDQLLSVIVGFERRELEEQRENLIQETSENKKLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKAKATEVSEKLKLAEKTAVDIDKLRDGYRPAAKRGAILFFVLSEMALVNSMYQYSLSSFLAVFDHSLRKSLPDGILMKRLKNIMDTLTYNVYNYGCTGLFEKHKLLFSFNMTVKIEQADGRVPQEELDFFLKGNISLEKSKRKKPCSWIPDQGWEDIIRLSELFPSMFGSLPSDVERCEAEWKAWYDLDTLEQYPYPLGYNDKLSDFQKLLLLRCFRVDRVYRAVSDYVTVTMGEKYVQPPVISFEAIFEQSVPTSPIVFILSPGSDPASDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVFRGQWLMLQNCHLLVKWLKDLEKALEMIKKPHPDFRLWLTTDPTKEFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEALDSCQHSAFKSLVYVLAFFHAVVQERRKFGKIGWNVPYDFNESDFQVCMEILNTYLTKAFQQHDTKIPWGSLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFIFDTFQLFHFYKNEEVDYRIPE-----GTTKDAFVEAIESLPLANTPEVFGLHSNAEIGYYTQAARDMWTHLLELQPQTG----ESSTGISRDEYIGQVAKDIENKLPQIFDLDQIRKNL---GLEISPTTVVLLQELERFNKLIIRMSRSLVELQRALAGEVGMSSELDEVARALFNGQIPNIWRRLAPDTLKSLGNWMIHFRRRFNQYTSWVNESEPNV--MWLSGLHIPESYLTALVQATCRKNGWPLDRSTLYTQVTSF--RTPEEVTERPGQGCFISGLYLEGADWDIANSCLIKSKPKVLVVELPVLKVIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLYTTKHNSHWVLQGVCLTLNSD 4410          
BLAST of Dynein heavy chain vs. Ensembl Xenopus
Match: DNAH2 (dynein, axonemal, heavy chain 2 [Source:NCBI gene;Acc:100170584])

HSP 1 Score: 1066.6 bits (2757), Expect = 0.000e+0
Identity = 637/1869 (34.08%), Postives = 1014/1869 (54.25%), Query Frame = 1
Query:   73 IKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEF--PKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFF-QEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTN----WLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFI-DYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLI--KPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLD-SPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI--WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMG-IGLVTVLDL-ATTEHNSHWILQGIALTLNSD 5634
            I  + LPTP K HY  NLRD+SKVFQG+ ++  D       + RLW HEC RVF+DR++ + D +    IL   + + F    H       P ++GD+  E     P +YED+ D+  +K+F  ++  E       G   LVLF DA++H+  I R++    G+ LLVG+ GSG++SL+RLA++  D   F++ +++GY ++EFRED+K +Y     ++   +FL  D  +  E FLE +NN+L+ G VP L+  DE EE+   + +   +   P+  E ++ +        LHIVL MSPVG   RNR R +P +VN T IDWF  WP++AL  VA   ++             V    VT+HRSV   S   +L+LRR NYIT T+++  +  Y SLL  K  +L  K  +L  GL K++ T  ++  ++ ++A  +  V E    CE  ++ I     EA  ++K     S +I  +          A++ L  A+PALE A R+L+ L+K D+TEI+++  PP  V+ V + + ++L+  E +W  A+  + ++NFIK+L   D + I  + +  +           + +   S A      ++ ++  +  + R + PK+ R+     +  + +  L   Q ++R++  +L+ LK Q+D+   + E L  E  +M+ +L  A  L  GLA EK+RW   V G  ++   L+GDCL+ASA+L+Y+GPF   YR  ++ + W+  +R + +P S  F + N L+S   + +WN QGLP D  S  N ++ T+  R+P+ +DPQ QA KWIK ME      +K +K+ +L  + F+RTLE +++FG P L ++  E +DP +  +L+K++ K  G+  + LGD+++ + P FR Y+T+KLSNP ++P + S+A I+N+ V   GLE QLL ++V+ ER ELEE++++L+L  +  KR L+ELED++L  L   TG++LD+ +L+NTL+ +K  A +V++QL  S      I+  R+ YRP A+R ++LFFVL +L  I+ MYQFSL SY  +F  +I +S   +++ +R+ N+    T+ VY Y C  +FE+HK+L S Q+  ++ E  G +  +E +FF++G + ++    E + N    WL D +W ++ +L   +  F  I++       +W  WY    PES  +   ++   +  +++ ++R  R DR+   +T F+   +G +F  PP+    A    S P  P+V ++SPG DP   +++LA            LS+GQGQ   A  +    V  G W+ L N HL + ++  ++K ++ L    PHP+FRLWL++ P   FPI ILQ S K+  EPP G++ N+T  Y  I  + F   +    YR+ +F L F H++L ERR+F ++GWNI Y F +SDF+VS  +L  YL +  E      PW  +KYLI  V YGG   D +DRR+L TY+++YF +             D    YYIP +    S     Y E+I  LP    P  FG H NA I       + L+  ++ LQPQ      + G    +EKVL +++  +  K+P   D     + L   S + +P  VVLLQE+ R+N LL  +  SLN L++ + G V MS EL++I   + +  +P  W    P ++K L +W   L  R   +  W    K   P +  WLS    P  +LTA++Q A R+NN ++D+ +   I++  +D    NL    + G ++ G+Y+EG GWD KN C+I  +  QL+  +P +   P ES K  +      P Y    R  + G    V  +DL        HWI +G AL ++ D
Sbjct: 2508 ITQRFLPTPAKIHYLFNLRDISKVFQGMLRAQRDLHDTKQSITRLWVHECFRVFSDRLVDSSDADAFVAILSEKLGSLFNLTYHNLCPSKQPPVFGDFLRE-----PPVYEDITDFQALKTFMNRQLQEQSQRPGAGAKSLVLFTDAIQHVTRIVRVIGQPRGNMLLVGIGGSGRQSLARLASYICDYKVFQLEVTRGYRKQEFREDIKRLYRLAGVDDRPSVFLLTDTQITDESFLEDVNNILSSGEVPNLYKADEFEEIKSALSEKAREQNIPDTPESLFNFLIERVRNNLHIVLCMSPVGDPFRNRIRQYPALVNCTTIDWFSEWPQEALLEVAERYLEGVQLGAIDGIQGKVARIFVTMHRSVAEFSHRMKLELRRHNYITPTSYLEVVSRYKSLLAEKRKELGDKATKLRNGLFKIDETREKVEKMSEQLAVARSKVAEFQKQCEEYLVIIVQQRREADEQQKTVAAHSEKIAAEEIKCKALAENAQKDLEEALPALEEAMRALESLNKKDMTEIKSYGRPPALVETVMQAV-MILRGNEPTWAEAKRQLGESNFIKQLIHFDKDNISDRVLKKIGQYCILPDFQPDIIGKVSLAARSLCMWVRAMEVYGRLFRVVEPKRARMNAAMNQLAEKQASLAEAQNKLREVAERLEQLKTQYDEKLAQKEALRAEAELMELKLQRAGTLVTGLAGEKSRWEETVKGLDEDLGFLVGDCLLASAYLSYMGPFLSSYREGIL-SIWIKEVREMLVPCSAVFSLTNFLSSPTMVREWNLQGLPSDSFSSDNGVIVTRGNRWPLMVDPQGQATKWIKSME-----SAKGLKVIDLQMTDFMRTLEQAVQFGFPVLLQNVQEELDPSLAPILNKSVTKVGGQLQIRLGDKDIVYNPEFRFYITTKLSNPHYTPEISSQATIVNFAVKEQGLEAQLLGSVVRKERPELEEQKQSLVLNIAAGKRKLQELEDEILRLLNEATGSLLDDVQLLNTLQTSKVTATEVSEQLESSEETEEKIDTAREAYRPCAQRASLLFFVLNDLGRIDPMYQFSLDSYTDLFHLSIDKSKRSANVEERIANLNDWHTYAVYRYTCRALFERHKLLFSFQMCAKILEVAGKLNMDEYNFFLRGGVVLDR--EEQMDNPCSAWLSDTNWDNITELD-KLANFHGIMNSFEQYPRDWHQWYTSPEPESACLPGEWENSCSEIQRMLIVRSLRQDRVAFCVTSFIINNLGSKFTEPPVLDMRAVVEDSLPRSPLVFVLSPGVDPTGALLQLAEQCGM-AQNFHALSLGQGQAPIATRMIKEGVKDGHWVFLANCHLSLSWMPQLDKLVEQLQIEDPHPNFRLWLSSSPHPDFPISILQASIKMTTEPPKGLRANMTRLYQLITEQQFSHCAKSSSYRRLLFSLCFFHSVLLERRKFLQLGWNIVYGFNDSDFEVSENLLSLYLDEYEE-----TPWEALKYLIAGVNYGGHVTDDWDRRLLSTYINDYFSEPALTNQFYRLSSLDT---YYIPRDGPLAS-----YKEFISLLPAADHPEAFGQHPNADIASQITEARTLFDTLLSLQPQITPSA-QGGGQTREEKVL-DLLSDVREKIPPEIDYEGTCKVL---SGDPNPLNVVLLQEIQRYNALLDTIRTSLNDLERGIQGLVVMSAELEEIFTCIYDARVPPLWEKAYP-SLKPLAAWTRDLVLRVELFSRW---AKTAHPPVLFWLSAFTFPTGFLTAVLQSAARQNNVSVDSLSWEFIVSTVDD---NNLVYPPKDGVWIRGLYLEGAGWDKKNSCLIEAEPMQLVCPLPTVHFRPTESRKKSSKGLYSCPCYYYPVRAGSSGRASFVIGVDLRCGAAPAEHWIKRGTALLMSLD 4335          
BLAST of Dynein heavy chain vs. Ensembl Xenopus
Match: asxl2 (ASXL transcriptional regulator 2 [Source:Xenbase;Acc:XB-GENE-996283])

HSP 1 Score: 987.638 bits (2552), Expect = 0.000e+0
Identity = 629/1897 (33.16%), Postives = 1011/1897 (53.29%), Query Frame = 1
Query:   61 ILREIKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHM--PYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWD--DGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVA---CYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKP----HPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDS-PHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLY---SSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLT-TIITNEEDRSS-----ENLTISSEL-----------GCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIG------LVTVLDLATTEHNSHWILQGIALTLNSDD 5637
            I   + + +LPTP K HY  NLRDLSK  QG+ Q          Q+ RL+ HEC R+F+DR+I NEDK+    +L  +    F   +   Y    PI++GD+    +D   ++YEDL D   IKS  Q++++ YN  +   + LV F DA+EH++ I R++R + G+ALLVGV G+GK+SL+RLAA       F+I LS+GY    F EDL+ +Y     E+ + +FLF D  V+      LI    T           E+ +LL+  +     + S Y      ++QYF +    +LHIVL MSPVG   R RCR FP +VN   IDWF  WP++AL SV+      ID  +  + +++ E      V IH SV   ++ +  +LRR  Y T T+++  I  YLS+L  K   L + R R+  GL KL  T   +  +  +++  + ++++K++  + LM ++++  E A   +++ +E       +++       +A+  L  AMPALEAA ++LD LDK D++EIR F  PP  V  V E +C++L + +  W +A+ L+ D+NF+K L   D E I  + +  ++  +       E V   SKA      ++ ++  +  V +++ PKK+++   + E +     L   Q++++ +E Q+K L+ Q+D +  E E L K MA+ Q +L  A KLT  L  E+ RW   +A F++E  N++G+  IA+A + Y G FT  YR  LV+  W+   + + IP S NF + N+L    EI +WN+ GLP D +S +N IL T+  R+P+ IDPQ+QA +WI+      K+    +K+  L D+ FLRTLEN+I+ GLP L E+  E +DP ++ +LSK    S GR  + LGD ++D++  FR Y+T+K+ NP + P +  +  IIN+TVT SGLE QLLS +V+ ER +LEE+R  LI+  + +K  LK +ED++L  L T  GNILDN +LINTL+++K  +  +  +L ++     +I   R+ YRP A +G+V++FV+ +LS I+ MYQ+SL  +  +F   I  +   + L  RL  +++   F  Y     G+FE+HK++ S  + + +    G I+  E +FF++G   ++   P       PD            +P  S                           DYY    + F    +L    I+ +  A+T+FV   +GK+F+  P       +   +P  P++ I+S GSDP     + A    +   +++ +S+GQGQ   A  +   A+  G W+ LQN HL + ++  +E+ +    +P    + +FRL+L++ P  TFP+ +LQ S K+  EPP G++ N+   + +I    F +     K+R+ IF + F HAI+QER++FG +GWNI Y+F +SD + +L  L  Y       ++  +PW+ + Y+ GE+ YGGR  D++D+R L+T +  +   F  +  +  + Y    I Y+ PD      SL+  + +YI++LP    P +FG+HENA + +    T  L   ++++QP++  +    G   S ++++ E+   IL KLP   D+ ++   +L+   +   ++  T VL QE+DRFN LLK +  SL TL KA+ G V MS E++ I KS  N  +P  W   A  ++K LGSW++ L  R    + WI  G+    S W+SGL  PQ +LT  +Q   R+ N A+D       ++    D+++     + L    EL           G  V G+Y++ C WD +   I     RQ+   +P+I   P +++   + +  Q P+Y TS R   +         +VTVL L +   N +WI +G AL    +D
Sbjct: 2138 IYHRMSIDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGSVRDKTQIFRLFCHECQRIFHDRLINNEDKQYFHEMLSEMASKHFAVQIDPEYFVTKPIIFGDFTKVGVDKADKVYEDLTDMEKIKSVLQDYLDDYNLTNAKDVKLVFFQDAVEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCFQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQVS------LILQTSTC----------EQGKLLVSSFSLLPCSSSSY-----YVFQYFISRVRQKLHIVLCMSPVGEAFRARCRMFPSLVNCCTIDWFVQWPKEALLSVSQKFFINIDLGSEGMKAKFSEMC----VEIHMSVNTMAEKYYSELRRRYYTTPTSYLELINLYLSMLGEKRNQLVSARDRVKNGLSKLLETNVLVDKMKVELSALEPVLKQKSVDVDALMEKLSVDQENADQVRRIVKEDEAVAKVKAEETQAIADDAQRDLDEAMPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAICILL-NAKPDWSAAKQLLGDSNFLKRLLEYDKENIKPQILLKLQKYVNNPDFVPEKVEKVSKACRSMCMWVRAMDLYSRVLKDVEPKKQKLAAAQAELDATMSTLRDKQQKLKSVEEQIKALQDQYDKSLSEKESLAKTMALTQARLNRAGKLTSALGDEQVRWKESIANFEEEISNVIGNVFIAAACVAYFGAFTAVYRQLLVD-CWINKCQELEIPISPNFSLINILGDAYEIRQWNTDGLPRDHISTENGILVTRGRRWPLMIDPQDQANRWIRN-----KENKNGLKVIKLTDAGFLRTLENAIRLGLPVLLEELKETLDPALEPILSKQTFTSGGRTLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTRSGLEDQLLSDVVRIERPDLEEQRNQLIIRINSDKNQLKAIEDRILKLLFTSEGNILDNEDLINTLQESKITSGAIKTRLLEAEATEENINTAREKYRPVATQGSVIYFVIASLSEIDPMYQYSLKYFKQLFNMTIEAAEKSNDLDIRLATLLSQTLFSAYTNVSRGLFEQHKLIYSFMLCVEIMRHKGEISETEWNFFLRGAAGLDKERPTK-----PD------------VPGLS---------------------------DYYL---SIFYARIMLLGHSINVV-FAVTEFVINTLGKKFIENPPIDLATLYQDMSPSTPLIFILSTGSDPMGAFQRFAKERGYS-ERVQSISLGQGQGPIAEKMIKDAMKTGHWIFLQNCHLAVSWMLPMEELIKSFTEPNVSINENFRLFLSSMPSRTFPVTVLQNSVKVTNEPPKGLRANVRRAFTEITTTFFEEHLLGRKWRKVIFGICFFHAIVQERKKFGPLGWNICYEFNDSDRECALLNLNLYC------QEGKIPWDALLYITGEITYGGRVTDAWDQRCLRTILRRF---FSPETLEDNYCYSTSGI-YFSPD----ADSLQS-FKDYIENLPLTDDPEIFGMHENANLAFQRKETNTLINTILDVQPRSTTQ----GGGKSNDEIVRELATSILSKLPDKLDM-EVASEMLFVKDAKGRVNSLTTVLGQEVDRFNKLLKVLKNSLETLNKAIAGLVVMSEEMEKIYKSFLNSQVPTLWSDAAYPSLKPLGSWVKDLVMRISFIDAWIRIGQPK--SFWISGLFFPQGFLTGTLQNHARKYNLAIDELNFHYNVLPQYRDQATVTEAMKTLKFGEELPMDAVLPAPEDGVLVHGMYMDACRWDDEAMVIEDALPRQMNPMLPVIHFEPHQNYN-PSGDLYQAPLYKTSARAGTLSTTGHSTNFVVTVL-LPSNRQNDYWISKGSALLCQLND 3929          
BLAST of Dynein heavy chain vs. Ensembl Mouse
Match: Dnah10 (dynein, axonemal, heavy chain 10 [Source:MGI Symbol;Acc:MGI:1860299])

HSP 1 Score: 1833.92 bits (4749), Expect = 0.000e+0
Identity = 952/1854 (51.35%), Postives = 1314/1854 (70.87%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQ----VTNNEDEWRNWYKLQSPES-EFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI-WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+VF GL  +  DRF   +QM+R+WR+ECLRVF+DR+I   DKE+VQ  + N++   F      V  +PIL+GD+     + EPR+YED+QDY   K+ F+E +E YNE++  +++LVLFDDALEHL  +HRI+RMD GHALLVGV GSGK+SL+RLAAF A    FEI LS+GY E  FR+DLK +Y KL  EN   +FLF D HVA+EGFLELINNMLT GMVP LF ++EK+ +L  +  +  K G    KE +WQ+F       LHIVL MSPVG TLR RCRNFPG+VNNT IDWF PWP QAL +VA   +   N +IP +  E ++ HVV +H+SV   S+ FQ KLRR NY+T  N++++I TY  LL+ K      + +RL  GLDKL+    Q+  LN K+AEQKI++ EK+ +CE L+ EI  +T  A  KKK+ EEK++EI +Q+K+I  EK EAE AL+  MP LEAAK  L +LDK+DVTEIR+FA PPK VQ V E + ++    E++WK+A+G+M+D NF++ L  +D ++I    +  +K  +     T E++ A SKAG G LKF+ +V+G+ DV REI+PK+E+V  LER F   ++ELER+Q E+  ++ +L+ L  +++ A  E ++L +E  IM+R+L+AA+KL  GL SE  RW++D+      RV LLGDCL+ +AFL+Y G FT+E+R  +V   W   +   +IP S+ F+++NLLT DVEIS+W SQGLP DELS+QN ILTT+++RFP+CIDPQ+QA+ WIK+     K+E  ++++++ ND  FL+ LE SIK+G P+LF D DE++DPVID+VL KNI  S+GR++++LGD+EVD++  FRLYL +KL+NP++SPS++ +A +INYTVTL GLE QLLS LV  ERRELEE+RE+LI ETSENK +LK+LED LL ELAT TGN+LDN EL+ TLE+TK+KA +V+++L  +   + DI+R RDGYRPAA+RGA+LFFVL+ ++++N+MYQ+SL ++L VF  ++++S+PDS L KRL NI+ TLTF++Y YGCTG+FE+HK+L S  + +++E+  G +   E+DFF+KGNI++     +    WL D  W+D+  LS    KFSDI       + ++   W+ WY   S E   F   Y +   +F+KL +LRC+R+DR+  A+TD+VT  MG+++V PP+ +F A F  STP  PIV I+SPGSDP ++++KLA    F   ++K+L+MGQGQEK AL L +TAV+RGQWLMLQN HLL+K++  +EK L+ + KPHPDFRLWLTT+P   FPIGILQKS K+V EPP+G+K N+  TY KI N++    PH  ++  ++ LAF HA++QERR+FGKIGWN+ YDF ESDFQV ++IL TYLTKA +++   +PW ++KYLIGEVMYGGRAIDSFDRRIL TYMDEY GDF+FD FQ FHF+ +  ++Y IP        +K+ + E I++LP   +P VFGLH NA IGY T   +++W +++ELQPQT     E+    S++  + ++   I +K+P ++D+++++++L  S   I+PT+VVLLQEL RFN L+ +M  SL  L++AL GEVGMS ELDD+++SL  G +P+ WR LAP+T+K LG+W+ +  +R  QY  W+  G+   PS+ WLSGLH+P+SYLTALVQ  CRRN W LD  TL T +T  +D    N       GC+V G+Y+EG  WD++ GC++  K + L+  +PI+++ P E H+ K  NT + PVY TS RRNAMGIGLV   DL T +H SHW+LQG+ LTLNSD
Sbjct: 2765 PTPSKFHYIFNLRDLSRVFNGLVLTNPDRFQTVSQMVRVWRNECLRVFHDRLINEVDKELVQNHIGNLVTEHFNDDFEMVMRDPILFGDFRLALQEGEPRIYEDIQDYEAAKALFEEILEEYNEVNT-KMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLARLAAFTAGCEVFEILLSRGYSENNFRDDLKNLYMKLGLENKMMIFLFTDAHVAEEGFLELINNMLTSGMVPALFAEEEKDNILGQIGQEALKFGMGPAKESVWQFFVNKSANNLHIVLGMSPVGDTLRTRCRNFPGLVNNTGIDWFMPWPPQALHAVAKSFLG-DNSMIPDEKLEELVEHVVMVHQSVGEFSKQFQQKLRRSNYVTPKNYLDFINTYSKLLDEKTQYNIAQCKRLEGGLDKLKEATIQLDELNLKLAEQKIVLAEKSAACEALLEEIATNTAIAEEKKKLAEEKAIEIEEQNKIIAVEKAEAETALAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKGYKELNWKTAKGMMSDPNFLRSLMEIDFDSITQGQVKNIKGLLKTLNTTIEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFFLTKRELERIQNELAAIQKELEALGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENVRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNQVWQNDILDRDIPLSQPFRLENLLTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKR-----KEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFHDVDEYIDPVIDSVLEKNIKTSQGRQFIILGDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVELVQTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFGLSLKKSLPDSILLKRLKNIMDTLTFNIYNYGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGNISLEKSKWKKPCTWLSDQGWEDIILLS---QKFSDIFGNLPLDIEHHLPMWQEWYDQDSLEQFPFPLGYDDNITAFQKLLILRCFRVDRVYRAVTDYVTLTMGEKYVQPPMISFEAIFEQSTPNSPIVFILSPGSDPASDLMKLAERSGFGGTRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISNDMLEQCPHTAFKPLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFIFDTFQPFHFFRNKDVDYKIP-----VGDIKDKFVEAIEALPLANTPEVFGLHSNAEIGYYTQAARDMWGHLLELQPQTG----ESSSGVSRDDYIGQVAKDIENKMPKIFDLDQVRKHLGLS---ITPTSVVLLQELGRFNKLVIRMTRSLAELQRALAGEVGMSNELDDVARSLFLGHIPHIWRKLAPDTLKTLGNWMVYFLRRFSQYTLWVTEGE---PSVMWLSGLHIPESYLTALVQATCRRNGWPLDRSTLFTQVTKFQDADEVNERAGQ--GCFVSGLYLEGADWDIERGCLVKSKPKVLVVDLPILKIIPTEGHRLKLQNTFRTPVYTTSMRRNAMGIGLVFEADLFTAKHISHWVLQGVCLTLNSD 4591          
BLAST of Dynein heavy chain vs. Ensembl Mouse
Match: Dnah10 (dynein, axonemal, heavy chain 10 [Source:MGI Symbol;Acc:MGI:1860299])

HSP 1 Score: 1833.54 bits (4748), Expect = 0.000e+0
Identity = 952/1854 (51.35%), Postives = 1314/1854 (70.87%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQ----VTNNEDEWRNWYKLQSPES-EFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI-WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+VF GL  +  DRF   +QM+R+WR+ECLRVF+DR+I   DKE+VQ  + N++   F      V  +PIL+GD+     + EPR+YED+QDY   K+ F+E +E YNE++  +++LVLFDDALEHL  +HRI+RMD GHALLVGV GSGK+SL+RLAAF A    FEI LS+GY E  FR+DLK +Y KL  EN   +FLF D HVA+EGFLELINNMLT GMVP LF ++EK+ +L  +  +  K G    KE +WQ+F       LHIVL MSPVG TLR RCRNFPG+VNNT IDWF PWP QAL +VA   +   N +IP +  E ++ HVV +H+SV   S+ FQ KLRR NY+T  N++++I TY  LL+ K      + +RL  GLDKL+    Q+  LN K+AEQKI++ EK+ +CE L+ EI  +T  A  KKK+ EEK++EI +Q+K+I  EK EAE AL+  MP LEAAK  L +LDK+DVTEIR+FA PPK VQ V E + ++    E++WK+A+G+M+D NF++ L  +D ++I    +  +K  +     T E++ A SKAG G LKF+ +V+G+ DV REI+PK+E+V  LER F   ++ELER+Q E+  ++ +L+ L  +++ A  E ++L +E  IM+R+L+AA+KL  GL SE  RW++D+      RV LLGDCL+ +AFL+Y G FT+E+R  +V   W   +   +IP S+ F+++NLLT DVEIS+W SQGLP DELS+QN ILTT+++RFP+CIDPQ+QA+ WIK+     K+E  ++++++ ND  FL+ LE SIK+G P+LF D DE++DPVID+VL KNI  S+GR++++LGD+EVD++  FRLYL +KL+NP++SPS++ +A +INYTVTL GLE QLLS LV  ERRELEE+RE+LI ETSENK +LK+LED LL ELAT TGN+LDN EL+ TLE+TK+KA +V+++L  +   + DI+R RDGYRPAA+RGA+LFFVL+ ++++N+MYQ+SL ++L VF  ++++S+PDS L KRL NI+ TLTF++Y YGCTG+FE+HK+L S  + +++E+  G +   E+DFF+KGNI++     +    WL D  W+D+  LS    KFSDI       + ++   W+ WY   S E   F   Y +   +F+KL +LRC+R+DR+  A+TD+VT  MG+++V PP+ +F A F  STP  PIV I+SPGSDP ++++KLA    F   ++K+L+MGQGQEK AL L +TAV+RGQWLMLQN HLL+K++  +EK L+ + KPHPDFRLWLTT+P   FPIGILQKS K+V EPP+G+K N+  TY KI N++    PH  ++  ++ LAF HA++QERR+FGKIGWN+ YDF ESDFQV ++IL TYLTKA +++   +PW ++KYLIGEVMYGGRAIDSFDRRIL TYMDEY GDF+FD FQ FHF+ +  ++Y IP        +K+ + E I++LP   +P VFGLH NA IGY T   +++W +++ELQPQT     E+    S++  + ++   I +K+P ++D+++++++L  S   I+PT+VVLLQEL RFN L+ +M  SL  L++AL GEVGMS ELDD+++SL  G +P+ WR LAP+T+K LG+W+ +  +R  QY  W+  G+   PS+ WLSGLH+P+SYLTALVQ  CRRN W LD  TL T +T  +D    N       GC+V G+Y+EG  WD++ GC++  K + L+  +PI+++ P E H+ K  NT + PVY TS RRNAMGIGLV   DL T +H SHW+LQG+ LTLNSD
Sbjct: 2708 PTPSKFHYIFNLRDLSRVFNGLVLTNPDRFQTVSQMVRVWRNECLRVFHDRLINEVDKELVQNHIGNLVTEHFNDDFEMVMRDPILFGDFRLALQEGEPRIYEDIQDYEAAKALFEEILEEYNEVNT-KMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLARLAAFTAGCEVFEILLSRGYSENNFRDDLKNLYMKLGLENKMMIFLFTDAHVAEEGFLELINNMLTSGMVPALFAEEEKDNILGQIGQEALKFGMGPAKESVWQFFVNKSANNLHIVLGMSPVGDTLRTRCRNFPGLVNNTGIDWFMPWPPQALHAVAKSFLG-DNSMIPDEKLEELVEHVVMVHQSVGEFSKQFQQKLRRSNYVTPKNYLDFINTYSKLLDEKTQYNIAQCKRLEGGLDKLKEATIQLDELNLKLAEQKIVLAEKSAACEALLEEIATNTAIAEEKKKLAEEKAIEIEEQNKIIAVEKAEAETALAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKGYKELNWKTAKGMMSDPNFLRSLMEIDFDSITQGQVKNIKGLLKTLNTTIEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFFLTKRELERIQNELAAIQKELEALGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENVRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNQVWQNDILDRDIPLSQPFRLENLLTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKR-----KEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFHDVDEYIDPVIDSVLEKNIKTSQGRQFIILGDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVELVQTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFGLSLKKSLPDSILLKRLKNIMDTLTFNIYNYGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGNISLEKSKWKKPCTWLSDQGWEDIILLS---QKFSDIFGNLPLDIEHHLPMWQEWYDQDSLEQFPFPLGYDDNITAFQKLLILRCFRVDRVYRAVTDYVTLTMGEKYVQPPMISFEAIFEQSTPNSPIVFILSPGSDPASDLMKLAERSGFGGTRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISNDMLEQCPHTAFKPLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFIFDTFQPFHFFRNKDVDYKIP-----VGDIKDKFVEAIEALPLANTPEVFGLHSNAEIGYYTQAARDMWGHLLELQPQTG----ESSSGVSRDDYIGQVAKDIENKMPKIFDLDQVRKHLGLS---ITPTSVVLLQELGRFNKLVIRMTRSLAELQRALAGEVGMSNELDDVARSLFLGHIPHIWRKLAPDTLKTLGNWMVYFLRRFSQYTLWVTEGE---PSVMWLSGLHIPESYLTALVQATCRRNGWPLDRSTLFTQVTKFQDADEVNERAGQ--GCFVSGLYLEGADWDIERGCLVKSKPKVLVVDLPILKIIPTEGHRLKLQNTFRTPVYTTSMRRNAMGIGLVFEADLFTAKHISHWVLQGVCLTLNSD 4534          
BLAST of Dynein heavy chain vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 1102.04 bits (2849), Expect = 0.000e+0
Identity = 657/1865 (35.23%), Postives = 1024/1865 (54.91%), Query Frame = 1
Query:   82 KMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQIN--PILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYN-ELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININH--VFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFI-DYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLI--KPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHP-KYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIG--SKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI-WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMG-IGLVTVLDLATTEHNS-HWILQGIALTLNSD 5634
            + LPTP K HY  NLRD+SKVFQG+ ++  D       + RLW HEC RVF+DR++   D E    IL + +   F     ++  N  P ++GD+  E     P++YEDL D  V+K+  +  +  YN       + LVLF +A+EH+  I R++    G+ LLVG+ GSG++SL+RLA+   D + F+I ++K Y ++EFR+D+K +Y +   E     FLF D  +A E FLE INN+L+ G VP L+  DE EE+  H+ D       PE+ + ++ Y        LHIVL +SPVG   RN  R +P +VN T I+WF  WP +AL  VA   I   +          V    VT+H SV   SQ   L+LRR NY+T TN++  +  Y  LL  K  +L  +  +L  GL K++ T  ++ +++ ++ + K  V E    CE  ++ I     EA  ++K     S +I  +          A++ L  A+PALE A R+L+ L+K D+ EI+++  PP  V+IV + + ++L+  E +W  A+  + + NFIK L   D + I  K +  +    A+     + +   S A      ++ ++  +  + R + PK+ R+     +  + +  L   QE++R++  +L+ LKKQ+D+   + E L K+   M+ +L  A  L  GLA EK RW   V G +++   L+GDCLIA+AFL+Y+GPF   YR  ++   W+  +R + +P S  F I N LT+  ++  WN QGLP D  S +N I+ T+  R+ + IDPQ QA+KWIK ME N     + +KI +L    +LR LE++I+FG P L ++  E++DP ++ VL+K++ +  GR  + +GD+EV++ P FR YLT+KLSNP ++P   ++  I+N+ V   GLE QLL  +V+ ER ELEE++++L++  +  KR LKELED++L  L   TG++LD+ +L+NTL+ +K  A +V +QL  S     +I+  R+ YRP A+R +VLFFVL ++  I+ MYQFSL +Y+ +F+ +I +S   + L  R+  +    T+ VY Y C  +FE+HK+L S  +  ++ E  G +  +E +FF++G + ++         T+WL D  W ++ +L   +  F  +++       +W  WY   SPE   +   ++   N  +++ ++R  R DR+   +T F+ + +G  F+ PP+    +    STP  P+V I+SPG DP + +++LA       H+   LS+GQGQ   A  L    V++G W+ L N HL + ++  ++K ++ L    PHP FRLWL++ P   FPI ILQ S K+  EPP G+K N+T  Y  +    F     P KY++ +F L F H+IL ER++F ++GWNI Y F +SDF+VS  +L  YL +  E      PW+ +KYLI  V YGG   D +DRR+L TY+++YF D             D    YYIP +    S     Y EYI  LP    P  FG H NA +       + L++ ++ LQPQ         R+G  S+E+ + E+   +  K+P + D    ++ L   + + SP  VVLLQE+ R+N L+K +  SL  L+K + G + MS  L++I   + +  +P  W  + P + K L SW   L  R  Q+ETW  A +   P + WLSG   P  +LTA++Q A R+NN ++D+ +   I++  +D    NL    + G +V G+Y+EG GWD KN C++  +  QL+  MP I   P ES K         P Y    R  +      V  +DL +    S HWI +G AL ++ D
Sbjct: 2631 RFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFGDFLKE-----PKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAV-MILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGN-----QGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELD-KLTNFHGLMNSFEQYPRDWHLWYTNSSPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDSTPRSPLVFILSPGVDPTSALLQLAEHTGMA-HRFHALSLGQGQAPIAARLLREGVNQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSSPHPDFPISILQASIKMTTEPPKGLKANMTRLYQLMTEAQFTHCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEE-----TPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTTPFYRLSVLDT---YYIPKDGSLAS-----YKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQ-----ITPTRVGGQSREEKVLELAADVKQKIPEMIDYEGTRKLL---ALDPSPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKVYP-SQKPLASWTRDLAVRVEQFETW--ASRARPPVLFWLSGFTFPTGFLTAVLQSAARQNNISVDSLSWEFIVSTVDD---SNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSTDRASFVIGIDLRSGSMTSDHWIKRGTALLMSLD 4455          
BLAST of Dynein heavy chain vs. Ensembl Mouse
Match: Dnah2 (dynein, axonemal, heavy chain 2 [Source:MGI Symbol;Acc:MGI:107731])

HSP 1 Score: 1101.27 bits (2847), Expect = 0.000e+0
Identity = 657/1865 (35.23%), Postives = 1024/1865 (54.91%), Query Frame = 1
Query:   82 KMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQIN--PILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYN-ELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININH--VFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFI-DYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLI--KPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHP-KYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIG--SKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI-WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMG-IGLVTVLDLATTEHNS-HWILQGIALTLNSD 5634
            + LPTP K HY  NLRD+SKVFQG+ ++  D       + RLW HEC RVF+DR++   D E    IL + +   F     ++  N  P ++GD+  E     P++YEDL D  V+K+  +  +  YN       + LVLF +A+EH+  I R++    G+ LLVG+ GSG++SL+RLA+   D + F+I ++K Y ++EFR+D+K +Y +   E     FLF D  +A E FLE INN+L+ G VP L+  DE EE+  H+ D       PE+ + ++ Y        LHIVL +SPVG   RN  R +P +VN T I+WF  WP +AL  VA   I   +          V    VT+H SV   SQ   L+LRR NY+T TN++  +  Y  LL  K  +L  +  +L  GL K++ T  ++ +++ ++ + K  V E    CE  ++ I     EA  ++K     S +I  +          A++ L  A+PALE A R+L+ L+K D+ EI+++  PP  V+IV + + ++L+  E +W  A+  + + NFIK L   D + I  K +  +    A+     + +   S A      ++ ++  +  + R + PK+ R+     +  + +  L   QE++R++  +L+ LKKQ+D+   + E L K+   M+ +L  A  L  GLA EK RW   V G +++   L+GDCLIA+AFL+Y+GPF   YR  ++   W+  +R + +P S  F I N LT+  ++  WN QGLP D  S +N I+ T+  R+ + IDPQ QA+KWIK ME N     + +KI +L    +LR LE++I+FG P L ++  E++DP ++ VL+K++ +  GR  + +GD+EV++ P FR YLT+KLSNP ++P   ++  I+N+ V   GLE QLL  +V+ ER ELEE++++L++  +  KR LKELED++L  L   TG++LD+ +L+NTL+ +K  A +V +QL  S     +I+  R+ YRP A+R +VLFFVL ++  I+ MYQFSL +Y+ +F+ +I +S   + L  R+  +    T+ VY Y C  +FE+HK+L S  +  ++ E  G +  +E +FF++G + ++         T+WL D  W ++ +L   +  F  +++       +W  WY   SPE   +   ++   N  +++ ++R  R DR+   +T F+ + +G  F+ PP+    +    STP  P+V I+SPG DP + +++LA       H+   LS+GQGQ   A  L    V++G W+ L N HL + ++  ++K ++ L    PHP FRLWL++ P   FPI ILQ S K+  EPP G+K N+T  Y  +    F     P KY++ +F L F H+IL ER++F ++GWNI Y F +SDF+VS  +L  YL +  E      PW+ +KYLI  V YGG   D +DRR+L TY+++YF D             D    YYIP +    S     Y EYI  LP    P  FG H NA +       + L++ ++ LQPQ         R+G  S+E+ + E+   +  K+P + D    ++ L   + + SP  VVLLQE+ R+N L+K +  SL  L+K + G + MS  L++I   + +  +P  W  + P + K L SW   L  R  Q+ETW  A +   P + WLSG   P  +LTA++Q A R+NN ++D+ +   I++  +D    NL    + G +V G+Y+EG GWD KN C++  +  QL+  MP I   P ES K         P Y    R  +      V  +DL +    S HWI +G AL ++ D
Sbjct: 2637 RFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFGDFLKE-----PKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAV-MILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGN-----QGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELD-KLTNFHGLMNSFEQYPRDWHLWYTNSSPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDSTPRSPLVFILSPGVDPTSALLQLAEHTGMA-HRFHALSLGQGQAPIAARLLREGVNQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSSPHPDFPISILQASIKMTTEPPKGLKANMTRLYQLMTEAQFTHCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEE-----TPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTTPFYRLSVLDT---YYIPKDGSLAS-----YKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQ-----ITPTRVGGQSREEKVLELAADVKQKIPEMIDYEGTRKLL---ALDPSPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKVYP-SQKPLASWTRDLAVRVEQFETW--ASRARPPVLFWLSGFTFPTGFLTAVLQSAARQNNISVDSLSWEFIVSTVDD---SNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSTDRASFVIGIDLRSGSMTSDHWIKRGTALLMSLD 4461          
BLAST of Dynein heavy chain vs. Ensembl Mouse
Match: Dnah8 (dynein, axonemal, heavy chain 8 [Source:MGI Symbol;Acc:MGI:107714])

HSP 1 Score: 1022.31 bits (2642), Expect = 0.000e+0
Identity = 616/1881 (32.75%), Postives = 1017/1881 (54.07%), Query Frame = 1
Query:   76 KLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEF-----------PKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQG-QLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEEL---LLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSG-------------EISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININ-HVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFI-DYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIG-SKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACR-RNNWALDTCTLTTIITNEEDRSS-ENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIAL 5619
            K+KMLPTP+KFHY  NLRDLS+++QG+     +  +    +L L++HEC RV  DR IT +D++   + L+  ++              P  + +++  P   GD   +T+ + P++YE +  +  +    Q +   +NE+ +G  LDLV F DA+ HL  I RI+R   G+ALLVGV GSGK+SLS+LA+F A    F+I+L++ Y      EDLK +Y     E     F+F D  +  E FLE +NN+L+ G +  LF  DE +E+   L+ V        +P   + +++YF T     LH+VL  SPVG   R R   FPG+++   +DWF  WP++AL +VA Y +   N +   +   HV+  +   H  V    + +  + RR  ++T  +++++I  Y S+   K   +  + +R+ +GLDKL   +  +  L+  +A ++  +   +I  + ++ E+ +S + +   K   +E   +  +    I  EK +AE  L  A PALE A+ +L+ +  ND+  +R  A PP  +  + + + L+ Q               + SW  +  LM+   F+  LQ    + I  + +  ++        T+E  +      AG L + ++++ FY + RE+ P K  +   E     A  EL + Q  + + + +L  ++ +FD A  E   L  +  + ++++ AA  L  GL+ EK RW      F+ +   L+GD L+ + FL+YLGPF   +R+ L+++ W   L++  IP + N  +  +L     I +W  QGLP D+LSIQN I+ TK+TR+P+ IDPQ Q   WIK      K++   +++++LN   F   LE+S+  G P L ED  E +DP +DNVL KN IKS     V +GD+E D    F+LY+T+KL NP F+P + ++ ++I++TVT+ GLE QLL  ++  E++ELE +R  L+ + + NKR +KELED LL +L+   G+++D+  LI  L  TK  A +V+++L  +      I   ++ +RPAA RG++L+F++T +S++N MYQ SL  +L +F +++ RS       KR+ NII  LT+ V+ Y   G++E HK L  L + L+++   G + H E    IKG   ++    P     W+ D +W +L +LS  +P+F++I++Q++ NE  W+NW+   +PE E I D Y +  ++ +KL L+R W  DR       ++   + +++  P I      +  S    P++  +S GSDP  +I  LA  +  E   I   SMGQGQE +A  L   ++ +G W++LQN HL ++F+  + + L         FR+W+TTEP   FPI +LQ S K   EPP G++  L  T+A I  ++   S  P ++  ++ +AFLH+ +QERR+FG +GWNI Y+F  +DF  S++ +Q +L +   +K   V W+T++Y+IGEV YGGR  D FD+R+L  +   +F + +F+    F      +  Y IP     C +L + Y E+I+SLP   +P VFGLH NA I Y +N   ++ + +  +QP+        G +G ++E ++  +   +L KLP  Y  +++K  L+     ++   + L QE+DR   ++  + +SL+ LK A+ G + MS  L D   ++ +  +P  W+ ++ ++   LG W   L +R  Q+ TWI  G+ ++   W++G   PQ +LTA+ Q+  R    WALDT T    I NE  R + E +      G Y+ G+Y++G  WD +NG +     + L   +P++ +  I S   K       P+Y   +R +   +  +TV+ L T     HWIL+G+AL
Sbjct: 2885 KVKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADRFITPDDEQWFNSQLIRAVEENISPEVAANILPEPYFVDFLRDMPEPTGDEPEDTMFEVPKIYELVPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVKISRIIRTSCGNALLVGVGGSGKQSLSKLASFIAGYQIFQITLTRSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGEISNLFARDEMDEITQGLISVMKRELPR-HPPTFDNLYEYFITRSRKNLHVVLCFSPVGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCENYFQRYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIGLDKLMEASESVAKLSQDLAVKEKELAVASIKADEVLAEVTVSAQASAKVKNEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALNTIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLKLMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLKANLAKQEGRLAVANVELGKAQALLDEKQAELDKVQAKFDAAMKEKMDLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINRLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELELKARKIPFTENLNLIAMLVDPPTIGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKS-----KEKENDLQVTSLNHKYFRTHLEDSLSLGRPLLIEDIREELDPALDNVLEKNFIKSGTAFKVKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQELESERVKLLEDVTFNKRKMKELEDNLLYKLSATKGSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTSLAQFLKLFDQSMARSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKGGAALDLKACPPKPFRWILDMTWLNLVELS-KLPQFAEIMNQISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIRSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTWEESDTHTPLICFLSMGSDPTIQIDALAKKLKLECRTI---SMGQGQEVHARKLIQLSMQQGGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTEPHDRFPITLLQTSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDECDIKK--GVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFARVWFSEKMFEPSFCF------YTGYKIPI----CKTLDQ-YFEFIQSLPSLDNPEVFGLHPNADITYQSNTASDVLETITNIQPKE-----SGGGVGETREAIVYRLSEDMLSKLPPNYVPHEVKARLM-KMGHLNSMNIFLRQEIDRMQKVISILRSSLSDLKLAIEGTIIMSENLRDALDNMYDARIPQLWKRVSWDS-STLGFWFTELLERNAQFSTWIFEGRPNV--FWMTGFFNPQGFLTAMRQEVTRAHKGWALDTVT----IHNEVLRQTKEEIITPPAEGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAINSTAPKDPKLYVCPIYKKPRRTD---LTFITVVYLRTVLSPDHWILRGVAL 4726          
BLAST of Dynein heavy chain vs. UniProt/SwissProt
Match: sp|Q8IVF4|DYH10_HUMAN (Dynein heavy chain 10, axonemal OS=Homo sapiens OX=9606 GN=DNAH10 PE=1 SV=4)

HSP 1 Score: 1849.33 bits (4789), Expect = 0.000e+0
Identity = 956/1851 (51.65%), Postives = 1317/1851 (71.15%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLS-ITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPN-NSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI-WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+VF GL  +  +RF    QM+R+WR+ECLRVF+DR+I+  DK++VQ  + +++   F   +  V  +PIL+GD+     + EPR+YED+QDY   K+ FQE +E YNE    +++LVLFDDALEHL  +HRI+RMD GHALLVGV GSGK+SLSRLAAF A    FEI LS+GY E  FREDLK +Y KL  EN   +FLF D HVA+EGFLELINNMLT G+VP LF+++EKE +L  +  +  K G    KE +WQYF       LHIVL MSPVG TLR  CRNFPG+VNNT IDWF PWP QAL +VA   +   NP+IP++  E+V+ HVV +H+SV+  SQ F  KLRR NY+T  N++++I TY  LL+ K      + +RL  GLDKL+    Q+  LN K+AEQKI++ EK+ +CE L+ EI ++T  A  KKK+ EEK++EI +Q+KVI  EK EAE  L+  MP LEAAK  L +LDK+DVTEIR+FA PPK VQ V E + ++    E++WK+A+G+M+D NF++ L  +D ++I    +  +K  +     T E++ A SKAG G LKF+ +V+G+ DV REI+PK+E+V  LER F   ++ELER+Q E+  ++ +L+TL  +++ A  E ++L +E  IM+R+L+AA+KL  GL SE  RW++D+      RV LLGDCL+ +AFL+Y G FT+E+R  +V   W   +    IP S+ F++++LLT DVEIS+W SQGLP DELS+QN ILTT+++RFP+CIDPQ+QA+ WIK+     K+E  ++++++ ND  FL+ LE SIK+G P+LF D DE++DPVIDNVL KNI  S+GR++++LGD+EVD++  FRLYL +KL+NP++SPS++ +A +INYTVTL GLE QLLS LV  ERRELEE+RE+LI ETSENK +LK+LED LL ELAT TGN+LDN +L++TLE+TK+KA +V+++L  +   + DI+R RDGYRPAA+RGA+LFFVL+ ++++N+MYQ+SL ++L VF  ++++S+PDS L KRL NI+ TLTF +Y +GCTG+FE+HK+L S  + +++E+  G +   E+DFF+KGNI++     +    WL D  W+D+  LS +    F  + D V NN+  W+ WY L S E   +    + N   F+KL +LRC+R+DR+  A+TD+VT  MG+++V PP+ +F A F  STP  PIV I+SPGSDP T+++KLA    F  +++K+L+MGQGQEK AL L +TAV+RGQWLMLQN HLL+K++  +EK L+ + KPHPDFRLWLTT+P   FPIGILQKS K+V EPP+G+K N+  TY KI +E+    PHP ++  ++ LAF HA++QERR+FGKIGWN+ YDF ESDFQV ++IL TYLTKA +++   +PW ++KYLIGEVMYGGRAIDSFDRRIL  YMDEY GDF+FD FQ FHF+ +  ++Y IP   E     KE + E I++LP   +P VFGLH NA IGY T   +++W +++ELQPQT     E+    S++  + ++   I +K+P ++D++++++ L      +SPT+VVLLQEL+RFN L+ +M  SL  L++AL GEVGMS ELDD+++SL  G +PN WR LAP+T+K LG+W+ +  +R  QY  W+   +   PS+ WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T  +D    N       GC+V G+Y+EG  WD++ GC+I  K + L+  +PI+++ PIE+H+ K  NT + PVY TS RRNAMG+GLV   DL TT H SHW+LQG+ LTLNSD
Sbjct: 2645 PTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRLISETDKQLVQQHIGSLVVEHFKDDVEVVMRDPILFGDFQMALHEGEPRIYEDIQDYEAAKALFQEILEEYNE-SNTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLSRLAAFTASCEVFEILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTSGIVPALFSEEEKESILSQIGQEALKQGMGPAKESVWQYFVNKSANNLHIVLGMSPVGDTLRTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLG-YNPMIPAENIENVVKHVVLVHQSVDHYSQQFLQKLRRSNYVTPKNYLDFINTYSKLLDEKTQCNIAQCKRLDGGLDKLKEATIQLDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAMEKAEAETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKGYKELNWKTAKGVMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLGMLKFVEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAILEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLSYEGAFTWEFRDEMVNRIWQNDILEREIPLSQPFRLESLLTDDVEISRWGSQGLPPDELSVQNGILTTRASRFPLCIDPQQQALNWIKR-----KEEKNNLRVASFNDPDFLKQLEMSIKYGTPFLFRDVDEYIDPVIDNVLEKNIKVSQGRQFIILGDKEVDYDSNFRLYLNTKLANPRYSPSVFGKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLRELATSTGNMLDNVDLVHTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFFVLSEMALVNSMYQYSLIAFLEVFRLSLKKSLPDSILMKRLRNIMDTLTFSIYNHGCTGLFERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGNISLEKSKRKKPCAWLSDQGWEDIILLSEMFSDNFGQLPDDVENNQTVWQEWYDLDSLEQFPVPLGYDNNITPFQKLLILRCFRVDRVYRAVTDYVTVTMGEKYVQPPMISFEAIFEQSTPHSPIVFILSPGSDPATDLMKLAERSGFGGNRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHPDFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEMLDQCPHPAFKPLVYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSLKYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFDTFQPFHFFRNKEVDYKIPVGDE-----KEKFVEAIEALPLANTPEVFGLHPNAEIGYYTQAARDMWAHLLELQPQTG----ESSSGISRDDYIGQVAKEIENKMPKVFDLDQVRKRL---GTGLSPTSVVLLQELERFNKLVVRMTKSLAELQRALAGEVGMSNELDDVARSLFIGHIPNIWRRLAPDTLKSLGNWMVYFLRRFSQYMLWVTESE---PSVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLFTQVTKFQDADEVNERAGQ--GCFVSGLYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIPIEAHRLKLQNTFRTPVYTTSMRRNAMGVGLVFEADLFTTRHISHWVLQGVCLTLNSD 4471          
BLAST of Dynein heavy chain vs. UniProt/SwissProt
Match: sp|Q9SMH3|DYH1A_CHLRE (Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1)

HSP 1 Score: 1533.08 bits (3968), Expect = 0.000e+0
Identity = 827/1871 (44.20%), Postives = 1191/1871 (63.66%), Query Frame = 1
Query:   82 KMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWT--ETLDDE----PRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTI--AKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQL----------SITIPKFSDILDQVTNNEDEWRNWYKLQSP-ESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEI-HKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            K+ PTP++FHY  NLRDLS++++GL  +  D F    Q LRLWR+ECLRV +DR+I+ +DK ++   L  +++ +FP    +   +P+L+GD+      L  E    PR+Y+DL DY  IK  F++ + ++    +  ++LV F+DALEHL  IHR LR+  G+ LLVGV GSGK+SLS+LAAF A    FEI+L++GY E  FREDLK +Y  L ++N   MFLF D HVA EGFLELINNMLT GMVP L+   EK+ L+  V  +  K G    KE  W Y+   C   LH+VLAMSPVG TLR+RCRNFPG+VNNT IDWF PWPEQAL SVA   +      +P      ++ H+VT+H+SV   S  F  +LRR NY+T  N++++I  Y   L T    +E    RL+ GL+KL   A ++  +  ++++ +++V + T  C  L+  I+ +T +   K K    K  ++   S+ I  EK EAE AL  A+PALE A  +L +L K+ +TEIR++A PP+ VQ V E + ++    ++SW  A+ +MAD NF++ L   D +++  K +  VK+     K  LTY+ +RA S AGAG LK++++++ + +VAR + PK+++V   E+    A+K+L   + E++ L  QL  L+ QF++   E + L  +  +M+R+L+AA KL  GL SE+ RW  D+A  +  R  L+GDCL+ S+FL+Y G FT  YRH +V   W   +++  +P ++ F+++ LLTSDVE + W S+GLP DELSIQN ILT ++ R+P+CIDPQ QAV WIK  E  + +     K+   NDS FL+ LE SI++G P+LFE+ DE++DPVID VL KN++   G+  + LGD+EV+W+  FRLY+TSKLSNP + P +  +  IINY VT  GL  QLL+  +++ER +LEE RE LI + SENK  L+ LED LL EL+   GNILDN ELI TLE  K KAV++A++L  S + +A+IE  R  Y PAAKRGA+LFFV+  LS I  MY++SL S+LVVF  ++  S  D+S+  RL NII TLT+ VY Y C G+FE+HK++ S Q+  ++ E    +    +DFF+KGN+++         +W PD  W+DL +L             +     + + V ++E  WR WY L++P E+E    Y+   + F+KLCL+RC R+DR+ + IT FV  VMG+++V PP+  + + +  ST   PIV ++SPG+DP  ++ KL   + F    K+KY+++GQG    A  L +T  +RG W+MLQN HLL  ++  +EK L+ + KPH DFRLWLTTE    FP+G+LQ+S K+V EPP+G+K N+  +Y+KI  EV  D PH  +R  ++ L F HA++QERR++GK+GWN+ YDF E+DF++S+ ++ TYLTKA + +   +PW T++YLIGE MYGGR  DS+DRRIL TY+DEY GDFLFD FQ F FY     E  IP      +  ++ Y + +++LP  QSP  FGL+ NA I Y T+ TK +W ++++LQP+T        R    E+ +  +   I  K+P  +D+ ++++ L       SPT VVLLQEL+R+N +L  M +SL  L++AL GE+G S  L++++ SL NG +P  W  L P T K LG+W+    +R  QY+ W   G+  +  IWLSGLH+P++Y+ ALVQ ACR   W LD  TL T +T   D     ++   + GCY+ G+Y+EG  WD++   +  Q  + L+  +PI+Q+ PIE++K K  NT + PVYVT  RRNAMG+GLV   DLA+ EH+SHW+LQG+AL LN D
Sbjct: 2777 KLPPTPSRFHYIFNLRDLSRIYEGLLLTVGDVFKTPEQFLRLWRNECLRVLHDRLISTDDKRVMTERLEALVQQKFPNLAAHTLASPVLFGDFKNVINELQGEGEVAPRMYDDLGDYNSIKPLFEDVMTNFYNRKRKPMNLVFFEDALEHLTRIHRTLRLPQGNCLLVGVGGSGKQSLSKLAAFTAGCEVFEITLTRGYDELAFREDLKRLYAMLGSDNKRVMFLFTDAHVADEGFLELINNMLTSGMVPALYDGAEKDGLIGSVRAEVEKKGLLATKESCWSYYVDKCRNNLHVVLAMSPVGETLRSRCRNFPGMVNNTVIDWFEPWPEQALTSVASVFL--AEEALPEALRPQIVEHMVTVHQSVRTFSTRFLEELRRYNYVTPKNYLDFINNYKRALATNRRTIEDTVTRLSGGLEKLIQAAVEVDAMQKELSQAQVVVAQATKECNELLEVISTNTVDVETKAKAAAIKEAQLKVDSEQIAIEKAEAEAALEEAIPALEEAAAALQDLSKDHITEIRSYAKPPEQVQKVCECVVILRNIKDVSWLGAKSMMADGNFLRSLVEFDKDSLTDKQVKKVKEYFKDPKAPLTYDSLRAISTAGAGLLKWVLAMVNYNNVARTVEPKRKKVAESEKNLRIAQKDLASTKLELQSLNDQLGKLRTQFEEKTAEQQDLKAKADLMERRLIAASKLIAGLGSERERWTRDIADLESRRDRLIGDCLLTSSFLSYTGAFTATYRHAMVYEMWQDDVKARGVPVTQPFRLEALLTSDVETTGWASEGLPSDELSIQNGILTVRANRWPLCIDPQMQAVNWIKSREGKMLEG----KVKTFNDSDFLKQLELSIQYGFPFLFENLDEYIDPVIDPVLEKNLVPGDGKFVIKLGDKEVEWDSNFRLYMTSKLSNPHYGPEISGKTMIINYGVTQQGLTEQLLNVTLRHERSDLEEAREALIKQMSENKATLQALEDTLLRELSNAQGNILDNSELIATLESAKLKAVEIAEKLEASKVTAAEIEETRVRYSPAAKRGAILFFVIAGLSAITNMYEYSLASFLVVFNGSLHSSRRDASIEGRLRNIIDTLTYDVYAYTCLGLFERHKLMFSFQMTCKILEGDTPLDPQLLDFFLKGNLSLEKAARRKPFDWFPDAGWQDLMRLVELGQKKIGADGRMHALGSLANDVESDEAAWRTWYDLEAPEEAELPCGYQSFLSDFEKLCLMRCLRMDRVTVGITRFVIGVMGEKYVQPPVLEYRSIYKQSTETTPIVFVLSPGADPAFDVFKLGEEMGFRPGAKLKYMALGQGMGPKAQELIETGATRGLWIMLQNCHLLPTWLKTLEKILEKITKPHADFRLWLTTELTDRFPLGVLQRSLKVVTEPPNGLKLNMRQSYSKITEEVLADCPHQAFRPLVYVLGFFHAVVQERRKYGKLGWNVPYDFNETDFRISMALISTYLTKAWDAQDDLIPWGTLRYLIGEAMYGGRVSDSYDRRILTTYLDEYLGDFLFDTFQPFRFYACKDYEIAIPQ-----TGSRDTYLKAVEALPLVQSPEAFGLNANADISYYTSATKAIWTDLVDLQPRTGGGGGGVAR----EEFIGGVARDIAAKIPEPFDLPQLRKEL----GTPSPTQVVLLQELERWNSVLGVMVSSLRDLQRALSGEIGFSSRLEELASSLYNGKLPAMWARLNPATEKALGAWMLWFGRRYRQYKDWTEHGEPKV--IWLSGLHIPETYIAALVQAACRDKGWPLDKSTLYTKVTKFTD--PYQVSERPKYGCYMSGLYLEGAAWDLEASQLRKQDPKVLVNELPILQVIPIEANKLKLANTFRAPVYVTQARRNAMGVGLVFDADLASAEHSSHWVLQGVALVLNID 4624          
BLAST of Dynein heavy chain vs. UniProt/SwissProt
Match: sp|P0C6F1|DYH2_MOUSE (Dynein heavy chain 2, axonemal OS=Mus musculus OX=10090 GN=Dnah2 PE=1 SV=1)

HSP 1 Score: 1102.04 bits (2849), Expect = 0.000e+0
Identity = 657/1865 (35.23%), Postives = 1024/1865 (54.91%), Query Frame = 1
Query:   82 KMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQIN--PILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYN-ELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININH--VFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFI-DYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLI--KPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHP-KYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIG--SKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI-WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMG-IGLVTVLDLATTEHNS-HWILQGIALTLNSD 5634
            + LPTP K HY  NLRD+SKVFQG+ ++  D       + RLW HEC RVF+DR++   D E    IL + +   F     ++  N  P ++GD+  E     P++YEDL D  V+K+  +  +  YN       + LVLF +A+EH+  I R++    G+ LLVG+ GSG++SL+RLA+   D + F+I ++K Y ++EFR+D+K +Y +   E     FLF D  +A E FLE INN+L+ G VP L+  DE EE+  H+ D       PE+ + ++ Y        LHIVL +SPVG   RN  R +P +VN T I+WF  WP +AL  VA   I   +          V    VT+H SV   SQ   L+LRR NY+T TN++  +  Y  LL  K  +L  +  +L  GL K++ T  ++ +++ ++ + K  V E    CE  ++ I     EA  ++K     S +I  +          A++ L  A+PALE A R+L+ L+K D+ EI+++  PP  V+IV + + ++L+  E +W  A+  + + NFIK L   D + I  K +  +    A+     + +   S A      ++ ++  +  + R + PK+ R+     +  + +  L   QE++R++  +L+ LKKQ+D+   + E L K+   M+ +L  A  L  GLA EK RW   V G +++   L+GDCLIA+AFL+Y+GPF   YR  ++   W+  +R + +P S  F I N LT+  ++  WN QGLP D  S +N I+ T+  R+ + IDPQ QA+KWIK ME N     + +KI +L    +LR LE++I+FG P L ++  E++DP ++ VL+K++ +  GR  + +GD+EV++ P FR YLT+KLSNP ++P   ++  I+N+ V   GLE QLL  +V+ ER ELEE++++L++  +  KR LKELED++L  L   TG++LD+ +L+NTL+ +K  A +V +QL  S     +I+  R+ YRP A+R +VLFFVL ++  I+ MYQFSL +Y+ +F+ +I +S   + L  R+  +    T+ VY Y C  +FE+HK+L S  +  ++ E  G +  +E +FF++G + ++         T+WL D  W ++ +L   +  F  +++       +W  WY   SPE   +   ++   N  +++ ++R  R DR+   +T F+ + +G  F+ PP+    +    STP  P+V I+SPG DP + +++LA       H+   LS+GQGQ   A  L    V++G W+ L N HL + ++  ++K ++ L    PHP FRLWL++ P   FPI ILQ S K+  EPP G+K N+T  Y  +    F     P KY++ +F L F H+IL ER++F ++GWNI Y F +SDF+VS  +L  YL +  E      PW+ +KYLI  V YGG   D +DRR+L TY+++YF D             D    YYIP +    S     Y EYI  LP    P  FG H NA +       + L++ ++ LQPQ         R+G  S+E+ + E+   +  K+P + D    ++ L   + + SP  VVLLQE+ R+N L+K +  SL  L+K + G + MS  L++I   + +  +P  W  + P + K L SW   L  R  Q+ETW  A +   P + WLSG   P  +LTA++Q A R+NN ++D+ +   I++  +D    NL    + G +V G+Y+EG GWD KN C++  +  QL+  MP I   P ES K         P Y    R  +      V  +DL +    S HWI +G AL ++ D
Sbjct: 2631 RFLPTPAKIHYLFNLRDISKVFQGMLRANKDFHDTKASITRLWIHECFRVFSDRLVDTADMEAFMGILSDKLGTFFDLTFHHLCPNKRPPIFGDFLKE-----PKVYEDLVDLTVLKTAMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYNTFQIEVTKHYRKQEFRDDIKRLYRQAGVELQTTSFLFVDTQIADESFLEDINNILSSGEVPNLYKSDEFEEIQNHIIDQARAEQIPESSDSLFAYLIERVRNNLHIVLCLSPVGDPFRNWIRQYPALVNCTTINWFSEWPREALLEVAEKYIIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRYNYVTPTNYLELVSGYKKLLGEKRQELLDQANKLRTGLFKIDETREKVEVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAIEEVKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAV-MILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAAMAQLQEKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLIAAAFLSYMGPFLTNYRDEIINQIWIRKIRELQVPCSPRFAIDNFLTNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQGQALKWIKNMEGN-----QGLKIIDLQMHDYLRVLEHAIQFGFPVLLQNVQEYLDPTLNPVLNKSVARIGGRMLIRIGDKEVEYNPNFRFYLTTKLSNPHYNPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVTEQLETSETTEINIDLAREAYRPCAQRASVLFFVLNDMGRIDPMYQFSLDAYIGLFILSIDKSHRSNKLEDRIEYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCTSWLADAYWDNITELD-KLTNFHGLMNSFEQYPRDWHLWYTNSSPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIVSNLGSRFIEPPVLNMKSVMEDSTPRSPLVFILSPGVDPTSALLQLAEHTGMA-HRFHALSLGQGQAPIAARLLREGVNQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSSPHPDFPISILQASIKMTTEPPKGLKANMTRLYQLMTEAQFTHCSKPAKYKKLLFALCFFHSILLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEE-----TPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCDLSLTTPFYRLSVLDT---YYIPKDGSLAS-----YKEYISMLPSMDPPEAFGQHPNADVASQITEARTLFETLLSLQPQ-----ITPTRVGGQSREEKVLELAADVKQKIPEMIDYEGTRKLL---ALDPSPLNVVLLQEIQRYNKLMKTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKVYP-SQKPLASWTRDLAVRVEQFETW--ASRARPPVLFWLSGFTFPTGFLTAVLQSAARQNNISVDSLSWEFIVSTVDD---SNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSTDRASFVIGIDLRSGSMTSDHWIKRGTALLMSLD 4455          
BLAST of Dynein heavy chain vs. UniProt/SwissProt
Match: sp|Q9MBF8|DYH1B_CHLRE (Dynein-1-beta heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC10 PE=1 SV=1)

HSP 1 Score: 1079.32 bits (2790), Expect = 0.000e+0
Identity = 641/1889 (33.93%), Postives = 1038/1889 (54.95%), Query Frame = 1
Query:   61 ILREIKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHM-----PYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYN-ELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEA-------EEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVF-PENLTN-WLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPE-SEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLD--DLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDS-PHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIE-----------YYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI-WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAM-GIGLVTVLDLATTEHN-SHWILQGIALTLN 5628
            I R +  ++LPTP+K HY  N RDL+K+ QG+ Q+T   +    ++L+LW HEC+R+  DRM  + DKE +   L   +   F          Y +  P  +  +  + +D    +YE ++D   +K    E +E Y  E     +DLVLF DAL H+  IHRIL    G+ALLVGV GSG++SL+RLAAF A+L  F I ++K Y + EFREDLK +Y +    N   +FLF +  +  E FLE +NN+LT G VP LF  DE   +L  +      +G  E  + ++ +        LH+VL +SPVG   R RCR FPG+VN T IDWF  WP  ALF VA   +   + L  ++    V    VT H+SVE  S      L+R NY+T TN++  ++ Y  LL  K  +L  K  +L  GL KL+ T+ Q+  +     E+K++V +    CE L++EI          K++ +E+  ++  +++ I KE  EA       ++ L  A+PAL  A+ +LD L K D++E++A+A PP+ V++    +  VL+    +W  A+  ++DANF++ L+  D + +    +  +    A    TYE +   S A +G  K++ ++  +  VA+++ PK+ ++K  +    + +  L   QE++  +  +++ LK ++D +    + L +E+A ++ +L  AEKL  GLA E+ RW + ++ +      L GD ++A+AF++Y GPF  EYR  LV++ WL  ++++NIP S +F     L +   +  WN QGLP D  S +N ++ T+  R+P+ IDPQ QA KWIK ME         +K+ NL  S   R +EN+I+FG P L +D  + +DP+++ VL+K+ IK   +  + LGD+EVD+   FRLYLT+KL+NP ++P + ++  I+N+ V   GLE QLL+ +VKNER +L++++ +L+++ +  KR   ELED +L  L+T TG++LDN  LINTL+ +K    +V   L+ +      IE     YRP + R +VL+FVL +LS I+ MYQFSL +Y  +FL +I+ S  + +LA+R+ ++    T+ VY Y   G+FE+HK+LLSLQ+ +R+ +    +   E  FF++G   ++    P N +  W+ + +W ++ +L   +P F  ++    +N  EW  WY+   PE SE    ++   N  ++L L+RC R DR+  A T +V+  +G+++V PP+         ST + P++ ++S G DP   + KLA        +   +++GQGQ   A  L +  +  G W+ L N HL+  ++  ++K ++  +  +PH +FRLWL++ P  +FPI ILQ+  K+  EPP G++ NL   Y  + +  +       KY++ +F L + H++L ERR+F  +G+NI YDF ++DF VS  +L++YL    +      PW+ +KYLI E  YGGR  D  DRR+L +Y++++              Y +D +            YY+P    E   L+  + +YI +LP    P  FG H NA I Y    +K L  +++ LQP+TE     AG    +E V+  +   +L ++P  +++ ++ +     +++ S   VVL QE++R+N LL  +  S   L++ + G V MS +LD I +SL    +P  W    P ++K LG W   L QR  Q  TW+   +   P + WLSG   P  +LTA++Q   R+ +  +DT +    I N ++R    +    + G Y+ G+++EG GWD +NGC+      +L+  MPI+   P+E+ K         P+Y+   R         +  +DL +   +  HWI++G AL L+
Sbjct: 2676 IYRAVSKELLPTPSKSHYLFNTRDLAKIIQGMMQATKAFYNSKEEVLQLWCHECMRIIADRMWDHADKEWLVRQLDEKLGTTFSTSFGTLFEAYNETVPP-FVTFMRQNVDVP--VYEAVRDMVALKDLLTERLEDYALEPGHSAMDLVLFRDALSHVCRIHRILGQPRGNALLVGVGGSGRKSLARLAAFVAELKCFTIEITKNYRQTEFREDLKGLYRQAGVANKPTVFLFDETQIVYETFLEDVNNILTSGEVPNLFPKDELGSVLDELRPAAKAAGAGETADALYGFLLERVRTNLHVVLCLSPVGEAFRERCRMFPGLVNCTTIDWFTEWPADALFEVAQKQLMDVD-LGSTEVKTAVCKVFVTAHQSVENTSAKMFAALKRRNYVTPTNYLETVRGYKGLLAEKRTELGEKAAKLQGGLHKLDETSVQVAAMKKVAEEKKVVVAQAKADCEELLVEI-------VQDKRVADEQEKQVNAEAQKIGKEAEEANIIAAQVQQELDKALPALREAEAALDVLTKKDMSELKAYAKPPEKVEMTLNAVLTVLRRPP-NWDEAKKRLSDANFMQSLKEFDKDKLDDSLLKKIGKFTANPDFTYEKINTVSAAASGMCKWVHAMETYGYVAKDVAPKRAKLKSAQDTLARKQAALALAQEQLAVVLAKVQALKDKYDTSIARKQALEEELADLEGKLERAEKLVTGLAGERVRWEASISEYNIALGCLPGDVVVAAAFMSYAGPFPSEYRDELVKHTWLPQVKALNIPASEHFDFALFLANPAMVRDWNIQGLPSDSFSTENGVMVTRGRRWPLMIDPQGQANKWIKNME----GRGGRLKVLNLQMSDMARQIENAIQFGQPVLMQDILQEIDPILEPVLAKSFIKRGNQTLIKLGDKEVDYNFDFRLYLTTKLANPLYTPEISTKVMIVNFAVKEQGLEAQLLATVVKNERPDLDKQKNDLVVKVAAGKRTQAELEDTILHLLSTATGSLLDNVTLINTLDQSKTTWEEVNASLAVAEETQKKIEAASQLYRPCSVRASVLYFVLNDLSTIDPMYQFSLDAYNDLFLLSIKNSPKNDNLAERIKSLNDFHTYAVYKYTSRGLFERHKLLLSLQMCVRILQTANQVNTEEWQFFLRGGTVLDRSSQPNNPSQEWISEEAWDNITELD-ALPNFKGVVSSFESNLGEWEAWYRKGDPEASELPAEWESKCNELQRLILVRCLRPDRVIFAATTYVSNALGRKYVEPPVLDLAETLKDSTALSPLIFVLSAGVDPTDNLRKLATEKGM-TSRFFTVALGQGQAPTATRLIEDGLREGNWVFLANCHLMTSWLPTLDKIIEGFETKQPHENFRLWLSSNPSPSFPIAILQRGIKMTTEPPKGLRANLLRLYNSVSDASYAQCKTQIKYQKLLFALTYFHSVLLERRKFRTLGFNIPYDFNDTDFSVSDDLLKSYLDSYEQ-----TPWDALKYLIAEANYGGRVTDELDRRVLASYLNKF--------------YCEDALAVPGYLLSPLSTYYVP----ENGPLQS-FKDYILTLPAGDRPEAFGQHPNAEISYLIEDSKVLLDSLLSLQPRTEGAAGGAGT--RREDVVMAIATDLLDQVPQPFNLEEVMKA---KADDPSALHVVLFQEVERYNALLVAVRRSCVELQRGIKGLVVMSADLDLIFESLYAAKVPAAWLKTYP-SLKPLGPWTRDLLQRIEQLATWV---EETYPRVYWLSGFTYPTGFLTAVLQTTARKASVPIDTLSFEFSIINLDER---EINAPPKEGVYIKGLFLEGAGWDFENGCLCEPNPMELIVPMPILLFRPVENKKRTAKGIYTCPLYLYPLRTGTRERPSFMINVDLRSGSADPDHWIMRGTALLLS 4510          
BLAST of Dynein heavy chain vs. UniProt/SwissProt
Match: sp|Q9P225|DYH2_HUMAN (Dynein heavy chain 2, axonemal OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3)

HSP 1 Score: 1064.29 bits (2751), Expect = 0.000e+0
Identity = 638/1863 (34.25%), Postives = 1015/1863 (54.48%), Query Frame = 1
Query:   82 KMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPK--HMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYN-ELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININH--VFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFI-DYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLI--KPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHP-KYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI-WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMG-IGLVTVLDLATTEHN-SHWILQGIALTLNSD 5634
            + LPTPTK HY  NLRD+SKVFQG+ ++  D     + + RLW HEC RVF+DR++   D E    I+ + + + F    H       P ++GD+  E     P++YEDL D  V+K+  +  +  YN       + LVLF +A+EH+  I R++    G+ LLVG+ GSG++SL+RLA+   D + F+I ++K Y ++EFR+D+K +Y +   E     F+F D  +A E FLE INN+L+ G VP L+  DE EE+  H+ D       PE+ + ++ Y        LHIVL +SP+G   RN  R +P +VN T I+WF  WP++AL  VA   +   +          V    VT+H SV   SQ   L+LRR NY+T T ++  +  Y  LL  K  +L  +  +L  GL K++ T  ++ +++ ++ + K  V E    CE  ++ I     EA  ++K     S +I  +          A++ L  A+PALE A R+L+ L+K D+ EI+++  PP  V+IV + + ++L+  E +W  A+  + + NFIK L   D + I  K +  +    A+     + +   S A      ++ ++  +  + R + PK+ R+     +  + +  L   QE++R++  +L+ LKKQ+D+   + E L K+   M+ +L  A  L  GLA EK RW   V G +++   L+GDCL+A+AFL+Y+GPF   YR  +V   W+  +  + +P S +F I N L +  ++  WN QGLP D  S +N I+ T+  R+ + IDPQ QA+KWIK ME       + +KI +L  S +LR LE++I FG P L ++  E++DP ++ +L+K++ +  GR  + +GD+EV++   FR Y+T+KLSNP +SP   ++  I+N+ V   GLE QLL  +V+ ER ELEE++++L++  +  KR LKELED++L  L   TG++LD+ +L+NTL  +K  A +V +QL  S     + +  R+ YRP A+R ++LFFVL ++  I+ MYQFSL +Y+ +F+ +I +S   + L  R++ +    T+ VY Y C  +FE+HK+L S  +  ++ E  G +  +E +FF++G + ++         ++WL D  W ++ +L   +  F  +++       +W  WY   +PE   +   ++   N  +++ ++R  R DR+   +T F+   +G  F+ PP+    +    STP  P+V I+SPG DP + +++LA  +     +   LS+GQGQ   A  L    V++G W+ L N HL + ++  ++K ++ L    PHP FRLWL++ P   FPI ILQ S K+  EPP G+K N+T  Y  +    F     P KY++ +F L F H++L ER++F ++GWNI Y F +SDF+VS  +L  YL +  E      PW+ +KYLI  + YGG   D +DRR+L TY+++YF D             +    Y+IP +    S     Y EYI  LP    P  FG H NA +       + L+  ++ LQPQ       AG    +EKVL E+   +  K+P + D    ++ L   + + SP  VVLLQE+ R+N L++ +  SL  L+K + G + MS  L++I   + +  +P  W    P + K L +W   L  R  Q+E W  A +   P I WLSG   P  +LTA++Q + R+NN ++D+ +   I++  +D    NL    + G +V G+Y+EG GWD KN C++  +  QL+  MP I   P ES K         P Y    R  +      V  +DL +      HWI +G AL ++ D
Sbjct: 2602 RFLPTPTKMHYLFNLRDISKVFQGMLRANKDFHDTKSSITRLWIHECFRVFSDRLVDAADTEAFMGIISDKLGSFFDLTFHHLCPSKRPPIFGDFLKE-----PKVYEDLTDLTVLKTVMETALNEYNLSPSVVPMQLVLFREAIEHITRIVRVIGQPRGNMLLVGIGGSGRQSLARLASSICDYTTFQIEVTKHYRKQEFRDDIKRLYRQAGVELKTTSFIFVDTQIADESFLEDINNILSSGEVPNLYKPDEFEEIQSHIIDQARVEQVPESSDSLFAYLIERVQNNLHIVLCLSPMGDPFRNWIRQYPALVNCTTINWFSEWPQEALLEVAEKCLIGVDLGTQENIHRKVAQIFVTMHWSVAQYSQKMLLELRRHNYVTPTKYLELLSGYKKLLGEKRQELLAQANKLRTGLFKIDETREKVQVMSLELEDAKKKVAEFQKQCEEYLVIIVQQKREADEQQKAVTANSEKIAVEEIKCQALADNAQKDLEEALPALEEAMRALESLNKKDIGEIKSYGRPPAQVEIVMQAV-MILRGNEPTWAEAKRQLGEQNFIKSLINFDKDNISDKVLKKIGAYCAQPDFQPDIIGRVSLAAKSLCMWVRAMELYGRLYRVVEPKRIRMNAALAQLREKQAALAEAQEKLREVAEKLEMLKKQYDEKLAQKEELRKKSEEMELKLERAGMLVSGLAGEKARWEETVQGLEEDLGYLVGDCLLAAAFLSYMGPFLTNYRDEIVNQIWIGKIWELQVPCSPSFAIDNFLCNPTKVRDWNIQGLPSDAFSTENGIIVTRGNRWALMIDPQAQALKWIKNME-----GGQGLKIIDLQMSDYLRILEHAIHFGYPVLLQNVQEYLDPTLNPMLNKSVARIGGRLLMRIGDKEVEYNTNFRFYITTKLSNPHYSPETSAKTTIVNFAVKEQGLEAQLLGIVVRKERPELEEQKDSLVINIAAGKRKLKELEDEILRLLNEATGSLLDDVQLVNTLHTSKITATEVTEQLETSETTEINTDLAREAYRPCAQRASILFFVLNDMGCIDPMYQFSLDAYISLFILSIDKSHRSNKLEDRIDYLNDYHTYAVYRYTCRTLFERHKLLFSFHMCAKILETSGKLNMDEYNFFLRGGVVLDREGQMDNPCSSWLADAYWDNITELD-KLTNFHGLMNSFEQYPRDWHLWYTNAAPEKAMLPGEWENACNEMQRMLIVRSLRQDRVAFCVTSFIITNLGSRFIEPPVLNMKSVLEDSTPRSPLVFILSPGVDPTSALLQLAEHMGMA-QRFHALSLGQGQAPIAARLLREGVTQGHWVFLANCHLSLSWMPNLDKLVEQLQVEDPHPSFRLWLSSIPHPDFPISILQVSIKMTTEPPKGLKANMTRLYQLMSEPQFSRCSKPAKYKKLLFSLCFFHSVLLERKKFLQLGWNIIYGFNDSDFEVSENLLSLYLDEYEE-----TPWDALKYLIAGINYGGHVTDDWDRRLLTTYINDYFCDQSLSTPFHRLSALET---YFIPKDGSLAS-----YKEYISLLPGMDPPEAFGQHPNADVASQITEAQTLFDTLLSLQPQITPT--RAGGQTREEKVL-ELAADVKQKIPEMIDYEGTQKLL---ALDPSPLNVVLLQEIQRYNTLMQTILFSLTDLEKGIQGLIVMSTSLEEIFNCIFDAHVPPLWGKAYP-SQKPLAAWTRDLAMRVEQFELW--ASRARPPVIFWLSGFTFPTGFLTAVLQSSARQNNVSVDSLSWEFIVSTVDD---SNLVYPPKDGVWVRGLYLEGAGWDRKNSCLVEAEPMQLVCLMPTIHFRPAESRKKSAKGMYSCPCYYYPNRAGSSDRASFVIGIDLRSGAMTPDHWIKRGTALLMSLD 4426          
BLAST of Dynein heavy chain vs. TrEMBL
Match: A0A2C9JWZ8 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106071343 PE=4 SV=1)

HSP 1 Score: 1983.38 bits (5137), Expect = 0.000e+0
Identity = 992/1849 (53.65%), Postives = 1367/1849 (73.93%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESE-FIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+++ GLC ST DRF+K  Q +RLWR+EC RV +DR+I ++DKE++   +++++++ F  H+ +V   PILYGDY T   + EPRLYED+QDY   K+ FQE +E YNE     ++LVLFDDALEHL+ IHR+LRMD GHALLVGV GSGK+SL RLA++AA    FEI LS+GY E  FREDLKV+YNKL TEN    FLF DQHV +EGFLELINNMLT GMVP L+ DDEKE L+  + D+  ++G    KE IWQYF   C   LHIVLAMSPVG TLR RCRNFPG VNN +IDWF+PWPEQAL++VA   I P+N LIP +  + +++HVV +H+S+ + S  F  +LRR+NY+T  N++++I TY+ LL+ +D  + ++ +RL  GL K+ + +  + +LN K+A QK+ V EKT +CE L+ EI   T+ AT KK   E K  EI +QSKVI  EK +AE+AL+ A+PALEAA+ +LD+LDK DVTEIR+FA PP+ VQ V E + ++    ++SWKSARG+M++ANF+K L+ +DV+ I  K +  VK  I    LT E +++ SKAGAG LKF+ +V+G+  VA+EIRPK+E+V  LE+ F +A+++LE++ +EV+ LE +L+ L K+++ A  E + L  E  IM+R+L+AA+KL  GL SE  RW  D+   +++RV LLGDCL++SAFL+Y+G F++E+R++LV   W+  L+  N+P S  F++++LLT+DVEISKW S+GLP DELSIQN ILTT+++RFP+CIDPQ+QA+ WIK+     K+E  ++K+   ND  FL+ LE +IK+G P+LF+D DE++DPVIDNVL KNI   +GRE+VMLGD+EVD++P FRLYL +KL+NPK+ P+++ ++ +INYTVTL GLE QLLS +VK ER+ELEE+RE LI+ETS NK++LK+LED LL ELA   GN+LDN EL+ TLE+TK KA +V+++L      + DIE+ RDGYRPAAKRGA+LFFVL  +S +N MYQ+SL SYL VF  ++++S+PDS L KRL NI+ TLT ++Y YGCTGIFEKHK+L S QI ++LE+D   +T +E+DFFIKG + +     +   +W PD  W+D N+L+   P FS +LD +  NE  W+ W+   +PES+ +   Y E  + F+ L LLRC+RIDRI  A+T++VT  MG+++V+PPI +F   +  STP+ PIV I+SPGSDP ++++KLA+ I+F  +K+K+LSMGQGQEK AL L +TA+SRGQWLMLQN HLL++++  ++K+L+ + KPHPDFRLWLTTEP  +FPI ILQ+S K+V EPP+G+K N+  TY KI      D  H  +   +F LAF HA++QERR++GKIGWN+SYDF ESDF+V ++IL TYL+KA +  +T +PWN++KYLIGEVMYGGRAID FDRRIL+TYMDEY GDF+FD+FQ FHFY D+ ++Y+IP++       +++Y +YI+SLP   +P VFGLH NA IGY T   +++W ++++LQPQT     E+    S+E  + ++   +L+KLP  +D++KI++NL     +ISPTTVVLLQEL+RFN+L+ +M  SL TLK+AL GEVGMS ELDD+++S+ NG +P+ WR LAP+T+K LG+W+ H E R  QY TW+   + + P +WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T     S++++T  +  GC+V G+Y+EG GWD++   ++PQ+ +QL+Q +P++++ PIESH+ K  NT + PVY TSQRRNAMG+GLV   DLAT EH SHW+LQG+ L LN+D
Sbjct: 2753 PTPSKFHYIFNLRDLSRIYNGLCLSTPDRFSKEEQFVRLWRNECHRVISDRLINDQDKELIAKKIVSLLEDNFKSHLEFVMREPILYGDYRTALDEGEPRLYEDMQDYEATKAVFQEILEEYNE-SHTPMNLVLFDDALEHLSRIHRVLRMDRGHALLVGVGGSGKQSLCRLASYAAGCQVFEIMLSRGYNENSFREDLKVLYNKLGTENQKVAFLFTDQHVVEEGFLELINNMLTSGMVPALYADDEKETLVGQLRDEALRAGAGHAKEMIWQYFINKCANNLHIVLAMSPVGDTLRTRCRNFPGTVNNASIDWFFPWPEQALYAVASVFISPENQLIPQEKRQDIVSHVVMVHQSIGVYSIKFLQRLRRNNYVTPKNYLDFINTYVKLLDEQDKFILSQCERLHGGLQKIADASEMLAVLNEKLAVQKVAVTEKTAACEALLAEIAAGTKAATEKKSFAEAKGEEIAEQSKVIEVEKKDAEDALAEALPALEAARLALDDLDKQDVTEIRSFAKPPREVQTVCECIVVLKNIRDVSWKSARGMMSEANFLKTLKEMDVDNISQKQMTTVKGLIKDIDLTLEQMKSISKAGAGLLKFVEAVMGYCAVAKEIRPKREKVAKLEKNFFQAKRDLEKVTKEVQALEEELQELNKKYEQAMTEKQALETEARIMERRLIAADKLISGLGSENIRWSKDLEELKKKRVQLLGDCLVSSAFLSYVGAFSWEFRNDLVYKDWVNDLKERNVPLSDPFRLEDLLTNDVEISKWTSEGLPPDELSIQNGILTTRASRFPMCIDPQQQALNWIKR-----KEEVNNLKVCTFNDPDFLKQLELAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGGQGREFVMLGDKEVDYDPNFRLYLNTKLANPKYGPNVFGKSMVINYTVTLKGLEDQLLSVIVKFERKELEEQRERLIMETSVNKKLLKDLEDSLLRELAQSQGNMLDNVELVETLEETKTKATEVSEKLKLGAKTAIDIEKLRDGYRPAAKRGAILFFVLAEMSQVNTMYQYSLASYLEVFGHSLKKSLPDSILQKRLKNIMDTLTHNIYNYGCTGIFEKHKLLFSFQINIKLEQDKQAVTQDELDFFIKGKVALEKSKRKKPFSWFPDEGWEDCNRLAADYPVFSSLLDDIERNEKAWKKWFDHDAPESQPYPLNYHERLSDFQSLMLLRCFRIDRIYRAVTEYVTKTMGEKYVTPPIISFENVYEQSTPMSPIVFILSPGSDPASDLMKLADRIEFGSNKLKFLSMGQGQEKVALQLLETAISRGQWLMLQNCHLLVRWLRELDKQLEKMTKPHPDFRLWLTTEPTPSFPISILQRSLKVVTEPPNGLKLNMRSTYHKISATALADCEHAAFSSLVFTLAFFHAVVQERRKYGKIGWNVSYDFNESDFRVCMQILNTYLSKAVQNGETKIPWNSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYMGDFIFDKFQPFHFYHDETVDYHIPED-----GPRDVYVDYIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLVDLQPQTG----ESASGISREDFIDQIAQDVLNKLPAEFDLDKIRKNL---GIDISPTTVVLLQELERFNLLIGRMRRSLVTLKRALAGEVGMSSELDDVARSMFNGQIPSIWRRLAPDTLKSLGNWMIHFENRYKQYNTWV--NEAEPPVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTKYP--SADDVTERTTSGCFVHGLYLEGAGWDLQESYLLPQRPKQLIQELPVLKIIPIESHRLKLQNTFRTPVYTTSQRRNAMGVGLVFEADLATQEHISHWVLQGVCLILNTD 4579          
BLAST of Dynein heavy chain vs. TrEMBL
Match: A0A2C9JWZ0 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106071343 PE=4 SV=1)

HSP 1 Score: 1982.99 bits (5136), Expect = 0.000e+0
Identity = 992/1849 (53.65%), Postives = 1367/1849 (73.93%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESE-FIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+++ GLC ST DRF+K  Q +RLWR+EC RV +DR+I ++DKE++   +++++++ F  H+ +V   PILYGDY T   + EPRLYED+QDY   K+ FQE +E YNE     ++LVLFDDALEHL+ IHR+LRMD GHALLVGV GSGK+SL RLA++AA    FEI LS+GY E  FREDLKV+YNKL TEN    FLF DQHV +EGFLELINNMLT GMVP L+ DDEKE L+  + D+  ++G    KE IWQYF   C   LHIVLAMSPVG TLR RCRNFPG VNN +IDWF+PWPEQAL++VA   I P+N LIP +  + +++HVV +H+S+ + S  F  +LRR+NY+T  N++++I TY+ LL+ +D  + ++ +RL  GL K+ + +  + +LN K+A QK+ V EKT +CE L+ EI   T+ AT KK   E K  EI +QSKVI  EK +AE+AL+ A+PALEAA+ +LD+LDK DVTEIR+FA PP+ VQ V E + ++    ++SWKSARG+M++ANF+K L+ +DV+ I  K +  VK  I    LT E +++ SKAGAG LKF+ +V+G+  VA+EIRPK+E+V  LE+ F +A+++LE++ +EV+ LE +L+ L K+++ A  E + L  E  IM+R+L+AA+KL  GL SE  RW  D+   +++RV LLGDCL++SAFL+Y+G F++E+R++LV   W+  L+  N+P S  F++++LLT+DVEISKW S+GLP DELSIQN ILTT+++RFP+CIDPQ+QA+ WIK+     K+E  ++K+   ND  FL+ LE +IK+G P+LF+D DE++DPVIDNVL KNI   +GRE+VMLGD+EVD++P FRLYL +KL+NPK+ P+++ ++ +INYTVTL GLE QLLS +VK ER+ELEE+RE LI+ETS NK++LK+LED LL ELA   GN+LDN EL+ TLE+TK KA +V+++L      + DIE+ RDGYRPAAKRGA+LFFVL  +S +N MYQ+SL SYL VF  ++++S+PDS L KRL NI+ TLT ++Y YGCTGIFEKHK+L S QI ++LE+D   +T +E+DFFIKG + +     +   +W PD  W+D N+L+   P FS +LD +  NE  W+ W+   +PES+ +   Y E  + F+ L LLRC+RIDRI  A+T++VT  MG+++V+PPI +F   +  STP+ PIV I+SPGSDP ++++KLA+ I+F  +K+K+LSMGQGQEK AL L +TA+SRGQWLMLQN HLL++++  ++K+L+ + KPHPDFRLWLTTEP  +FPI ILQ+S K+V EPP+G+K N+  TY KI      D  H  +   +F LAF HA++QERR++GKIGWN+SYDF ESDF+V ++IL TYL+KA +  +T +PWN++KYLIGEVMYGGRAID FDRRIL+TYMDEY GDF+FD+FQ FHFY D+ ++Y+IP++       +++Y +YI+SLP   +P VFGLH NA IGY T   +++W ++++LQPQT     E+    S+E  + ++   +L+KLP  +D++KI++NL     +ISPTTVVLLQEL+RFN+L+ +M  SL TLK+AL GEVGMS ELDD+++S+ NG +P+ WR LAP+T+K LG+W+ H E R  QY TW+   + + P +WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T     S++++T  +  GC+V G+Y+EG GWD++   ++PQ+ +QL+Q +P++++ PIESH+ K  NT + PVY TSQRRNAMG+GLV   DLAT EH SHW+LQG+ L LN+D
Sbjct: 2768 PTPSKFHYIFNLRDLSRIYNGLCLSTPDRFSKEEQFVRLWRNECHRVISDRLINDQDKELIAKKIVSLLEDNFKSHLEFVMREPILYGDYRTALDEGEPRLYEDMQDYEATKAVFQEILEEYNE-SHTPMNLVLFDDALEHLSRIHRVLRMDRGHALLVGVGGSGKQSLCRLASYAAGCQVFEIMLSRGYNENSFREDLKVLYNKLGTENQKVAFLFTDQHVVEEGFLELINNMLTSGMVPALYADDEKETLVGQLRDEALRAGAGHAKEMIWQYFINKCANNLHIVLAMSPVGDTLRTRCRNFPGTVNNASIDWFFPWPEQALYAVASVFISPENQLIPQEKRQDIVSHVVMVHQSIGVYSIKFLQRLRRNNYVTPKNYLDFINTYVKLLDEQDKFILSQCERLHGGLQKIADASEMLAVLNEKLAVQKVAVTEKTAACEALLAEIAAGTKAATEKKSFAEAKGEEIAEQSKVIEVEKKDAEDALAEALPALEAARLALDDLDKQDVTEIRSFAKPPREVQTVCECIVVLKNIRDVSWKSARGMMSEANFLKTLKEMDVDNISQKQMTTVKGLIKDIDLTLEQMKSISKAGAGLLKFVEAVMGYCAVAKEIRPKREKVAKLEKNFFQAKRDLEKVTKEVQALEEELQELNKKYEQAMTEKQALETEARIMERRLIAADKLISGLGSENIRWSKDLEELKKKRVQLLGDCLVSSAFLSYVGAFSWEFRNDLVYKDWVNDLKERNVPLSDPFRLEDLLTNDVEISKWTSEGLPPDELSIQNGILTTRASRFPMCIDPQQQALNWIKR-----KEEVNNLKVCTFNDPDFLKQLELAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGGQGREFVMLGDKEVDYDPNFRLYLNTKLANPKYGPNVFGKSMVINYTVTLKGLEDQLLSVIVKFERKELEEQRERLIMETSVNKKLLKDLEDSLLRELAQSQGNMLDNVELVETLEETKTKATEVSEKLKLGAKTAIDIEKLRDGYRPAAKRGAILFFVLAEMSQVNTMYQYSLASYLEVFGHSLKKSLPDSILQKRLKNIMDTLTHNIYNYGCTGIFEKHKLLFSFQINIKLEQDKQAVTQDELDFFIKGKVALEKSKRKKPFSWFPDEGWEDCNRLAADYPVFSSLLDDIERNEKAWKKWFDHDAPESQPYPLNYHERLSDFQSLMLLRCFRIDRIYRAVTEYVTKTMGEKYVTPPIISFENVYEQSTPMSPIVFILSPGSDPASDLMKLADRIEFGSNKLKFLSMGQGQEKVALQLLETAISRGQWLMLQNCHLLVRWLRELDKQLEKMTKPHPDFRLWLTTEPTPSFPISILQRSLKVVTEPPNGLKLNMRSTYHKISATALADCEHAAFSSLVFTLAFFHAVVQERRKYGKIGWNVSYDFNESDFRVCMQILNTYLSKAVQNGETKIPWNSLKYLIGEVMYGGRAIDDFDRRILRTYMDEYMGDFIFDKFQPFHFYHDETVDYHIPED-----GPRDVYVDYIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLVDLQPQTG----ESASGISREDFIDQIAQDVLNKLPAEFDLDKIRKNL---GIDISPTTVVLLQELERFNLLIGRMRRSLVTLKRALAGEVGMSSELDDVARSMFNGQIPSIWRRLAPDTLKSLGNWMIHFENRYKQYNTWV--NEAEPPVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTKYP--SADDVTERTTSGCFVHGLYLEGAGWDLQESYLLPQRPKQLIQELPVLKIIPIESHRLKLQNTFRTPVYTTSQRRNAMGVGLVFEADLATQEHISHWVLQGVCLILNTD 4594          
BLAST of Dynein heavy chain vs. TrEMBL
Match: V4BRT3 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_122204 PE=4 SV=1)

HSP 1 Score: 1982.61 bits (5135), Expect = 0.000e+0
Identity = 990/1852 (53.46%), Postives = 1368/1852 (73.87%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSG--EISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIP-KFSDILDQVTNNEDEWRNWYKLQSPESE-FIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+++ GLC +T DRF K  Q LR+WR+ECLRV  DR+I  +DKEIV   +  +++  F     +V  +P L+GDY T   + EPRLYED+QDY   K+ FQE +E YNE     ++LVLFDDALEHL  IHR+LRMD GH+LLVGV GSGK+SL RLA+F A    FEI+LS+GY E  FR+DLKV+YN L TEN    FLF DQHV +EGFLELINNMLT GMVP L+ DDEKE ++  + D+  K+G    +E IWQYF   C   LH+V+AMSPVG TLR RCRNFPG+VNN +IDWF+PWPEQAL++VA   I P+N LIP ++ E+++TH+V +H SV   S++F  +LRR+NY+T  N++++I TYL LLE KD  + ++ +RL  GL K+ + +  + +L+ K+A Q++ V EKT +C+ L+ EI I T++AT KK+M ++K  EI +Q+K+I  EK EAE+AL+ A+PALE A+ +L++L+K+DVTEIR+FA PPK VQ V E  C+V+  G  E+SWKSA+G+M++ANF+K L  +DV+ I  K   AVK  + +   T  D++A S+AGAG LKF+ +V+G+  VAREI+PK+E+V  LER +++A+++L+++ +E+  LE +L  L +++++A  E + L +E  IM+R+L AA+KL  GL SE  RW+ ++   + +RV LLGDCL+ SAFL+Y+G F++E+R++LV   W   L+   IP S  FK+++LLT+DVEISKW S+GLP D+LSIQN ILTT+++RFP+CIDPQ+QA+KWIKK     K+E+ ++K+   ND  FL+ LE +IK+G P+LF+D DE++DPVIDNVL +NI   +GRE+VMLGD+EVD++P FRLYL +KL+NPK+ P+++ ++ +INYTVTL GLE QLLS +VK ER+ELEE+RE LI ETS NKR+LK+LED LL ELAT  GN+LDN EL+ TLE+TK KA +V+ +L Q    + DIE+ RDGYRPAAKRGA+LFFVL  +S++N MYQ+SL SYL VF  ++++S+PDS L KRL NI+ TLT +VY YGCTGIFEKHK+L SLQI ++LE+D  ++   E+DFFIKGNI +     +    WLPD  W+D  +L+     KF  +LD +  NE+ W+ WY   +PES+ F   Y++   +F++L LLRC+R+DRI  A+T+++T+VMG+++V+PPI +F A F  STP+ PIV I+SPGSDP ++++KLA  ++F  +K+KYLSMGQGQE+ AL L +TA++RGQWLMLQN HLL+ ++  +EK L+ L KPHPDFRLWLTT+P   FPIGILQ+S K+V EPP+G+K NL  TY KIP     + PHP +   IF LAF HA++QERR++GKIGWN+SYDF ESDF+V ++IL TYLTK+ ++  + +PW ++KYLIGEVMYGGRAID FDRR+L+TYMDEY GDF+FD FQ FHFY ++ ++Y IP EP      ++ Y ++++SLP   +P VFGLH NA IGY T   +++W +++ELQPQT     E+G   S+E+ + ++   +L+KLP  +D++KI++       +ISPTTVVLLQEL+RF+ L+ +M  SL TL++AL GEVGMS ELD+++++L NG +P+ WR LAP+T+K LG+W+ H E+R  QY  W+   + + P +WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T  +  +++++T  +  GC+V G+Y+EG  WD K  C+I QK +QL+Q +P++++ PIESH+ K  NT++ PVYVTSQRRNAMG+GLV   DLATTEH SHW+LQG  L LN+D
Sbjct: 2628 PTPSKFHYIFNLRDLSRIYNGLCLTTPDRFQKPEQFLRVWRNECLRVIGDRLINEQDKEIVNVTMKGLLEENFNSSTEFVLRDPCLFGDYRTALEESEPRLYEDVQDYDASKALFQEILEEYNE-SHTPMNLVLFDDALEHLTRIHRVLRMDRGHSLLVGVGGSGKQSLCRLASFTAGCEVFEITLSRGYSESSFRDDLKVLYNMLGTENKKVSFLFTDQHVVEEGFLELINNMLTSGMVPALYADDEKEGIISGIRDEAIKNGAAHARESIWQYFVNKCANNLHVVMAMSPVGDTLRTRCRNFPGMVNNASIDWFFPWPEQALYAVASVFISPENNLIPDEHRENLVTHIVLVHTSVGHYSKMFLQRLRRNNYVTPKNYLDFINTYLKLLEEKDQYILSQCERLAGGLSKIADASDMLAVLSDKLAVQEVAVREKTAACQELLEEIAIGTKQATEKKEMAQKKGKEIEEQNKIIVVEKKEAEDALAEALPALEMARIALEDLEKSDVTEIRSFAKPPKAVQTVCE--CIVVMRGIREVSWKSAKGMMSEANFLKSLTEMDVDGITPKQTAAVKGLLKEMDTTPADMKAVSRAGAGLLKFVEAVMGYCSVAREIKPKREKVAKLERSYHQAKRDLDKITKEISALESELSKLNQKYEEAMSEKKALQEEAEIMERRLRAADKLISGLGSENVRWVKNLEELKNKRVRLLGDCLLNSAFLSYVGAFSWEFRNDLVYQEWKNDLKEREIPLSDPFKLEDLLTNDVEISKWTSEGLPPDDLSIQNGILTTRASRFPMCIDPQQQALKWIKK-----KEEANNLKVCTFNDPDFLKQLELAIKYGFPFLFQDVDEYIDPVIDNVLERNIKGGQGREFVMLGDKEVDYDPNFRLYLNTKLANPKYGPNVFGKSMVINYTVTLKGLEDQLLSVIVKYERKELEEQRERLIQETSVNKRLLKDLEDSLLRELATSQGNMLDNVELVETLEETKTKASEVSIKLKQGAETAIDIEKLRDGYRPAAKRGAILFFVLAEMSLVNTMYQYSLASYLDVFEFSLKKSLPDSILHKRLRNIMETLTHNVYNYGCTGIFEKHKLLFSLQITIKLEQDQSHLGQEELDFFIKGNIALEKSKRKKPFGWLPDEGWEDCTRLATEFSDKFGTLLDDIEKNENAWKEWYDHDTPESQPFPGRYEQSLAAFQRLMLLRCFRVDRIYRAVTEYITSVMGEKYVTPPIISFEAIFEQSTPMSPIVFILSPGSDPASDLMKLAERLEFGTNKLKYLSMGQGQEQVALQLLETAIARGQWLMLQNCHLLVNWLLELEKHLEKLNKPHPDFRLWLTTDPTPRFPIGILQRSLKVVTEPPNGLKLNLRSTYHKIPATALSECPHPAFSSLIFVLAFFHAVVQERRKYGKIGWNVSYDFNESDFRVCMQILNTYLTKSTDQGDSKIPWASLKYLIGEVMYGGRAIDDFDRRVLRTYMDEYMGDFIFDTFQPFHFYHNEEVDYKIP-EP----GPRDNYIDFLESLPLSNTPEVFGLHPNAEIGYYTQAARDMWSHLVELQPQTG----ESGGGISREEFIDKIATDVLNKLPEEFDLDKIRKKF---GIDISPTTVVLLQELERFDKLIIRMRRSLTTLQRALAGEVGMSSELDEVARALFNGQIPSIWRRLAPDTLKSLGNWMIHFERRFKQYNFWV--NESEPPVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTQYQ--TADDVTERAHSGCFVTGLYLEGAAWDRKEMCLIRQKPKQLIQELPVLKIIPIESHRLKLQNTLRTPVYVTSQRRNAMGVGLVFEADLATTEHISHWVLQGACLILNTD 4455          
BLAST of Dynein heavy chain vs. TrEMBL
Match: A0A2T7PHE3 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_08286 PE=4 SV=1)

HSP 1 Score: 1979.14 bits (5126), Expect = 0.000e+0
Identity = 998/1853 (53.86%), Postives = 1365/1853 (73.66%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSG--EISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPK-FSDILDQVTNNEDEWRNWYKLQSPESE-FIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIP-DEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+++ GLC ST DRF K    LRLWR+ECLRVF+DR+I + DK+++   L  +++  F ++  YV+ +P+L+GDY T   + EPRLYED+QDY   K+ FQE +E YNE     + LVLFDDALEHL  +HR+LRMD GHALLVGV GSGK+SL RLA++AA    FEI+LS+GY E  FR+DLKV+YNKL  EN   +FLF DQHV +EGFLELINNMLT GMVP L+ DDEKE ++  V ++   +GY   +E IWQ+F   C   LHIVLAMSPVG TLR RCRNFPG VNN +IDW++PWPEQAL++VA   I P N LIP    E +++H+V +H SV + S+ F  +LRR+NY+T  N++++I +YL LL+ KD  ++ +  RL  GL K+ + +  + +LN ++A QK+ V EKT +CE L+ EI   T++A+ KK + E K  EI +QS VI  EK EAE+AL+ A+PALEAA+ +LD+LDK+DVTEIR+FA PPK VQ V E  C+V+  G  E+SWKSA+G+M++ANF++ L  +DV+ I  K   AVK  +    ++ E+++A S+AGAG LKF+ +V+G+  VAREI+PK+E+V  LER +++A+++L+++ +E+  LE +L+ L K++++A  E + L +E  IM+R+L+AA KL  GL SE  RW +D+   ++ RV LLGDCL++SAFL+Y+G F++E+R++LV   W+  LR   +P S  F+I++LLT+DVEISKW S+GLP DELSIQN ILTT+++RFP+CIDPQ+QA+KWIK      K+E  ++K+   ND  FL+ LE +IK+G P+LF+D DE++DPVIDNVL KNI   +GRE+V+LGD+EVD++P FRLYL +KLSNPK+ P+++ ++ +INYTVTL GLE QLLS +VK ER+ELEE+RE+LI ETS NKR+LK+LED LL ELAT  GN+LDN EL+ TLE+TK KA +V+++L+     + DIE+ RDGYRPAAKRGA+LFFVL  +S++N MYQ+SL SYL VF  ++++SMPDS L KRL NI+ TLT +VY YGCTGIFEKHK+L S QI ++LE+D   +  +E+DFFIKGNI +          W+PD  W+D N+L+      F  +LD +  NE  W+ W+   +PES+ F   Y E  + F++L LLRC+R+DRI  A+ ++VT +MG+++V+PPI +F + F  STP  PIV I+SPGSDP ++++KLA  I+F  +K+K+LSMGQGQEK AL L +TA++RGQWLMLQN HLL++++  +EK+L+ L+KPHPDFRLWLTTEP   FPIGILQ+S K+V EPP+G+K NL  TY KIP+    +  H  +   +F LAF HA++QERR++GKIGWN+SYDF ESDF+V ++IL TYLTKA E+  T +PWN++KYLIGEVMYGGRAID FDRRIL+TYM+EY GDF+FD FQ FHFY D+ ++Y IP D P      ++ Y +YI++LP   +P VFGLH NA IGY T   +++W +++ELQPQT     E+G   S+E+ + ++   +L+KLP  ++++KI++       ++SPTTVVLLQEL+RFN L+ +M  SL TLK+AL GEVGMS ELDD+++SL NG++P  WR LAP+T+K L +W+ H E+R  QY +W+  G  + P +WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T  +    E++T  +  GC+V G+Y+EG GWDVK  C+I QK +QL+Q +P++++ PIE+H+ K  NT + PVYVTSQRRNAMG+GLV   DLATTEH SHW+LQG+ L LN+D
Sbjct: 2793 PTPSKFHYIFNLRDLSRIYSGLCLSTPDRFKKPEHFLRLWRNECLRVFSDRLIIDTDKDMISKKLNGLLEENFKQYTEYVERDPVLFGDYRTALEEGEPRLYEDIQDYEACKALFQEILEDYNE-SNTPMKLVLFDDALEHLTRVHRVLRMDRGHALLVGVGGSGKQSLCRLASYAAGCDVFEITLSRGYSENSFRDDLKVLYNKLGMENKKTVFLFTDQHVVEEGFLELINNMLTSGMVPALYADDEKEAIIGQVRNEAMAAGYAHARESIWQFFVNKCANNLHIVLAMSPVGDTLRTRCRNFPGTVNNASIDWYFPWPEQALYAVASVFISPDNTLIPETKREDIVSHIVLVHLSVGVYSKKFLQRLRRNNYVTPKNYLDFINSYLKLLDEKDKYIQAQCDRLAGGLQKIADASEMLAVLNERLAVQKVAVTEKTAACEALLEEIASGTKQASEKKVVAEAKGKEIEEQSVVIVHEKKEAEDALAEALPALEAARLALDDLDKSDVTEIRSFAKPPKAVQTVCE--CIVVMRGIREVSWKSAKGMMSEANFLRSLTEMDVDNISQKQTQAVKALLKDIDMSPEEMKAISRAGAGLLKFVEAVMGYCAVAREIKPKREKVAKLERTYHQAKRDLDKINKEISALEAELQDLNKKYEEAMAERQALEEEARIMERRLIAAGKLISGLGSENIRWSNDLEELKKARVRLLGDCLVSSAFLSYVGAFSWEFRNDLVYQDWVNDLRKREVPLSDPFRIESLLTNDVEISKWTSEGLPPDELSIQNGILTTRASRFPLCIDPQQQALKWIKN-----KEEQNNLKVCTFNDPDFLKQLELAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGGQGREFVVLGDKEVDFDPNFRLYLNTKLSNPKYGPNVFGKSMVINYTVTLKGLEDQLLSVIVKFERKELEEQRESLIQETSVNKRLLKDLEDSLLRELATSQGNMLDNTELVATLEETKTKATEVSEKLALGAATAVDIEKTRDGYRPAAKRGAILFFVLAEMSLVNTMYQYSLASYLEVFQHSLKKSMPDSILQKRLRNIMDTLTHNVYNYGCTGIFEKHKLLFSFQITIKLEQDQAKVKQDELDFFIKGNIALEKSKRRKPFGWIPDEGWEDCNRLTAEYSNTFGTLLDDIERNEKTWKAWFDHDTPESQPFPMQYNEVLSQFQRLMLLRCFRVDRIYRAVMEYVTKIMGEKYVTPPIISFESVFDQSTPASPIVFILSPGSDPASDLMKLAERIEFGSNKLKFLSMGQGQEKVALQLLETAIARGQWLMLQNCHLLVRWLRELEKQLEKLVKPHPDFRLWLTTEPTPNFPIGILQRSLKVVTEPPNGLKLNLRSTYHKIPSTALAECVHEAFPSLVFVLAFFHAVVQERRKYGKIGWNVSYDFNESDFRVCMQILNTYLTKAQEQADTKIPWNSLKYLIGEVMYGGRAIDDFDRRILRTYMNEYMGDFIFDTFQPFHFYCDETVDYCIPVDGP------RDNYVDYIETLPLANTPEVFGLHPNAEIGYYTQAARDMWSHLVELQPQTG----ESGAGISREEFIDKIATDVLNKLPAEFELDKIRKKY---GLDVSPTTVVLLQELERFNSLIGRMRKSLATLKRALAGEVGMSSELDDVARSLFNGVIPGIWRRLAPDTLKSLANWMIHFEKRFSQYNSWVNEG--EPPVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVT--QYVLPEDVTERTTQGCFVHGLYLEGAGWDVKQTCLIRQKPKQLIQELPVLKIIPIEAHRLKLQNTFRTPVYVTSQRRNAMGVGLVFEADLATTEHISHWVLQGVCLILNTD 4620          
BLAST of Dynein heavy chain vs. TrEMBL
Match: A0A2R2MKY4 (dynein heavy chain 10, axonemal-like OS=Lingula unguis OX=7574 GN=LOC112041633 PE=4 SV=1)

HSP 1 Score: 1979.14 bits (5126), Expect = 0.000e+0
Identity = 997/1855 (53.75%), Postives = 1366/1855 (73.64%), Query Frame = 1
Query:   85 MLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSG--EISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLS-ITIPKFSDILDQVTNNEDEWRNWYKLQSPESE-FIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI-WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            M PTP+KFHY  NLRDLS++  GLC +T DRF   ++ +R+WR+ECLRV  DR+I   D+E V   + N+++  F K + +V   PIL+GDY T   + EPRLYED+QD+   K+ FQE +E YNE +   ++LVLFDDAL HL  +HR++RMD GHALLVGV GSGK+S++RLAA+ A    FEI+LS+GY E  FR+DLK++YNKL  EN   +F+FGDQHV +EGFLELINNMLT GMVP L+ DDEKE ++  + ++  K+G    +E IW YF   C   LHIV+AMSP G TLR RCRNFPG+VNNTNIDWF+PWPEQAL++VA   + P+NPL+P      +++H+V +H+SV   S  F  KLRR NY+T  N++++I TYL LLE KD  +  + +RL  G+ KL   + Q++ LN K+A QK+ V EKT +CE L+ EI      A  KK M E K VEI +QSK+I++EK +AE +L+ A+PALEAA+ +LD+LDK+DVTEIR+FA PPK VQ V E  C+V+  G  E+SWKSA+G+M++ANF+K L  +DV+AI  K ++ VK  + + ++T ++++  SKAG G LKF+ +VLG+  VAREI+PK+++V  LE+ +++A+++L+++ +EV  LE  L  L +++++A  E + L +E  IM+R+L+AA+KL  GL SE  RW  ++   +Q R+ LLGDCL  SAFL+Y+G F++E+R  ++ + W  ++  + IP S+ F ++ LLT+DVEISKW S+ LP DELSIQN ILTT+++RFP+CIDPQ+QA+ WIKK     K+E  ++K+S+ ND  FL+ LE +IK+G P+LF+D DE++DPVIDNVL KNI   +GRE++MLGD+EVD++P FRLYL +KLSNPK++P+ + ++ +INYTVTL GLE QLLS +VK+ER+ELEE+RE LI ETS NK +LK+LED LL ELAT TGN+LDN +LI TLE+TKAKA +VA++L      + DI++ RDGYRPAAKRGA+LFF+L  ++ IN MYQ+SL +YL VF  ++++S+PD+ L KRL NI+ TLT +VY YGCTGIFEKHK+L S QI ++LE D   I   E+DFFIKG+I +          W+P+  W+D+ +L+ I    F  IL+ V  NE EW+ W+   SPES+ F   Y++  + F++L LLRCWR+DRI  AITD++T VMG+++V+PPI +F A F  STP  PIV I+SPGSDP ++++KLA    F  +K+K+LSMGQGQEK A+   +TAV+RGQWLMLQN HLL++++  +EK+++ L KPHPDFRLWLTTEP S FPIGILQ+S K+V EPP+G+K NL  TY KIP    ++ PHP +   +F LAF HA++QERR++GKIGWN+ YDF ESDFQV ++IL TYLTKAHE  +T +PWN++KYLIGEVMYGGRAID+FDRRIL TYMDEY GDF+FD FQ FHFY ++ ++Y IP+     + ++++YT+YI++LP   +P VFGLH NA IGY T+  +E+W N++ELQPQT     E G   S+E  + ++   +L KLP  YD++KI++ L     EI+PTTVVLLQEL+RFN+L+K+M  SL+TLK+AL GEVGMS ELDD++KSL NG +P  WR LAP T+K LG+W+ H ++R  QY  WI     D P++ WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T+ ++   E++T  +  GC+V G+Y+EG GWD++ GCII QK ++L+Q +P++++ PIE+H+ K  NT++ PVYVTS+RRNAMG+GLV   DL TTEH SHW+LQG+AL+LN+D
Sbjct: 1646 MPPTPSKFHYIFNLRDLSRITNGLCLTTPDRFPTVDKFVRVWRNECLRVIYDRLINEADQEQVTGYIKNLLEENFKKELEFVMREPILFGDYRTALDEAEPRLYEDIQDFEASKALFQEILEEYNE-NHTPMNLVLFDDALSHLTRVHRVIRMDRGHALLVGVGGSGKQSITRLAAYTASCEVFEITLSRGYSENSFRDDLKILYNKLGIENKKVVFMFGDQHVVEEGFLELINNMLTSGMVPALYPDDEKEGIIGQIRNEAMKAGSGPARENIWNYFVNKCANNLHIVMAMSPTGDTLRTRCRNFPGMVNNTNIDWFFPWPEQALYAVASVFVSPENPLVPEDQHSKIVSHIVHVHQSVTTYSIEFLQKLRRLNYVTPKNYLDFISTYLRLLEEKDNFILAQCERLGGGMTKLAEASGQLNELNEKLAVQKVAVTEKTAACEELLEEIATGKAHAEEKKAMAEAKGVEIEEQSKIISEEKADAEASLAEALPALEAARLALDDLDKSDVTEIRSFAKPPKMVQTVCE--CIVVMRGIKEVSWKSAKGMMSEANFLKSLTEMDVDAITPKQVSTVKGFLKEGEVTQDEMKTISKAGYGLLKFVDAVLGYCVVAREIKPKRDKVARLEKSYHQAKRDLDKITKEVATLESTLADLAQRYENAIAEKQALQEEAEIMERRLIAADKLISGLGSENVRWTKELEELKQMRIRLLGDCLQGSAFLSYVGAFSWEFRSAMMNDNWEKNILDLQIPMSQPFALEQLLTNDVEISKWTSESLPPDELSIQNGILTTRASRFPLCIDPQQQALNWIKK-----KEEPHNLKVSSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNIKGGQGREFIMLGDKEVDYDPNFRLYLNTKLSNPKYTPAHFGKSMVINYTVTLKGLEDQLLSVIVKSERKELEEQRERLIQETSANKSLLKDLEDALLRELATSTGNMLDNTDLIQTLEETKAKASEVAEKLKLGAKTAIDIDKLRDGYRPAAKRGAILFFILAEMASINTMYQYSLAAYLDVFQFSLKKSLPDTILQKRLRNIMDTLTHNVYNYGCTGIFEKHKLLFSFQITVKLEMDEQRIRQEELDFFIKGSIALEKSKRGRPFKWVPEQGWEDMIRLAEIEKGAFGTILEDVEKNEKEWKQWFDHDSPESQPFPLKYEDSLSDFQRLMLLRCWRVDRIYRAITDYITKVMGEKYVTPPIISFEAIFEQSTPTSPIVFILSPGSDPASDLMKLAERTGFGTNKLKFLSMGQGQEKIAMQFLETAVARGQWLMLQNCHLLVRWLRDLEKEIEKLAKPHPDFRLWLTTEPTSAFPIGILQRSLKVVTEPPNGLKLNLRSTYFKIPATALVECPHPAFPSLVFVLAFFHAVVQERRKYGKIGWNVPYDFNESDFQVCMQILNTYLTKAHENNETKIPWNSLKYLIGEVMYGGRAIDNFDRRILNTYMDEYMGDFIFDTFQPFHFYVNEEVDYKIPE-----TGMRDVYTDYIETLPLTNTPEVFGLHPNAEIGYYTSAAREMWSNLVELQPQTG----ETGSGISREDFIDKIASDVLAKLPPEYDMDKIRKKL---GIEITPTTVVLLQELERFNILIKRMRVSLSTLKRALAGEVGMSNELDDVAKSLFNGQLPGIWRRLAPATLKSLGNWMTHFQKRNSQYTVWIEE---DEPNVMWLSGLHIPESYLTALVQATCRKNGWPLDKSTLYTSVTSYQN--PEDVTERAHQGCFVHGLYLEGAGWDIEKGCIIRQKPKELIQELPVLKVIPIEAHRLKLQNTLRTPVYVTSERRNAMGVGLVFEADLFTTEHISHWVLQGVALSLNTD 3475          
BLAST of Dynein heavy chain vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1863.2 bits (4825), Expect = 0.000e+0
Identity = 958/1851 (51.76%), Postives = 1346/1851 (72.72%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIP-KFSDILDQVTNNEDEWRNWYKLQSPE-SEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI-WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+V+ GL  +  +RF    Q +R+WR+ECLRVF DR+I   DK +VQ  + ++++  F   +     +PIL+GDY T   + EPR+YED+QDY   K+ FQE +E YNE ++ +++LVLFDDAL+HL  +HRI+RMD GHALLVGV GSGK+SL++LAAF A    FEI LS+GY E  FREDLK +Y KL  EN   +FLF D HVA+EGFLELINNMLT GMVP LF DDEKE +L  + D+  K G   +KE +WQYF     + LHIVL MSPVG  LR RCRNFPG+VNNT IDWF PWP QAL +VA   +  ++P+IP+ + E VI HV  +H SV   S +FQ KLRR NY+T  N++++I TY +LL+ KD  +  + +RL  GLDKLE  + Q+  LN K+AEQK+++ EK+ +CE L+ EI+ +T  A  KKK+ EEK+ EI +Q+KVI  EK +AE +L+ A+PALEAA+ +L +LDK+DVTEIR+FA PPK VQ+V E + ++    EI+WK+A+G+M++ANF++ L  +D ++I    +  V+  +     + E+++A SKAG+G LKF+ +V+G+ DVAREI+PK+E+V  LE+ F ++++ELE++Q E+  ++ +L  L +++  A  E + L +E  +M+R+L+AA+KL  GL SE  RW  D+   +++RV LLGDCLI++AFL+Y G F +++R+ +V   W   +    IP S+ F+I++LLT +VEIS+W S+ LP DELS+QN ILTT+++RFP+CIDPQ+QA+ WIKK E     E  ++KIS+ ND  FL+ LE +IK+G P+LF+D DE++DPVIDNVL KN+  ++GR+ ++LGD+EVD++P F+LYL +KL+NPK+SP+++ +A +INYTVTL GLE QLLS +V  ER+ELEE+RE LI ETS+NKR+LK+LED LL ELAT TGN+LDN EL++TLE+TK+KA +V ++L  +   SADI++ RDGYRPAAKRGA+LFFVL  ++++N+MYQ+SL S+L VF  ++R+S+P+S L KRL+NI+ TLT +VY YGCTG+FE+HK+L S  + +++E+  G     E++FF+KGN+++     +   +WLPD  W+D+ +L+   P +F  +++ +  N  EW+NW+ L SPE + F   Y++    F+KL LLRC+R+DR+  A++D+VTA MG+++V PP+ +F A F  STP  PIV I+SPG +P  +++KLA    F  +++K+L+MGQGQEK AL L +TAVSRGQWLMLQN HLL+K++  +EK L+ + KPHPDFRLWLTT+P+  FPIGILQKS K+V EPP+G+K N+  TY KI  E  +  PHP YR  ++ LAF HA++QERR++GKIGWN+ YDF ESDF V ++IL TYLTKAH + + ++PW ++KYLIGEVMYGGRAIDSFDRRIL  YMDEY GDF+FD FQ FHF+ +  ++Y IP +       KE+Y E I+SLP   +P VFGLH NA IGY T   +++W ++IELQPQT D    +G   S+++ ++++   I +KLP  +D++ I++ L     ++SPT+VVLLQEL+RFN L+ +M  SL+ L++AL GEVGMS ELD+++++L NG +P  WR LAP+T+K LG+W+ H  +R  QY +W+  G+   P++ WLSGLH+P+SYLTALVQ  CRRN W LD  TL T +T+   RS + +T     GCYV G+Y+EG  WDV+ GC++  K ++L+  +PI+++ PIE+H+ +  NT++ PVY TS RRNAMG+GLV   DL TTEH+SHW+LQG+ L LNSD
Sbjct: 2514 PTPSKFHYIFNLRDLSRVYNGLTLTNAERFLTEAQFVRVWRNECLRVFYDRLINETDKALVQGHIKSLIQEHFGSELDSAMRDPILFGDYRTALSESEPRVYEDIQDYDACKALFQEILEEYNE-NKTRMNLVLFDDALDHLTRVHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGCDVFEIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVLNQIRDEAVKMGSGHSKESVWQYFINKSASNLHIVLGMSPVGDVLRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQSFLG-ESPMIPAAHSETVIGHVCMVHGSVGEFSTLFQQKLRRSNYVTPKNYLDFISTYSTLLQDKDQFILAQCKRLEGGLDKLEEASVQLADLNKKLAEQKVVLAEKSSACESLLQEISTNTAIAEEKKKLAEEKAKEIEEQNKVILVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFAKPPKQVQVVCECILVMRGHKEINWKTAKGMMSEANFLRSLMEMDCDSISGGQVKTVRGFLKNLNTSSEEMQAISKAGSGMLKFVEAVMGYCDVAREIKPKREKVARLEKNFFQSKRELEKIQSELEAIQKELGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDVLERGIPLSQPFRIESLLTDEVEISRWGSESLPPDELSVQNGILTTRASRFPMCIDPQQQALNWIKKKE-----EKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNVKGAEGRQVIVLGDKEVDYDPNFKLYLNTKLANPKYSPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLIQETSQNKRLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKSKAGEVFEKLKLAETTSADIDKLRDGYRPAAKRGAILFFVLAEMALVNSMYQYSLASFLEVFDYSLRKSLPNSILPKRLSNIMNTLTLNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQEELEFFLKGNLSLEKSKRKKPCDWLPDQGWEDIVRLNELFPNEFGALIEDIEKNPKEWKNWFDLDSPEQAPFPMKYRDSLTVFQKLLLLRCFRVDRVYRAVSDYVTATMGEKYVQPPVISFEAIFEQSTPNSPIVFILSPGCEPANDLMKLAERSGFGTNRLKFLAMGQGQEKVALQLLETAVSRGQWLMLQNCHLLVKWLKDLEKALERITKPHPDFRLWLTTDPIRDFPIGILQKSLKVVTEPPNGLKLNMRATYFKIQLETLMSCPHPAYRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILNTYLTKAHNQGEGSIPWGSLKYLIGEVMYGGRAIDSFDRRILTVYMDEYLGDFIFDTFQPFHFFHNKDVDYRIPPDGS-----KEVYVEEIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGD----SGGGISRDEYIAQVARDIQNKLPSAFDLDVIRKKL---GPDVSPTSVVLLQELERFNRLVLRMSRSLSELQRALAGEVGMSSELDEVARALFNGQIPAIWRKLAPDTLKSLGNWMIHFRRRHQQYSSWVEVGE---PAVMWLSGLHIPESYLTALVQATCRRNGWPLDRSTLYTHVTHY--RSEDEVTEKPGQGCYVSGLYLEGADWDVEQGCLVRSKPKELVVQLPILKVIPIEAHRLRLQNTLRTPVYTTSMRRNAMGVGLVFEADLFTTEHHSHWVLQGVCLYLNSD 4340          
BLAST of Dynein heavy chain vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 1086.63 bits (2809), Expect = 0.000e+0
Identity = 654/1898 (34.46%), Postives = 1030/1898 (54.27%), Query Frame = 1
Query:   25 ILKEAFSATFY*ILREIKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINP----ILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQG--QLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHV----VTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKE----KGEAEEA---LSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININH--VFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPE-SEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLI--KPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHP-KYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI--WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMG-IGLVTVLDLATTEHN-SHWILQGIALTLNSDD 5637
            IL +A    +Y     I  + LPTP K HY  NLRD+SKVFQGL +S  D       + RLW HEC RVF+DR++   D E    +L   + + F   + Y  I P     ++GD+  E     P +YEDL D+  +K F +  +E YN L  G   + LVLF DA+EH+  + R++    G+ LLVG+ GSG++SLSRLAA+  +   F++ ++K Y ++EFRED+K +Y     +N   +FLF D  +  E FLE INN+L+ G VP L+  DE EE+   + D   K    E  + ++ Y        LHIVL MSPVG   RNR R +P +VN T +DWF  WP+ AL  VA   +D    LI     E + T V    VT+H+SV   SQ  +L+L+R NY+T TN++  +  Y  LL  K  +L  +  +L  GL K+++T  ++  ++ ++ + K  V E    CE  ++ I         +K+  +E+ + ++  S+ I  E    K  AE A   L  A+PALE A ++L+ L+K D+TEI+++  PP  V+ V + + ++L+  E +W  A+  + ++NFIK+L   D + I  + +  +     +     E +   S A      ++ ++  +  + R + PK+ R+     +  + +  L   + + R++E +LK LK Q+D+  ++ E L K+   M+ +L  A KL  GLA E+ RW   V   +++   L+GDCL+A+AFL+Y+GPF   YR  L+ N W+   R + +P S  F     L+    +  WN QGLP D  S +N ++ T+  R+P+ +DPQ QA+KWIK ME       + +K+ +L    FLR LEN+++FG P L ++  E +DP +  +L+K+     GR  + LGD+EV++ P F+ Y+T+KLSNP ++P + ++  I+N+ V   GLE QLL  +V+ ER ELEE++++L++  +  KR L+ELED++L  L   TG++LD+ +L+NTL+ +K  A +V+ QL  S      I+  R+ YRP A+R ++LFFVL ++  I+ MYQFSL +Y+ +F  +I +S     L +R+ N+    T+ VY Y C G+FE+HK+L S  +  ++ E  G +  +E  FF++G + ++         T+WL D++W ++ +L   +  F  ++        +W  WY    PE +     ++   N  +K+ ++R  R DR+   +  F+   +G  FV PP+    A    ST   P++ ++SPG DP   +V+LA +          LS+GQGQ   A  +    V  G W+ L N HL + ++  ++K ++ L     HPDFRLWL++ P   FPI ILQ   K+  EPP G+K N+   Y  +    F     P  YR+ +F L F H+IL ER++F ++GWNI Y F +SDF+VS  ++  YL +  E     +PW+ +KYLI  V YGG   D +DRR+L TY+++YF +   +              YYIP +  +     + Y EYI+ LP  + P VFG H NA I    + T+ L+  ++ LQPQ             ++KVL E+   +  K+P L D    ++ L    ++ SP  VVLLQE+ R+N LL  +  SL  L+K + G V MS  L+++ + + +  +P  W    P ++K L SW   L QR  Q+  W    +   P +  WLSG   P  +LTA++Q + R++N ++DT +   I++  +D    NL    + G ++ G+Y+EG GWD KN C++  +  QL+  MP I   P+E+ K    N    P Y    R    G    V  +DL +   +  HWI +G AL ++ D+
Sbjct: 2565 ILTQATLELYY----AISARFLPTPAKIHYLFNLRDISKVFQGLLRSHRDFHDTKQSITRLWIHECFRVFSDRLVDQADTEAFVALLAEKLGSLF--DLTYHNICPNKQQPIFGDFLKE-----PHVYEDLLDFKALKGFMESQLEDYN-LTPGVVPMSLVLFRDAIEHVTRVVRVISQPRGNMLLVGIGGSGRQSLSRLAAYICEYMVFQVEVTKQYRKQEFREDIKKLYRLTGVDNKPTVFLFNDTQIIDESFLEDINNILSSGEVPNLYKSDEFEEVQSALSDSARKENVLETADAMFNYLIERVRNNLHIVLCMSPVGEPFRNRIRQYPALVNCTTLDWFSEWPQDALLEVAERYLD---GLILGNV-EKIQTKVARIFVTMHQSVAQFSQRMKLELKRHNYVTPTNYLELVSGYKKLLAEKRAELGEQVSKLRNGLFKIDDTRSKVEAMSVELEDAKKKVAEIQKQCEEYLVVI-------VQQKREADEQQMAVSAHSEKIGAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAV-MILRGCEPTWAEAKRQLGESNFIKQLVHFDKDNISDRVLKKIGQYCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGLAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIWMKQFRDLEVPCSPGFNFATFLSKPTAVRDWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNME-----SKRGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSFTHIGGRVLLKLGDKEVEYNPDFQFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVSDQLETSEQTEIKIDTAREAYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNLSIEKSQRSHKLEERIINLNDYHTYAVYRYTCRGLFERHKLLFSFHMCAKILEVAGKLNMDEYSFFLRGGLVLDKEGQMDNPCTSWLADSNWDNITELD-KLANFHGLMSSFEKYPKDWHQWYTSSEPENAPLPGEWETVCNELQKMLIVRSLRQDRVSFCVNSFIINNLGSRFVEPPVLDMKAVMEDSTTKTPLIFVLSPGVDPTGALVQLAEASGMG-PSFHALSLGQGQAPIATRMIKEGVKNGHWVFLANCHLSLSWMPQLDKLVEQLQVEDSHPDFRLWLSSSPHPEFPIAILQAGIKMTTEPPKGVKSNMKRLYQLVTESQFSRCSRPVVYRKLLFSLCFFHSILLERKKFLQLGWNIVYSFNDSDFEVSENLMSLYLDEYEE-----IPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCEGAVNTPFFKL---SSLPTYYIPRDGSQ-----DTYREYIRQLPPVEHPEVFGQHPNADIASQISETRTLFDTLLSLQPQVTSTTATGAGPSREDKVL-EISADVRQKVPELVDYESTQKLL---QDDPSPLNVVLLQEIQRYNALLHTIRTSLTELEKGIKGLVVMSSSLEEMFQCIHDARVPPLWEKAYP-SLKPLASWTRDLCQRVEQFAHW---AETAHPPVLFWLSGFTFPTGFLTAVLQSSARQHNVSVDTLSWEFIVSTVDD---NNLLFPPKDGVFIRGLYLEGAGWDKKNSCLVEAEPMQLVCPMPTIHFRPVENRKKVAKNMYSCPCYYFPVRSGGAGRPSFVVGVDLKSGAVSYEHWIKRGTALLMSLDN 4407          
BLAST of Dynein heavy chain vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 989.178 bits (2556), Expect = 0.000e+0
Identity = 618/1872 (33.01%), Postives = 1027/1872 (54.86%), Query Frame = 1
Query:   67 REIKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLD-DEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPV-QIVGELLCLVLQSGEI----SWKSARGLMADAN-FIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYW---LASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSID--FEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIK-PHPDFRLWLTTEPVST-----FPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVF-LDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTL 5625
            + +    LPT  KFHY  NLRDLS +FQG+     +       +++++ HE  RV+ D+M+ ++D       L + M  +F + M        +   Y    L   EPR Y  +Q +  +     E ++SYNE++   ++LVLF DA+ H+  I+RIL    G+ALLVGV GSGK+SL+RLAAF + L  F+I+L KGYG  + + DL  +  K   +N   +FL  D  VA E FL L+N++L  G +P L+ DDE E ++  V ++    G  +++E  W++F      +L + L  SPVG  LR R R FP +VN T IDWF+ WP++AL SV+   +     + P +  + V   +  +H SV   S+ +    RR NY T  +F+  IK Y +LL  K  DL  K +RL  GL KL +T+ Q+  L AK+A Q++ +++K    +RL+  + + TE+ + +K + +E+  ++   + V+T+++ + EE L+ A PAL AA+ +L+ L+KN++TE+++F +P   V  +   ++ L+   G +    SWK+A+ +MA  + F+  L   + E I    + A++  +   +   E V A S A AG   ++I+++ FY+V  E+ PK++ +     E   A+++L  ++ ++  L   L  L  +F+ A  +  +  +E     R +  A +L  GLASE  RW   V  F+Q+   L GD L+ +AF++YLG FT  YRH L++N W   L+ L+ + IP +      ++L  D +++ W ++GLP D +S +NA + T   R+P+ +DPQ Q +KWIK       D  + I+I       +L ++E ++  G   L E+ +E VDPV+  +L +  IK KGR Y+ +GD+E ++ P FRL L +KL+NP + P L ++  ++N+TVT  GLE QLL+A+V  ER +LEE + NL  + +  K  LK LED LL  L++ +GN L + EL+  LE TK  A ++ +++ ++ +  A I   R+ YRPAA R ++L+F++ +L+ I+ MYQFSL ++ VVF KA+ ++ PD +L +R+ N+I ++T  V+ Y   G+FE  K+  + Q+A ++      I  +E+DF ++  +      P    ++L  +SW  +  L  ++ +F ++   + ++   W+ + + + PE E      +   S +KLC++R  R DR+  AI DFV   +G ++V      F  +F  S    P+  I+SPG DP  ++ K   ++   F+      +S+GQGQE  A    D A   G W++LQN HL+ K++  +EKKL+   +    +FR++++ EP S+      P GIL+ S KI  EPP G+  NL         +   + +   +++  +F L + HA++ ERR+FG  GWN SY F   D  +S+ +L  YL        + VP++ ++YL GE+MYGG   D +DRR+ +TY++E+    + +              Y  P  P   +     Y +YI      +SP ++GLH NA IG+ T  +++L++ ++E+QP+  D     G   S+++ +  ++   L KLP  +++ +    L+    E SP  VV LQE +R N+L +++  SL  L   L GE+ M+ +++++  ++    +P+ W   A  +M  L  W   L  R  + E+W +   +  P++WL+G   PQS+LTA++Q   RRN W LD  +L   +     ++ E+ +     G YV G+++EG  WD + G I+  + ++L  ++P+I +  +   K +T N  Q PVY T QR    G   V   +L T E+ S W L G+AL L
Sbjct: 2499 QRVTATFLPTAIKFHYIFNLRDLSNIFQGMLFCKSECMKTPQDLVKVYLHESNRVYRDKMVEDKDFSTFDK-LQSEMVGKFYEDMEEALEEAKVMNMYCHFALGIGEPR-YMPVQSWESLNKTLLEALDSYNEVNAA-MNLVLFGDAMSHICRINRILESPRGNALLVGVGGSGKQSLTRLAAFISSLEVFQITLKKGYGITDLKSDLGALCIKAGVKNIGTVFLMTDAQVADEKFLVLVNDLLASGEIPDLYPDDEVENIINSVRNEVRGQGLLDSRENCWKFFIERVRRQLKVALCFSPVGSKLRVRSRKFPAVVNCTVIDWFHEWPQEALESVSLRFLQEVEHIEP-EVKDSVSKFMAYVHVSVNKTSKDYLANERRYNYTTPKSFLEQIKLYRNLLALKRKDLTMKMERLENGLQKLNSTSAQVDDLKAKLAAQEVDLKQKNEDADRLIQVVGVETEKVSREKAVADEEEEKVASIAVVVTRKQKDCEEDLAKAEPALIAAQEALNTLNKNNLTELKSFGSPVAAVTNVTAAVMVLMAPGGRVPKDRSWKAAKVMMAKVDAFLDSLMNFNKENIHENCLKAIQPYLQDPEFKPELVAAKSNAAAGLCSWVINIVKFYEVYCEVEPKRQALNKANAELASAQEKLSVIKAKINHLNENLAKLTAKFEKATADKLKCQQEAETTARTISLANRLVGGLASENVRWAEAVNNFKQQERTLCGDVLLITAFVSYLGYFTKRYRHELMDNTWKPYLSQLK-VPIPVTPGLDPLSMLMDDADVAAWQNEGLPADRMSTENATILTSCERWPLMVDPQLQGIKWIKN---KYGDNLQVIRIGQRG---YLDSIERALSAGEVVLIENLEEAVDPVLGPLLGQETIK-KGR-YIKIGDKECEYNPRFRLILHTKLANPHYQPELQAQCTLMNFTVTRDGLEDQLLAAVVSMERPDLEELKSNLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGDTELVENLEITKRTAAEIEEKVKEAKVTEAKINEAREHYRPAAARASLLYFIMNDLNKIHPMYQFSLKAFSVVFQKAVLKAAPDEALKQRVLNLIDSITSSVFQYTTRGLFECDKLTYTAQLAFQILLMNKEINPSELDFLLRYPVQPGVTSP---VDFLSHHSWGGIKALC-SMDEFRNLDRDIESSAKRWKKFVECECPEKEKFPQEWKNKTSLQKLCMMRALRPDRMNYAIRDFVEEKLGSKYVMGRSVDFAVSFEESGAATPMFFILSPGVDPLKDVEKHGRTMGYTFDNQNFHNVSLGQGQEVVAEQALDLAAREGHWVILQNIHLVAKWLGTLEKKLEQHGEGSSQNFRVFISAEPSSSPEGHIIPQGILENSIKITNEPPLGMHANLHKALDNFNQDTLEMCARENEFKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLYNYL-----EANSKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIKPEMMEGEL-----------YLAPGFPLPGNMDYNGYHQYIDDALPAESPYLYGLHPNAEIGFLTQTSEKLFRTVLEMQPR--DAGSGEGSGTSRDEKVKAVLEETLEKLPEEFNMVE----LMGKVEERSPYVVVALQECERMNILTQEIKRSLKELNLGLKGELTMTNDMENLQNAIYLDQVPDSWTKRAYPSMCGLALWFTDLLNRIRELESWSSDFNLP-PAVWLAGFFNPQSFLTAIMQSTARRNEWPLDKMSLQCDVLK---KNREDFSSPPREGAYVHGLFMEGARWDTQAGVIVDARLKELTPAIPVIFIKAVPVDKQETRNVYQCPVYKTRQR----GPTYVWTFNLKTKENPSKWTLAGVALLL 4323          
BLAST of Dynein heavy chain vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 964.526 bits (2492), Expect = 0.000e+0
Identity = 608/1887 (32.22%), Postives = 995/1887 (52.73%), Query Frame = 1
Query:   76 KLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKH-------------MPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQ-LDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKS--GYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQ-----QSKV--ITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSG-------------EISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININ-HVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFI-DYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRN-NWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIAL 5619
            K+KMLPTP  FHY  NLRDLS+++QG+     D       +L LW+HEC RV  DR  + ED     ++L N+++ E  +              + ++Q  P   G+       D P++YE +  +  ++     F+  YNE  +G  +DLV F DA+ HL  I RI+R   G+ALLVGV GSGK+SL+RLA+F A    F+I+L++ Y      EDLK +Y     +     F+  D  +  E FLE +NN+L+ G V  LF  DE +E+L  +     +     P   E + +YF +     LH+VL  SP           FP +++   +DWF  WP+ AL +V+ + +   +     Q    V+  + +    V  +   +  + RR  ++T  +++++I+ Y ++ + K   LE+ +  +  GL KL+  +  +  L+    E ++  +E  I+ E+     ++  +E T+K    E+  +E+ +     Q+ V  I+ +K  A+E L  A PALE A+ +L  +  +D+  +R  A PP  +  + + + L+ Q                 SW+ +  LM   NF+  LQ    + I  + +  +           E  +      AG   +  ++  F+ + RE+ P K  + + E     A  +L++ Q E+   + +L  ++ +++ A  E + L ++    + ++  A  L  GLA EK RW      F  +   L+GD L+A+AFL+Y GPF  E+R NL+ + W   +R+  IP   N  +  +L     +S+WN QGLP D+LSIQN I+ TK+ RFP+ IDPQ Q   WI+      K+    ++I++LN   F   LE+S+  G P L ED  E +DP +DNVL KN IK+     V +GD+EVD    FRLY+T+KL NP ++P + +R +II++TVT+ GLE QLL  ++  E++ELE+ R +L+ +   NKR +KELED LL  L +  G+++D+  LI  L +TK  + +V ++L  +      I   R+ YRP A RG++L+F++T +S++N MYQ SL  +L +F  ++ RS      +KR+ NII  +T+ V+ Y   G++E+HK L +L + L+++     I H E    IKG  +++    P   + W+PD +W +L +LS  + +FSDILDQ+  +E +WR+W+  ++PE E I + Y +  + FK+L L+R W  DR       ++   MG+ +    I      +  S P  PI+ ++S GSDP   I+ L      E     Y+SMGQGQE +A  L    ++ G W +LQN HL + F+  +   + +    H  FRLW+TTE    FPI +LQ S K   EPP G+K  L  TY  I  E+   S   ++R  ++ +AFLH+ +QERR++G +GW+I Y+F ++DF  +++ +Q +L     ++   V W T++Y+IGE+ YGGR  D +D+R+L T+   +           F FY+D    Y+IP     C+S+ + Y +YI+ LP   +P VFGLH NA I Y +   K++   ++ +QP+       +G   ++E  +  +   +L KLP  Y   ++ +  L +   + P  + L QE+DR   +L  + ++L  LK A+ G + MS  L D    + +  +P  W+  A      LG W   L +R  Q++ WI  G+ +    W++G   PQ +LTA+ Q+  R N  WALD   L   +T       +++T   + G YV G+Y+EG GWD +N  ++  K + L + MP+++++  E++  K +     P+Y    R +     ++  +DL T++   +WIL+G+AL
Sbjct: 2340 KVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPEDVAWFDSMLANLVEEELGEEYRDVVKPEVDAYFVDFLQDAPEATGEEPENADFDMPKVYEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTRSYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRRPPTNENLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLSSYDIDCTPQVKGEVVQCMGSFQDGVAEKCVDYFQRYRRSTHVTPMSYLSFIQGYKAIYKEKH--LESVKFAMNTGLQKLKEASESVAALSK---ELEVKEKELQIANEK----ADMVLKEVTVKAHAAEKVKIEVQKVKDKAQAIVDSISADKAIAKEKLEAAKPALEEAEAALQTIKPSDIATVRTLARPPHLIMRIMDCVLLLFQRRLNAVKIDAEKNCITPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVELLTPYFDMPDYNIETAKRVCGNVAGLCSWTKAMATFFSINREVLPLKANLVVQENRLAIAHADLQKAQAELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFR-NLLLSDWQKEMRARCIPFGINLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIRN-----KEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGNIIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIKHEEFLTLIKGGASLDLKACPPKPSKWIPDMTWLNLVELS-KLWQFSDILDQIGRHEKQWRSWFDKEAPEEEVIPNAYDQSLDCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVILDLERTWEESDPRTPIICLLSMGSDPTDIIIALGKRQKVET---AYVSMGQGQEVHARKLLQQFMANGGWALLQNCHLGLDFLDELMDTVTETDSIHESFRLWITTETHRNFPITLLQMSIKFTNEPPQGLKAGLKRTYQGINQELLDVSNMVQWRPMLYSVAFLHSTVQERRKYGPLGWSIPYEFNQADFNATVQFVQNHLDDMDMKR--GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVW--FSETMFNHEFQFYKD----YHIP----RCTSVDQ-YLQYIQGLPAYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDS----SSGGGETREAAVGRLADDMLEKLPPDYSPFEVMKR-LETMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGTIVMSENLRDALDCMYDARIPARWK-KASWASSTLGFWFTELLERNQQFQAWIFEGRPN--CFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTR---WMKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYA-ENNGVKDSRLYSCPIYKKPARTDQ---NIIAAVDLRTSQRPEYWILRGVAL 4168          
BLAST of Dynein heavy chain vs. Ensembl Cavefish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 957.592 bits (2474), Expect = 0.000e+0
Identity = 618/1922 (32.15%), Postives = 1005/1922 (52.29%), Query Frame = 1
Query:   85 MLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYV---------QINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELL--LHVWDDGAKSGYPENKE------GIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLV--LQSGEIS------------WKSARGLMADANFIKELQTLDVEAIPLKNINAVK-DTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYY--KEPNNS------------FKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKP--HPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIP--NEVFLDSPHPK---YRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIE-----------YYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKI--KRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAM-----GIGLVTVLDLATTEHNSHWILQGIALTLNSDD 5637
            +LPTP K HYT NLRD S+V QG      +       M+RL+ HE  RVF DR++ ++D++ +  ++ NI+K  F +    V          +  +L+GDY T  ++   RLY ++          + ++  YN+  + +++LV+F   LEHL+ I R+L+  GG+ALLVGV GSG++S++RLA F AD++ F+  +SK YG  E+REDLK++  K   +    +FL  D  + +E FLE ++++L  G VP LF  DEK+E++  +H     A++G   NK        ++ +F   C   LH+V+A SP+G   RNR R FP ++N   I+WF PWPE+AL  VA   ++     +     + V+    T H S    S+ F  +L R NY+T T+++  I  +  LL  K   +   ++R T GLDKL     Q+  +  ++ + +  +E+  I   +++  I + + +   K K+   +    +Q++      K E E  L+ A+PALEAA  +LD L  +DVT +++   PP  V++V   +C++  ++  +I+            W  ++ L+ D NF+++L+  D + IP   ++ ++ + +         V  AS A  G  K+I ++  +  VA+ + PKK  + + ++        L + + E++++E +L  LKK  ++  +E  +L  ++ +  R+L  AEKL  GL  EK RW       Q    NL GD LI++  + YLG FT  +R N  +  W    +S NIP S +F +   L   ++I  WN  GLP D  SI N ++ + S R+P+ IDPQ QA KW+K  ER       ++ +  L D+ ++RTLEN I+FG P L E+  E +DP ++ +L K I K  G + + LG+  +++   FR Y+T+KL NP + P L ++ +++N+ +T  GLE QLL  +V  ER ELEE+R  LIL+++ NK+ LKE+EDK+L  L +  GNIL++   I  L+  K  + +++K+   +      I   R+GYRP AK  ++LFF + +L+ I+ MYQ+SL  ++ +++ +I+ S     L KRL  +I   T+++YC  C  +FEK K+L S  +   L      I + E  F + G + + +  P    NWL D SW ++ + S  +P    +                   P   F+  Y  KEP N+            F+K+ + RC R D+I  AI++++T  +GK+FV PP      ++  S   +P+V ++SPG+DP   ++K AN  +      K +S+GQGQ   A+ +  +A+  G W+ LQN HL + +++ +EK  +D      HPDFRLWLT+ P   FP+ ILQ   K+  EPP+G++ NL  +Y   P  +  F  +   K   + + ++ + F HA++QER++FG +GWNI Y F ESD ++S++ LQ ++    E     VP+  I YL GE  YGGR  D +DRR+L T + ++              Y  D IE           YY P +     S+ E Y E+I++LP  Q P VFG+HEN  I      TK L+ ++I     T+    + G     +  L ++   I  KLP  ++I+    K  +LY  +       VL+QE++R+N L   +  SL  L KA+ G V M  EL+ I+ SL  G +P  W   +  ++K LGS++     R    + W    K ++   WLSG    Q++LT  +Q   R+ +  +D  +      + E    +    S E G YV G++++G  WD K+G +  Q  + L  S+PII + P    K+  T  +   +  TS+R+  +         V  + L T++   HWI +G+A+    D+
Sbjct: 2048 LLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLENKRTMIRLFVHEVFRVFYDRLVDDQDRDWLYKLMKNIVKEHFKESFDTVFEHLKLCEEDMRSLLFGDYMTPDVEASERLYAEVPSMESFSQVVESYLTEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMADMTLFQPEISKNYGMNEWREDLKLLLKKAGVKGQKTVFLLTDAQIKEEAFLEDVDSVLNTGEVPNLFAVDEKQEIMEVMHAVRPIAQAG---NKSLEFSPLALFAFFVNRCRENLHVVVAFSPIGDAFRNRLRQFPSLINCCTINWFQPWPEEALERVANKFLETLE--MSDHERQEVMLICKTFHTSAIHLSEKFLSELGRHNYVTPTSYLELIAAFRLLLTNKRDTVMNAKKRYTNGLDKLAFAESQVGEMKKELVDLQPKLEQAKIDNIKMVQVIEVESVQVEAKSKVVRVEEEAASQKAAEAQALKNECESDLAEAIPALEAALSALDTLKPSDVTIVKSMKNPPSGVKLVMAAVCVMKDIKPEKINDPAGTGQKILDYWGPSKKLLGDMNFLRDLKVYDKDNIPAPVMHKIRSEYMTNPDFDPTKVAKASSAAEGLCKWITAMEVYDRVAKVVAPKKANLIVAQQSLAATMALLNQKRAELKEVEDRLAALKKTLEEKTEEQAQLQFQVDLCARKLERAEKLIGGLGGEKTRWSKAADDLQNTYDNLTGDVLISAGVIAYLGAFTAGFRQNCTKE-WTKLCKSKNIPSSDDFSLSKTLGDPIKIRAWNISGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSER-----ENNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQIFKQGGMDCIRLGESVIEFSSDFRFYITTKLRNPHYLPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDKILETLQSSEGNILEDESAIQILDSAKIMSNEISKKQQIAEKTELKIAESREGYRPIAKHSSILFFSIADLANIDPMYQYSLNWFVNLYINSIQDSNKSKILEKRLRYLINHFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYAEFMFLLTGGVGLQNNVPNPDPNWLQDKSWDEICRAS-DLPGLQGL----------------RYPPFCHFLPIYDSKEPYNTPLPKPWCDKLSDFQKMIIYRCLRPDKIEPAISNYITGKLGKKFVEPPPFDLSKSYNDSNSTIPLVFVLSPGADPMASLLKFANDKNMGGANFKSISLGQGQGPIAVKMIQSAMKEGTWVCLQNCHLAVSWMSTLEKICEDFSPETCHPDFRLWLTSYPSPMFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPVSDPQFFSACSNKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNSYEE-----VPFEAITYLTGECNYGGRVTDDWDRRLLLTILADF--------------YNKDIIENPRYMFSPSGKYYSPPK-----SIYEDYVEFIRNLPATQHPEVFGMHENVDISKDLQQTKLLFDSLI----LTQGGGSKGGASSGGDSTLMDIANDIRTKLPENFNIDSALNKFPVLYEES----MNTVLVQEMERYNNLCNTIRVSLQNLLKAIKGLVVMDAELEAIAGSLLVGKVPEKWAKRSYPSLKPLGSYITDFLTRLKFLQDWYDTTKPNV--FWLSGFFFTQAFLTGAMQNYARKYSIPIDLLSF-----DYEVLPFDTSATSPEDGVYVHGLFLDGARWDKKSGVLAEQHPKVLFDSVPIIWIKP----KHCCTFLL---LSCTSERKGTLSTTGHSTNFVISIMLPTSKRPQHWIKRGVAMLCQLDN 3895          
BLAST of Dynein heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009595.1 (pep scaffold:Pmarinus_7.0:GL478108:144315:184457:1 gene:ENSPMAG00000008659.1 transcript:ENSPMAT00000009595.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1877.45 bits (4862), Expect = 0.000e+0
Identity = 946/1853 (51.05%), Postives = 1318/1853 (71.13%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIK-ISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIP-KFSDILDQVTNNEDEWRNWYKLQSPE-SEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYI-PDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI-WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+++QGLC +T +RFT    M+RLWR+ECLRVF+DR+I  +DK +V+  +  +++  FP  +     +PIL+GDY +     EPRLYED+QDY   ++ FQE +E YN   +  ++LVLF+DALEH+  +HR LRM+ GHALLVGV GSGK+SLSRLAA+AA    FEI+LS+GY E   R+DLK +Y +L  E     FLF D HV +EGFLELINNMLT G+VP LF DDEKE L+  V D+ A++G    +E +W YF + C + LHIVLAMSP G TLR RCRNFPG+VNNT IDWF PWPEQAL +VA   +  +NP+IP  +   V++HVV++H SV   S  FQ KLRR NY+T  N+++Y+ TY  LLE KD  +  + QRL  GLDKL   + Q+  LN ++AEQK+++  K+++C+ L+ EI+ STE    KK++ EEK+ EI  Q++VI  EKGEAEEAL+ A+PAL+AA+R+L ELDK+DVTEIR+FATPPK VQ V E + L+    E+SWK+A+G+M+++NF++ L  +D +AI    +  ++  +     TYE++   S+AGAG LKF+ +V+G+ +VAREI+PK+++V  LER+F ++++ELER+Q E+  L+ +L  L  +++ A  E ++L  E  +M+R+LLAA+KL  GL SE  RW S++   +Q RV LLGDCL+++AFL Y G F++E+R  ++ + W   +R   IP S+ F++++LLT DVEIS+W S+GLP DELS+QN ILTT ++RFP+CIDPQ+QA+ WI++     K++  ++K +S+ ND  FL+ LE +IK+G P+LF+D D+++DPVIDNVL +NI   +GR+YV+LGD+EVD++P FRLYL +KL+NP+ SPS++ +A +INYTVTL GLE QLLS +V  ER ELEE+RE LI ETS NKR+LKELED LL ELAT TGN+LDN EL+ TLEDTKAKA +VA++L+ +   + DI+R RDGYRPAAKRGA+LFF L +++ ++ MYQ+SL ++L VF  ++R+S+PD+ L KRL NI  TLT ++Y YGCTG+FEKHK+L SL +A+RLE+    +  +E+DFF+KGNI++         +WLP+  W+D+ QL+   P  F+ + D V  N   W  W+ L +PE +   D Y    ++F+ L +LRC+R+DR+  AI+D+V + MG+ +V PP+         S+P  P+V I+S GSDP  ++ KLA    F   ++K L+MGQGQEK AL L   AVSRG WLMLQN HLL +++  +EK L+ + KPHPDFRLWLTT+P  +FPIGILQ+S K+V EPP+G+K NL  TY ++ +E     PHP +R  ++ LAF HA++QERR++GK+GWN+SYDF ESDFQV ++IL TYL+KAHE+    +PW ++KYLIGEVMYGGRAIDSFDRRIL TYMDEY GDFLFD FQ+FHF+ +   +Y + PD P++      I T  ++SLP   +P VFGLH NA IGY T   +++W+++++LQPQT     E G   S+++ +S +   I  +LP+ +++ + ++ L      +SPT VVLLQE+ RFN LL++M  SL  L+KAL GEVGMS ELD+++++L NG +P  WR LAP+T+K L +W+ H  QR  QY  W+  G+   P++ WLSGLH+P+SYLTALVQ  CR+N W LD  TL T +T    R  E +T     GC+V G+++EG  WDV+  C++  K + L+  +P++++ PIESH+ K  +T++ PVY TS RRNAMG+GLV   DL TT+H SHW+LQG+ LTLN D
Sbjct:  469 PTPSKFHYIFNLRDLSRIYQGLCLTTPERFTTVGHMVRLWRNECLRVFHDRLINTDDKILVERHVRRLLEEHFPHDVEVTMRDPILFGDYRSALSPGEPRLYEDIQDYEAARALFQEILEEYNS-SETPMNLVLFEDALEHVTRVHRTLRMERGHALLVGVGGSGKQSLSRLAAYAAGCQVFEITLSRGYNESSLRDDLKALYTRLGVEGKPTAFLFTDAHVVEEGFLELINNMLTAGIVPALFPDDEKEALIGQVRDEAARAGCGPARESVWHYFVSKCASNLHIVLAMSPDGDTLRTRCRNFPGLVNNTCIDWFLPWPEQALLAVAQSFLAGENPMIPGDHRGAVVSHVVSVHCSVGDFSVQFQRKLRRSNYVTPKNYLDYLATYTRLLEEKDLYILGQCQRLEGGLDKLAEASVQLAELNERLAEQKVVLAAKSLACDALLEEISRSTETVNEKKQLAEEKAREIEDQNRVIAVEKGEAEEALTAALPALQAARRALQELDKSDVTEIRSFATPPKQVQTVCECILLMRGHKEVSWKAAKGMMSESNFLRNLMEMDCDAIGQGQVKLIRGILKSLGTTYEEMVPISRAGAGMLKFVEAVMGYCEVAREIKPKRDKVARLERDFYQSKRELERIQAELATLQEELAALGSKYEAAMSERQQLQAENEVMERRLLAADKLISGLGSENARWTSELQELRQRRVRLLGDCLLSAAFLCYSGAFSWEFRSAMLSDAWEKEVREREIPLSQPFRVESLLTDDVEISRWGSEGLPPDELSVQNGILTTHASRFPLCIDPQQQALNWIRR-----KEQKNNLKVVSSFNDPDFLKQLEMAIKYGFPFLFQDVDDYIDPVIDNVLERNIKGQQGRQYVVLGDKEVDYDPSFRLYLNTKLANPRLSPSIFGKAMVINYTVTLKGLEDQLLSVIVAFERSELEEQRERLIQETSHNKRLLKELEDSLLRELATSTGNMLDNAELVLTLEDTKAKATEVAEKLALAEKTALDIDRLRDGYRPAAKRGALLFFSLADMAQVSGMYQYSLSAFLGVFDLSLRKSLPDTVLPKRLVNITDTLTHNIYNYGCTGLFEKHKLLFSLNMAIRLEQAEERVPQSELDFFLKGNISLEKSARARPFDWLPEQGWQDVVQLAEVSPDAFASLPDHVERNGQAWGQWFDLDTPEQAPLPDGYAHSLSAFQHLLVLRCFRVDRVYRAISDYVASTMGERYVQPPVVNLEGVLEQSSPTSPVVFILSAGSDPAGDLAKLAERTGFSGSRLKMLAMGQGQEKAALQLLGHAVSRGHWLMLQNCHLLPRWLKELEKALEGISKPHPDFRLWLTTDPTPSFPIGILQRSLKVVTEPPNGLKLNLRATYFRVSHEALDSCPHPAFRPLVYTLAFFHAVVQERRKYGKLGWNVSYDFNESDFQVCMEILCTYLSKAHEQANGRIPWASLKYLIGEVMYGGRAIDSFDRRILTTYMDEYLGDFLFDSFQVFHFFCNSETDYRLPPDGPKDAY----IVTAEVESLPLANTPEVFGLHSNAEIGYYTQAARDMWRHLVDLQPQTG----ETGSGVSRDEFISGVARDIQARLPLPFELGQTRKRL---GAVLSPTAVVLLQEMQRFNALLQRMARSLAELQKALAGEVGMSGELDEVARALFNGTIPAIWRRLAPDTLKSLANWMVHFHQRHQQYSAWVEDGE---PTVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLYTQVTTF--RGPEEVTERPGQGCFVSGLFLEGADWDVEASCLVRSKPKVLMVQLPVLKIIPIESHRLKLQSTLRTPVYTTSTRRNAMGVGLVFEADLFTTKHPSHWVLQGVCLTLNCD 2299          
BLAST of Dynein heavy chain vs. Ensembl Sea Lamprey
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 1042.72 bits (2695), Expect = 0.000e+0
Identity = 643/1905 (33.75%), Postives = 1020/1905 (53.54%), Query Frame = 1
Query:   82 KMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMP--YVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPE-NKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENL-TNWLPDNSWKDLNQLSITIPKFSDILDQVTN--------------NEDEWRNWYK------LQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKP----HPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSP-HPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLY--SSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTL---TTIITNEEDRSSENL---TISSEL-----------GCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAM-----GIGLVTVLDLATTEHNSHWILQGIALTLNSDD 5637
            ++LPTP K HY  NLRDLSK  QG+ Q         NQ+ RL+ HEC RVF+DR+I NEDK+   T+L  +   +F   +   Y   +PIL+GD+    +    R+YEDL D   +K   Q++++ YN     ++ LV F DA+EH+  I R++R + G+ALLVGV G+GK+SL+RLA        F+I LS+GY    F EDL+ +Y     E+ D +FLF D  +  E FLE INN+L  G VP LF  DE E++L        ++G PE N++ + Q+F     ARLHIVL MSPVG   R RCR FP IVN   IDWF  WP +AL SV+     P + L   +  E++    V IH SV   ++ +  +LRR  Y T T+++  I  YLS+L  K   L   R R+  GL KL  T   +  L  +++  + ++++K+   E LM ++    E A   +++  E       +++       +A+  L  A+PAL+AA R+LD LD++D++E+R F  PP+ V+ V E +C+VL S +  W SA+ L+ D+NF+K L   D E I    I  +K  I  +    E V   SKA      ++ ++  +  V +++ PK++R+   + E +     L   Q  ++++E Q+  L+ QFD +  E E L K MA+ Q ++  A KLT  L  E+ RW   VA FQ E  N++G+  IASA + Y G FT  YR  L++  W++  + + IP + NF +  +L    EI +WN+ GLP D +S +N IL T+  R+P+ IDPQ+QA +WI+      K+    +KI  L D  FLRTLEN+I+ G+P L E+  E +DP ++ +L K    S GR  + LGD +VD++  FR Y+T+K++NP + P +  +  IIN+TVT SGLE QLLS +V+ E+ ELEE+R  LI+  + +K  LK +ED++L  L T  GNILDN ELI TL+++K  +  +  +L ++      I   R+ YRP A RG+V++FV+ +LS I+ MYQ+SL  +  +F   I  S   S LA+RL  ++       Y     G+FE+HK++ S  + + +    G+++  E + F++G   ++   P      WL +++W     L   +P F  +  ++                N + W    K       +  E+E   ++ E  + F+KL L++ +  +++  A+TDFV   +GK F+  P       +   +   P+V ++S GSDP     + A  + +   ++  +S+GQGQ   A  L + AV  G W+ LQN HL   ++  +E+ +  L +P    HP++RL+L++ P   FP+ +LQ S K+  EPP G++ N+   + +I    F  +     +R+ IF + F HAI+QER++FG +GWNI Y+F +SD + +L  L  +           +PW+ + Y+ GE+ YGGR  DS+D+R L+T +  +   F     +  + Y    I YY  +E     +L++ + +YI++LP    P +FG+HENA + +    T  L + ++E+QP++  +    G   S ++++ E+   IL KLP + D+     +L        I+  T VL QE+DRFN LL+ + +SL+TLKKA+ G V MS E++ I  S  N  +P  W   A  ++K LG W++ L  R    + WI  G     S W+SG   PQ +LT  +Q   R+ N  +D       T  +  ++   +E +       EL           G  V G++++   WD ++  +    + Q+   +P++   P ++++    +    P+Y TS R   +         V  + + +   + +WI +G AL    +D
Sbjct: 2238 ELLPTPAKSHYIFNLRDLSKCMQGILQCDSGTVRDQNQIFRLFCHECQRVFHDRLINNEDKDYFNTMLAEMASKQFGVQVEAEYFVKHPILFGDFMKVGVQRADRVYEDLTDVEKLKGVLQDYLDDYNLSSAKEMKLVFFQDAIEHVTRITRMIRQERGNALLVGVGGTGKQSLTRLACHMCGYRCFQIELSRGYSYDTFHEDLRKLYTIAGVEDKDTVFLFTDTQIVIEEFLEDINNILNSGEVPNLFEKDELEKVLAATRPKAKEAGIPEGNRDEVLQFFINRVRARLHIVLCMSPVGDAFRARCRMFPSIVNCCTIDWFVQWPREALLSVSKTFFTPVD-LGSDELKENLSEMCVEIHMSVTELAEHYYAELRRRYYTTPTSYLELINLYLSMLGEKRSQLTNSRDRIKNGLTKLLETNELVDKLQLELSALEPVLKQKSEDVEALMEKLATDQENADQVRRVVMEDEAVAKVKAEETQAMAADAQRDLDEALPALQAANRALDSLDRSDISEVRVFTNPPEGVRTVMEAICIVL-SKKPDWASAKQLLGDSNFLKRLTDYDKENISEDVIQKLKVYINNKDFVPEKVERVSKACKSMCMWVRAMDLYSRVLKDVGPKRQRLATAQAELDATMAMLNDKQRRLKQVEDQIGALQDQFDMSVAEKESLAKNMALTQARMSRAGKLTSALGDEQIRWQESVAQFQVEINNVIGNVFIASACVAYYGAFTSHYRQMLIDR-WISRCQELGIPINANFSLIGILGDPFEIRQWNTDGLPRDTVSTENGILVTRGRRWPLMIDPQDQANRWIRN-----KEMKNGLKIIKLTDGNFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRLLIRLGDSDVDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRNELIVRINADKNQLKVIEDRILKLLFTSEGNILDNEELIKTLQESKVTSGAIKTRLKEAEATEEMINTAREKYRPVAARGSVMYFVIASLSEIDPMYQYSLKYFKQLFNMTIETSEKRSDLAERLELLLKQTLLATYTNISRGLFEQHKLIFSFMLCIEILRQHGHVSDAEWNLFLRGAAGMDKERPTKPEIGWLAESTWNLCCDLEDHLPCFKGLKREIVAIPILVTLGRLEIRLNPEAWEGCMKEPLHFTEEVSENEIQGHWNERLSKFQKLVLVKSFMEEKVVFAMTDFVIENLGKAFIENPPVDLATLYQDMSASTPLVFVLSTGSDPMGAFQRFAREMGYS-ERVHAISLGQGQGPIAEKLIEEAVKSGDWVFLQNCHLAASWMLAMEEIIKALSEPNAVIHPNYRLFLSSMPTRNFPVTVLQNSVKVTNEPPKGLRANIRRAFTEITPAFFEKNVLGQNWRKIIFGICFFHAIIQERKKFGPLGWNIHYEFNDSDRECALLNLNLFCQDGR------IPWDALIYITGEITYGGRVTDSWDQRCLRTILKRF---FSPKTLEPGYLYSTSGI-YYASEE----KTLQD-HKDYIENLPLNDDPEIFGMHENANLAFQRQETGTLVKTILEVQPRSSGQ----GAGTSNDEIVKELADSILAKLPEILDMEGAMESLFTRDEKGRINSLTTVLEQEVDRFNTLLQVIRSSLHTLKKAIAGFVVMSEEMEKIYNSFLNSQVPVLWSDNAYPSLKPLGGWVKDLALRTTFIDAWIKTGPPK--SFWISGFFFPQGFLTGTLQNHARKYNLPIDELGFHYKTLPVYRDQTSVAEAMRTQQFGQELEADIQLPAVQDGVLVHGLFMDASRWDDEDMVMEDALAAQMNPPLPVLHFEPCQNYQ-PDPSLYHAPLYKTSARAGTLSTTGHSTNFVVTVFIPSKRDSDYWISKGAALLCQLND 4111          
BLAST of Dynein heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000736.1 (pep scaffold:Pmarinus_7.0:GL477446:167298:178455:-1 gene:ENSPMAG00000000670.1 transcript:ENSPMAT00000000736.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 473.396 bits (1217), Expect = 5.089e-146
Identity = 285/881 (32.35%), Postives = 470/881 (53.35%), Query Frame = 1
Query: 2992 GNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININ-HVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFI-DYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPS-IWLSGLHLPQSYLTALVQKACR-RNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIES-HKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIAL 5619
            G+++D+  L+  L  +K  A +V ++L+ +      I   R+ YRP A RG++L+F++  +S++N MYQ SL  +L +F   + RS      +KR++NII  +TF V+ Y   G++E+HK L +L +AL+++     + H E    IKG  +++    P     W+ D +W +L +LS  + +FSDIL+Q+T NE +W++W+  ++PE E + + + +  + F++L L+RCW  DR       ++T  MG+ F    I      +  S P  P++  +S GSDP   I+ L   +  E    +Y+SMGQGQE +A  L    ++ G W +LQN HL + F+  +   L +    H  FRLW+TTE    FPI +LQ S K   EPP G++  L  TYA I  E    S   ++R  ++ +AFLH+ +QERR++G +GWNI Y+F ++DF  +++ +Q +L     +K   V W T++Y+IGE+ YGGR  D +D+R+L T+   +F + +F     F      H +Y IP     C+++ +  T   +SLP   +P V GLH N  I Y T   +++    + +QP+       AG   ++E ++      +L KLP  Y   ++ R  L     + P  + L QE++R   ++  + ++LN L+ A+ G + MS  L D    + +  +P  WR  A      LG W   L +R  Q+ +W   G+   PS  W++G   PQ +LTA+ Q+  R    WALD+  L   +T       E++T S + G YV G+++EG  WD +NG +   + + L + MP++ ++   +    K T     P+Y    R +   +  +  +DL T +   HWIL+G+AL
Sbjct:    2 GSLVDDESLLGVLASSKRTAEEVTQKLATAADTEQQINTAREEYRPVATRGSILYFLIVEMSLVNVMYQTSLRQFLGLFDIGLARSAKSPITSKRISNIIEFMTFEVFKYAVRGLYEEHKFLFALLLALKIDMQARRVKHEEFLTLIKGGASLDLKTCPPKPAKWILDLTWLNLVELS-KLRQFSDILNQITRNEKQWKSWFDKEAPEEEPVPNGFDQALDCFRRLLLIRCWCPDRTIAQARKYITETMGESFAEGVILDLERTWEESDPRTPLICFLSMGSDPTDSIIALGKRLRLET---RYVSMGQGQEVHARKLLQLTMANGGWALLQNCHLGLSFLPELMDTLTEAEGVHETFRLWMTTEAHPLFPITLLQMSIKFTNEPPQGLRAGLKRTYAAISQEQLEVSNMVQWRPMLYAVAFLHSCVQERRKYGPLGWNIPYEFNQADFNATVQFVQNHLDDMDIKK--GVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFTQVWFSENMFLPTFSF------HKDYTIP----RCTTVDQYLTLPRQSLPAATTPEVLGLHANGDITYQTTVARDVLDTALGIQPKDS----AAGGGETRESIVYAKAQEMLEKLPQDYIPYEV-REQLQKMGALQPMNIFLRQEVERMQRVISLVRSTLNDLRLAIEGTIIMSEGLRDALDCMYDARIPARWRK-ASWASSTLGFWFTELLERDRQFRSWCFQGR---PSCFWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLQNDVTRW---LREDVTRSPDEGVYVHGLFLEGAAWDRRNGRLAEARPKALFEPMPVVHIYAANNPAGSKDTQLYSCPIYKKPVRTD---LNYIADVDLRTAQPPEHWILRGVAL 851          
BLAST of Dynein heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001140.1 (pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 gene:ENSPMAG00000001005.1 transcript:ENSPMAT00000001140.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 389.808 bits (1000), Expect = 7.896e-110
Identity = 240/764 (31.41%), Postives = 395/764 (51.70%), Query Frame = 1
Query:   85 MLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDK----EIVQTILLNIMKNEFPKHMPYVQ----------INPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEG----IWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLV-----------LQSGEIS---WKSARGLMADANFIKELQTLDVEAIPLKNINAVKDT-IAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRH 2277
            +LPTPTK HY  NLRD S+V QG+C S  +    A  + RLW HE LRVF DR++ + D+      ++  +   MK +F +   +            +  +++ D+ +++ DD  R Y ++ D   ++   +  +E +N L +  ++LVLF  A+EH+  I RIL+    HALLVGV GSG++SL+RLAA  AD   F++ +SKGY   E+REDLK +  +      + +FLF D  + QE FLE INN+L  G +P LF  DEK+E+   +     +    +  +G    +   F   C  +LH+VLAMSP+G   RNR R FP +VN   IDWF  WP  AL +VA   ++  +  +  +     I      H S    SQ FQ + +R NY+T T+++  I T+  LLE K  ++   ++R  VGL+KLE+   Q+  + A++A  +  + E  I     M  I   +EE +  +++ +       +Q+      K E +  L+ A+P L +A  +LD L + D+T ++   +PP  V++V E + ++             SG +    W  A+ L+ D  F++ L   D + IP+  +  ++   I   +   + +R AS A  G  K++I++  +  VA+ + PKK ++   E E   A   L R QE +R+++ +L  L++  +  + +   L  ++ +  ++L  AE+L  GL  E++RW+           +L GD L++S  + YLG F   +R 
Sbjct: 2045 LLPTPTKSHYLFNLRDFSRVIQGVCLSLPETCPVAASIQRLWVHEVLRVFYDRLVDDADRTWLVAFIRKTIHTYMKEDFTQLFQHDSNGDGQVEDDDLRSLMFCDF-SDSKDDAKR-YVEVSDVERLRLVVEGHLEEFNNLSKKPMNLVLFRFAIEHVCRISRILKQPRSHALLVGVGGSGRQSLTRLAAHMADCELFQVEISKGYATNEWREDLKRILRRSTDGEQNGVFLFTDTQIKQESFLEDINNLLNSGEIPNLFAPDEKQEICEKMRQIDRQRDKDKQTDGSPLALLNMFVDRCRDQLHVVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPGDALQAVATRYLE--DVEVSEETLASCIDMCKLFHTSTIALSQKFQAEQQRYNYVTPTSYLELISTFKDLLEKKRLEVMRMKRRYEVGLEKLESATSQVAGMQAELAALQPQLLEAGIQVVNTMAVIERESEEVSRTERVVKADEAVANEQAMAAKVIKDECDADLAEALPILRSALAALDTLTQQDITVVKTMKSPPAGVKLVMEAISILKGVKPDRVPDPSGSGRMVEDLWGPAKRLLGDMKFLQSLHDFDKDNIPVAIMKTIRAKYITNLEFDPDKIRNASTAAEGLCKWVIAMESYDKVAKVVAPKKVKLNQAEAELAVAMGSLRRKQEALREVQDKLAGLQQTLEANKQKKADLENQVDMCTKKLDRAEQLIGGLGGERSRWMEAARLLGIRYNDLTGDTLVSSGIVAYLGAFISSFRQ 2804          
BLAST of Dynein heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010791.1 (pep scaffold:Pmarinus_7.0:GL476647:224020:289570:-1 gene:ENSPMAG00000009773.1 transcript:ENSPMAT00000010791.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 348.977 bits (894), Expect = 3.075e-103
Identity = 250/781 (32.01%), Postives = 410/781 (52.50%), Query Frame = 1
Query: 2839 GLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFH-----VYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSP-ESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDD-LIKP---HPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIP--NEVFLDS---PHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDE--PEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQR 5130
            GLE QLLS +   E+ ELEE +  L LE + N++ LKELED++L  L+T  GNIL++   I  L  ++  + ++A +   +V     I+  R+GY+P A   +VLFFV++NL+ ++ MYQ+SL  ++  ++++I  S P S L +R   + +  T       +Y   C  +FEK K+L S  + + L    G ++  +  F + G + +           L + SW +L + S  +P FS +     +N DEW+      +P E+   + +      F++L +LRC R D++  A+  ++   MG+ ++ PP      +F  S+ + P+V ++SPG+DP   ++  A+        I+ +S+GQGQ   A+ + + A S G W++LQN HL   +++ +E+  +D L+ P     +FRLWLT+ P + FP+ +L+   K+  E P G++ NL  ++   P  +  F +    P P +++ +F L F HA++QERR FG +GWN+SY+F ESD ++S + +Q +L +  E     VP   + YL GE  YGGR  D  DRR+L   +  ++ +             DD   +            +  E + E+IK LP    P VFGLHENA I    N T+ L+  +++  P+       +G   S    + E+   IL K+P  +DI +IK     S +E   T  VL+QEL RFN L   +  SL  + +A+ G+  MS EL+DI  S+  G +P  W   +  ++K LGS++  L  R
Sbjct:    1 GLEDQLLSIVAAREKPELEEAKNQLYLEGAHNRKQLKELEDQILEVLSTSQGNILEDETAIAILSSSRQLSSEIADKQEVTVRTEKQIDETRNGYKPVASHSSVLFFVISNLAHVDPMYQYSLAWFIGQYVQSIASSRPSSVLHERTEALNSHFTCRRGPDSIYTNVCRSLFEKDKLLFSFLLCVGLARSRGRVSDADWRFLLTGGVALPSPSSNPAPALLDNRSWAELARCS-DLPGFSGLAGHFCDNLDEWKAITNSPTPHEAHLPEPWGSRLTRFQRLLILRCIRPDKVIPAVQQYIAEEMGERYIEPPPFDLAHSFRDSSRVTPLVFVLSPGADPMALLMHFADERGMGGSNIETISLGQGQGPIAVRMIEKAASEGTWVVLQNCHLAASWLSELERICEDRLLDPDRTRSEFRLWLTSYPSTRFPVSVLENGVKMTNESPIGLRANLLRSFLNDPISDPAFFNGCNKPTP-WKKLLFGLCFFHALVQERRTFGSLGWNVSYEFNESDLRISARQVQMFLNEYEE-----VPLEALAYLTGECNYGGRVTDEHDRRLLLALLATFYCERTV---------RDDAYRFSPTGRYGAPPAGAAYECHLEHIKGLPLHAHPEVFGLHENASITKEQNETQRLFDGILKTLPRE-----TSGGGKSSSDFVQELATDILSKIPPKFDIEEIKSKFPTSYSESMHT--VLVQELVRFNGLTGTVRNSLRNVTRAVSGQALMSAELEDIYSSIILGKVPAMWSAKSYPSLKPLGSYVSDLLAR 758          
BLAST of Dynein heavy chain vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 271.166 bits (692), Expect = 3.616e-73
Identity = 260/1123 (23.15%), Postives = 519/1123 (46.22%), Query Frame = 1
Query:   94 TPTKFHYTLNLRDLSKVFQGLCQS--TVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYP-ENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHV---------------VTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLD--VEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQN-AILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKA-IRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDI 3396
            T  + HY  + R+L+++ +G+  +  T  R T    ++RLW +E  R+F DR++  ++K   + +L   +    P       I+          +LD +     DL ++  I+  F+ F +     ++ ++ +V+ +  ++H+  I R L+   GH +L+G S +GK  L+R  A+   L   +  + +     +F   LK   +  + + S    +  + ++ +  FLE +N +L    +P LF  +E ++LL ++ +     G   + ++ ++ +F       LH+V  +        +   + P + N   I+W   W  + +  VA   +D    +IP ++ + ++  V                 ++  +  +   +Q      N  +   F++ ++  + L+  K  DL+  ++ + VGL+KL  +  +++ LN  ++++   + EK       + ++ +   E+  K++ TEE    +  Q + I K K    +++    P +  A+R +  + K  +TEIR+   PP  V+IV E +C +L     +W+  +  +   +FI  +   D  +   P       ++ ++    TYE +  ASKA     +++ + + F  V   + P ++ +K +E E  K +  L   +E  + LE  ++  K+++     ++E +  EM+ +Q  L  +  L K L  EK RW++    F +    L+G+C+I+S +  Y G      R +++       L    + +  N++  + L +  E  KW   GL  ++  ++N +I+       P  +DP    +  I     N     K++ +S L +  F++ LEN+I+FG   + +D  E  DP+I  ++S+    +  R  V +GD EVD    F+L++ S   +      L SR  ++++      +E ++    +  E  E++ KRE+LI   +E K  LK LE +LL EL    GN+L+N EL+ TL + K +A+++ K+LS+S       +   + Y    K    +F +L      +  Y  S+G +L  F +  I++S    +   R++ I+  L   VYC   T + +K KM++++ +    + DI
Sbjct: 2609 TGLQSHYLFSPRELTRLVRGVYTAINTGPRQT-LRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDKYLPNQ-DLGNISSTSLLFSGLLSLDFKEVNKTDLVNF--IEERFKTFCD-----EELEVPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRNKTRSLGLLLDTEQELYDWFVGEIAKNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVD----VIPMEFTDFIVPEVNKELVFTEPIQTIRDAVVNILIHFDRNFYQKMKVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLSKKSTELTEKEKEARSTLDKMLMEQNESERKQEATEEIKKILKVQEEDIRKRKEVVMKSIQDIEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQFSNWRDIQQFIRKDDFIHNIVHYDTTLHMKPQIRKYMEEEFLSDPNFTYETINRASKACGPLYQWVNAQINFSKVLENVDPLRQEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVEAIKTEMSNVQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLV-ILKRLLGKFAVKYDVNYRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYGN-----KTVLLSFLEEG-FVKRLENAIRFGSVVIIQD-GEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVYCQFSTALDKKFKMIMAMTMFCLYKFDI 3710          

HSP 2 Score: 55.4546 bits (132), Expect = 1.114e-7
Identity = 38/168 (22.62%), Postives = 77/168 (45.83%), Query Frame = 1
Query: 3961 GQWLMLQNAHLLIKFIAV-IEKKLDDL--IKPHPDFRLWLTTEPVS-TFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYR-QCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGR 4449
            G W++LQN  + + ++   + K +++    + H  F++++T        P  +LQ++ + V E   GI   +   +    ++ F       +   C F L++ HA++  R R    G++  Y F + DFQ +   L+  L          +PW  ++  I  ++YGG+
Sbjct: 3836 GGWILLQNIQMSLSWVKTYLHKHVEETKAAEEHEKFKMFMTCHLTGDKLPAPLLQRTDRFVYEDIPGILDTVKDLWG---SQFFTGKISGVWSVYCTFLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVLAT---NSTNNIPWAQVRDHIATIVYGGK 3997          
BLAST of Dynein heavy chain vs. Ensembl Nematostella
Match: EDO35852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK91])

HSP 1 Score: 1842.78 bits (4772), Expect = 0.000e+0
Identity = 962/1853 (51.92%), Postives = 1311/1853 (70.75%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPK-FSDILDQVTNNEDEWRNWYKLQSPESE-FIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPE-ECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIG--SKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHY  NLRDLS+V+QGLC +T DRF    + +R+WR+EC+RVF DR+    D+E V   + +++   F +H      +P L+GDY   TL ++PRLYED+ DY   K+ F+E +E YN +D   ++LVLFDDALEHL  IHR++RMD GHALLVGV GSGK+SL++LAAF+A    FEI+L++GY E  FREDLK +YN L  EN   +FLF D HVAQEGFLELINNMLT GMVP L+ DDEKE ++  V D+  K+G P  +E IWQYF   C   LHIVLAMSPVG  LR RCRNFPG+                            N  IP QY E V+ HVV +H++V   SQ F  KLRR NY T  N++++I TY  LLE KD  +  +  RL  GL KL   + Q+  LN K+A QKI V EK+ +CE+L++EI  +T++A  KK+M   K  EI +Q+KVI  EK EAEEAL+ A+PALE AK +L +LDK+DVTEIR+FA PP+ VQ+V E +  +    EISWKSA+ +M++ NF+K L  +DV+ I    +   +D + +   T E+++  SKAGAG  KF+I+V+G+  VAREI+PK+E+V  LER F+ +++ELE++++E++ LE +L+ L KQ+DDA  E   L +E  IM+R+L+AA+KL  GL SEK RW  D+   + +RV LLGDCL+ +AFL+YLG FT+++R +++   W   +    IP S+ FK+  LLT+DVE+SKW S+GLP D+LSI+N ILTT+++R+P+CIDPQ+QA+ WIKK E     E  ++K+   ND  FL+ LE +IK+G P LF+D DE++DPVIDNVL KNI    GRE+V+LGD+EVD++P FRLYL +KLSNPK++P+ +SR  ++NYTVT+ GLE QLLS +V  ER+ELEE+RE LI ETSENKR+LK+LED LL ELAT  GN+LDN EL+ TLEDTK KAV+V+++L      + DI++ RDGYRPAAK GAVLFFVL+ +SV+N+MYQ+SL SYL VF  ++R+S+PD+ L+KRL NI+ TLT +VY Y CTG+FE+HK+L S Q+ +++ E  G +   E+DFF+KGNI +     +   +W+PD  W+D+ +L    P+ F  + D +  NE  WR W  L +PES  F   Y+E  + F++L LLRC+R+DR+ +AIT FVT  MG+++V+PP+ +F +    STP  P++ I+SPGSDP ++++KLA    F  +K+K+L+MGQGQEK AL L +TA+SRGQWLMLQN HLL+K++  +EK L+ + KPHPDFRLWLTT+P   FPIGILQ+S K+V EPP+G+K NL  TY KI N++  D PH  +   +F L F HA++QERR++GKIGWNI+YDF ESDF+V + +L TYLTK+ +     +PW ++KYLIGEVMYGGR ID FDRR++KTYMDEY GDF+FD FQ FHFY ++ ++Y IP   E +    +++Y +YI+ LP   +P VFGLH NA IGY TN  K++W +++ELQPQT      AG  G  S+E+ ++++   I  KLP L+D++++++NL    +EI+PT VVLLQELDRFNVL+++M  SL  L++AL GEVGMS ELD++S+SL NGM+PN WR LAP T+K LG+W+EH ++R  QY  W+  G+  +  IWLSGLH+P SYLTALVQ  CR++ W LD  TL T +T   +  ++ +T  +  GC+V G+Y+EG  WD+   C+   K + L++ +P++++ PIESH+ K  NT + PVY TSQRRNAMG+GLV   DLATTEH SHW+LQG+ LTLNSD
Sbjct: 2506 PTPSKFHYIFNLRDLSRVYQGLCLTTPDRFDSPAKFVRVWRNECMRVFCDRLTNEADRETVSGYISSLVDQNFSEHTDIAMRDPCLFGDY-RNTLTEDPRLYEDVVDYDATKAIFEEILEEYN-MDHAPMNLVLFDDALEHLTRIHRVIRMDQGHALLVGVGGSGKQSLTKLAAFSAGCGVFEITLTRGYDENSFREDLKELYNSLGLENKKMVFLFTDAHVAQEGFLELINNMLTSGMVPALYPDDEKEGIIGQVRDEANKAGVPPARESIWQYFVNKCANNLHIVLAMSPVGDILRTRCRNFPGL----------------------------NDKIPDQYRETVVDHVVFVHQTVGTYSQSFLQKLRRVNYTTPKNYLDFISTYNRLLEIKDKYVLEQCHRLEGGLGKLLAASEQLAELNEKLAVQKIAVTEKSEACEKLLVEIQRATQQANEKKEMAIGKKKEIAEQNKVIVVEKTEAEEALAAALPALEEAKLALQDLDKSDVTEIRSFAKPPRAVQMVSECIVALRGYKEISWKSAKAMMSEGNFLKSLTEMDVDGITTGQVKKCRDMLKEMNTTVEEMKEVSKAGAGLFKFVIAVMGYCSVAREIKPKREKVARLERNFHLSKRELEKIEKELKALEEELERLGKQYDDAMREKSSLQEEAEIMERRLIAADKLISGLGSEKIRWTKDLQDLKDQRVRLLGDCLLGAAFLSYLGAFTWDFRRDMLRKQWENDVIQREIPLSKPFKVDVLLTNDVEVSKWTSEGLPPDDLSIENGILTTQASRYPLCIDPQQQALNWIKKKE-----EKNNLKVVTFNDHDFLKQLELAIKYGFPILFKDVDEYIDPVIDNVLDKNIKGEPGREFVVLGDKEVDYDPSFRLYLNTKLSNPKYTPAHFSRCMVVNYTVTMKGLEDQLLSVIVGVERKELEEQRERLIQETSENKRLLKDLEDTLLRELATSQGNMLDNVELVQTLEDTKTKAVEVSEKLKLGAKTAIDIDKLRDGYRPAAKLGAVLFFVLSEMSVVNSMYQYSLNSYLEVFDLSLRKSLPDTILSKRLKNIMDTLTMNVYNYACTGLFERHKLLFSFQMTIKIMEADGKLKQEELDFFLKGNIALEKSSRQKPYSWMPDQGWEDVIRLCQVTPEVFGSLADDIERNEKGWREWSDLDAPESHPFPGKYEESLSDFQRLLLLRCFRVDRVYLAITHFVTGRMGEKYVTPPVLSFESILEQSTPFSPVIFILSPGSDPASDLMKLAERSGFGGNKLKFLAMGQGQEKLALQLLETAISRGQWLMLQNCHLLVKWLRTLEKVLERISKPHPDFRLWLTTDPTPEFPIGILQRSLKVVTEPPNGLKLNLRSTYHKISNQMLADCPHQSFSPLVFVLGFFHAVVQERRKYGKIGWNIAYDFNESDFRVCMTLLNTYLTKSLQNTDVKIPWASLKYLIGEVMYGGRVIDDFDRRVVKTYMDEYMGDFIFDTFQPFHFYNNEEVDYCIPKNGENKYDPGRDVYVDYIEELPLANTPDVFGLHPNAEIGYYTNAAKDMWLHLVELQPQT------AGDSGGISREEFITKIASDIQGKLPPLFDVDRVRKNL----SEITPTAVVLLQELDRFNVLIRRMSTSLINLQRALAGEVGMSSELDEVSRSLFNGMIPNIWRKLAPATLKSLGNWMEHFQKRLDQYNKWVNDGEPAV--IWLSGLHIPDSYLTALVQATCRKHGWPLDRSTLYTTVTKYHN--ADEVTERAHSGCFVSGLYLEGASWDLAESCLRRPKPKVLVEELPVLKVIPIESHRLKLQNTFRTPVYTTSQRRNAMGVGLVFEADLATTEHTSHWVLQGVCLTLNSD 4309          
BLAST of Dynein heavy chain vs. Ensembl Nematostella
Match: EDO35603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKZ5])

HSP 1 Score: 1016.91 bits (2628), Expect = 0.000e+0
Identity = 613/1884 (32.54%), Postives = 1014/1884 (53.82%), Query Frame = 1
Query:   76 KLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKH-----------MPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQ-LDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKS--GYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKV--ITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSG-------------EISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQ----RDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININ-HVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPE-SEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACR-RNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIAL 5619
            K+KMLPTP KFHY  NLRDLS+++QG+  +  +       ++ LW+HEC RV +DR    +DK+  +  +  ++ +E  +            + +++  P   GD   +   + P++YE +  +  ++     +++ YN+  +G  +DLV F DA+ HL  + RI+R   G+ALLVGV GSGK+SL+RL++F A    F+I+L++ Y      EDLK +Y           F+F D  +  EGFLE +NN+L+ G V  LF  DE +E+   +     K     P   E +++YF T     LH+VL  SPVG   RNR   FPG+++   +DWF  WP+ AL +VA + +   + +  ++    V+  +  IH  V      +  + RR  ++T  +++++I  Y S+   K  ++    QR+  GLDKL   +  +  L+ ++A ++  +   +   ++++ E++I  + A  +K   + + V+   Q+ V  I  +K  AE  L  A PALE A+ +L  +    ++ +R  A PP  +  + + + L++                + SW  +  LM+ ++F+  L   D ++I  + +  +   +       E  +      AG   +  ++  F+ + +E+ P K  + + E     A+ +L + Q ++ + + +L   +  +++A  E + L  +    +R++LAA  L  GL  EK RW      F ++   L+GD L+ + FL+Y GPF  E+R  L+ N W   ++S  IP + N  +  ++     + +WN QGLP DELS+QN I+ TK+TRFP+ +DPQ Q   WIK  E++       ++I++LN   F   LE+++  G P L ED  E +DP +DNVL KN IKS     V +GD+EVD    F LY+T+KL NP ++P + +R +II++TVT+ GLE QLL  ++  E+ ELE +R  L+ + S NKR +KELED LL  L +  G+++D+  LI  L  TK      A+++SQ ++V+AD E +    R+ +RP A RG++L+F++  +S +N MYQ SL  +L +F +++ RS P    +KR+NNII  LT  V+ Y C G+FE HK L +L +A +++     I HNE    IKG  +++    P     W+ D +W +L +LS  + +FSDIL+Q++ NE +W+NW+   +PE +E  D Y    ++F+KL L+R W  DR       +++  MG ++    I      +  S    P++  +S GSDP   I  LA    ++   I   SMGQGQE +A  L ++ +  G W +LQN HL ++F+  +   + +    H DFRLW+TTE    FPIG+LQ S K   EPP G++  L  TY  I  +    S  P++R  ++ +AFLH+ +QERR++G +GWNI Y+F ++DF  S++ +Q +L     +K   V WNT++Y++GEV YGGR  D FD+R+L T+   +F + +F     F      +  Y IP    + +S+++ + E+I  L    SP VFGLH NA I Y +N  K+    ++ +QP+       +G   ++E ++ +M   +L KLP  Y  +++K   L     +SP  + L QE+DR   ++  +  +L  LK A+ G + MS  L D    + +  +P  W+ ++ E+   +G W   L +R  Q+ TW   G+ ++   W++G   PQ +LTA+ Q+  R    WALD+  L   +T       +++T     G YV G++++G GWD +   ++   ++ L   +P+I ++ I S   +     Q P+Y   +R +   I  V   DL T ++  HWIL+G+AL
Sbjct: 2769 KVKMLPTPAKFHYIFNLRDLSRIWQGILNTIAEVINSERALVSLWKHECQRVVSDRFTNQQDKDWFEKTMKRVIVDELGEDYQPMIDATAYFVDFLRDAPEATGDEPEDADFETPKIYEPIPSFDGLEERLAMYMDLYNDSIRGAGMDLVFFRDAMIHLMRVSRIIRTPRGNALLVGVGGSGKQSLTRLSSFIAGYKTFQITLTRSYNSSNLMEDLKYLYRTAGQNGQGITFIFTDNEIKDEGFLEYLNNVLSSGEVSNLFARDEIDEICGELIPVMKKEFPRRPPTGENLYEYFLTRAKHNLHVVLCFSPVGEKFRNRSLKFPGLISGCTMDWFSRWPKDALIAVADHFLSSFDIVCTAEIKTQVVHSMGVIHDGVANCCTDYFQRFRRATHVTPKSYLSFINGYKSIYTEKRGEIGELAQRMHTGLDKLMEASDSVAQLSKELAVKEKELAVASEKADKVLKEVSIKAQAA--EKVKAQVQKVKDKAQAIVDEIAVDKAVAEGKLEKAKPALEEAEAALQTIKPAHISTVRKLAKPPHLIMRIMDCVLLLMVKKVDPVVHDPERNMLKPSWSESLKLMSKSDFLNNLLNFDKDSINDETVELLAAYLEADDYNMETAKRVCGDVAGLCSWTRAMSTFFGINKEVLPLKANLAVQEARLGVAQGDLNKAQAQLDEKQAELDEAQAMYENAVKEKQDLLDDAEACRRKMLAASALISGLGGEKERWTEQSKEFAEQIGRLVGDVLVCTGFLSYSGPFNQEFRELLMSN-WQKEMKSRKIPFTSNLNVTGMMVDGATVGEWNLQGLPNDELSVQNGIIVTKATRFPLLVDPQGQGKAWIKNREKD-----NEMQITSLNHKYFRTHLEDALSLGRPLLIEDVGEELDPALDNVLEKNFIKSGSTLKVKVGDKEVDVMKGFVLYVTTKLPNPAYTPEISARTSIIDFTVTIKGLEDQLLGLVILTEKAELESERTKLLEDVSSNKRKMKELEDNLLYRLTSTQGSLVDDESLIEVLSVTKT----TAEEVSQKLLVAADTEIKINGAREEFRPVATRGSILYFLIVEMSYVNCMYQTSLKQFLGLFSQSMERSHPSPITSKRINNIIDYLTHEVWRYSCRGLFENHKFLFTLLLAFKIDLQNKRIKHNEFMTLIKGGASLDLKACPPKTCRWITDMTWLNLVELS-KLSQFSDILNQISRNEKQWKNWFDKDAPEEAEIPDGYANSLDTFRKLLLIRSWCPDRTISQARKYISESMGAQYGETVILELEKTWEESDNRTPLINFLSMGSDPTGMIEALAKKHKYDCRAI---SMGQGQEVHARKLLNSFMQTGGWALLQNCHLGLEFMLELIDTVVESEHIHEDFRLWMTTEEHVQFPIGLLQMSIKFTNEPPQGLRAGLKRTYNGISQDQLDVSNLPQWRPMLYSVAFLHSTVQERRKYGPLGWNIPYEFNQADFTASVQFVQNHLDDMDIKK--GVSWNTVRYMLGEVQYGGRVTDDFDKRLLNTFAKVWFSEGMFHPSFNF------YKGYVIP----KGTSVQQ-FLEHIDGLKLVDSPEVFGLHPNADITYQSNLAKDCLDTILSIQPKDS----SSGGGETRESIVHKMADDMLEKLPEDYIQHEVKAR-LQKMGPLSPMNIFLRQEIDRMQRVITAVRITLTDLKLAIDGTIIMSETLRDSLDCMYDARIPTHWKKVSWES-STIGFWFTELIERNAQFRTWCFDGRPNV--FWMTGFFNPQGFLTAMRQEVTRAHKGWALDSVVLHNDVTR---FFKDDITTPPAEGVYVHGLFLDGAGWDRRGCKLVEPPAKVLFTPVPVIHIYAINSTGGRDNRLYQCPIYKKPRRTDLTYIACV---DLKTNQNPDHWILRGVAL 4609          
BLAST of Dynein heavy chain vs. Ensembl Nematostella
Match: EDO47920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKK0])

HSP 1 Score: 1005.74 bits (2599), Expect = 0.000e+0
Identity = 630/1876 (33.58%), Postives = 1029/1876 (54.85%), Query Frame = 1
Query:   85 MLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKN---EFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKP-VQIVGELLCLVLQSGEI----SWKSARGLMADAN-FIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSIN--IPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXX--XTSENKRIXXXXXXXXXXXXA---TQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKY--LSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIK-PHPDFRLWLTTEPVST-----FPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVF-LDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYI-KSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPS-IWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNS 5631
             LPT  KFHY  NLRDLS +FQG+  +T +         RLW HEC RV+ D++I ++D E+   I +++ K    E  +   Y +  P ++  + +     EP+ Y  + D+ V+     E +E+YNE++   ++LVLF+DA++H+  I+RIL    G+ALLVGV GSGK+SL+RLAAF + L  F+I+L KGYG  + + DL  +  K   +N   +FL  D  V +E FL LIN++L  G +P L+ DDE E ++  V ++   +G  + +E  W +F       L +VL  SPVG TLR R R FP + N T IDWF+ WP++AL SV+   I+    L  ++Y   V   +  +H SV  ESQ++    RR NY T  +F+  I  Y +LL+ K  +L  K +RL  GL KL++TA+Q+  L AK+A Q++ +++K    ++L+ ++ + TE+ + +K + +++  ++   +K +++++   EE L+ A PAL AA+ +L+ L+K ++TE+++F +PP   V +   ++ L+  + +I    SWK+A+ +M   + F+ +L   D E I   N+ AV+  +   +   + ++  S A  G   ++I+++ FY +  ++ PK++ ++    E   A ++L +++ ++++L+  L  L   F+ A  E  +  +E     + +  A +L  GLASE  RW   V  F+++   L GD L+ +AF++Y G FT  YR NL+ + WL  L S N  IP +      +LLT +  I+ WN++ LP D +S +NA + T   R+P+ IDPQ Q VKWIK  E N       ++I  L    +L T+E ++  G   L E+  E+VDPV+D ++ +N IK KGR  + +GD+EV++   FR+ L +KL+NP + P + ++  +IN+TVT  GLE QLL+ +V  ER +LEE + +  +   T +      +L++     LA      GN L ++ L+  LE TK  A ++  Q++++      I   R+ YRPAA R ++L+F+L +L+ IN MYQFSL ++ VVF KAI R+ P   +  R+ N+I  +T+ V+ Y   G+FEK K++ + Q+A ++      I  +E+DF ++    +N   P    ++L + SW  +  LS  + +F ++   +  +   W+ + + + PE E      +   + +KLC++R  R DR+  A+++FV   +G ++V    T F  +F  S P  PI  I+SPG DP  ++      I F      +  +S+GQGQE  A    D A   G W++LQN HL+  ++  +EKKL+   +  +PD+R++++ EP  T      P GIL+ S KI  EPP+G+  NL         +   + +   +++  +F L + HA++ ERR+FG  GWN SY F   D  +S+ +L  YL          VPW  ++YL GE+MYGG   D +DRR+ KTY++EY    + +                 P  P   +S  + Y  YI ++LP E SP ++GLH NA IG+ T  +  L++ ++E+QP+  D     G   ++E+ + +++  I  KLP  +++ +    ++    + +P TVV  QE +R N+L  +M  SL  L   L GE+ ++ E++D+S +L    +P  W   A  +M  L +W   L  R  + E W +     +P+ +WLSG   PQS+LTA+ Q   R+N W LD   L   +T    ++ E+       G YV G+++EG  WD + G I   K + L  +MP++ +  I   K  T N  + PVY T QR    G   V    L T E+ S W L G+AL L+S
Sbjct: 2647 FLPTAIKFHYVFNLRDLSNIFQGILFATHECIKTPVDFARLWMHECNRVYRDKLIDDKDMEVFDKIQIDMTKKFFEELDEEAMYAK--PNMFSHFSSGI--GEPK-YLAVPDWEVLSKLLTEALENYNEVN-AVMNLVLFEDAMQHVCRINRILESPRGNALLVGVGGSGKQSLARLAAFISALEVFQITLRKGYGIPDMKLDLANLCTKAGLKNIGTVFLLTDAQVPEENFLVLINDLLASGEIPGLYPDDEVENIISGVRNEVKGAGLQDTRENCWMFFIERVRRNLKVVLCFSPVGATLRVRSRKFPAVTNCTAIDWFHEWPQEALVSVSRRFIEDLEQL-EAEYKPPVAEFMSYVHTSVNEESQMYLANERRYNYTTPKSFLEQINLYRNLLKKKSKELTQKTERLENGLLKLQSTAQQVDDLKAKLASQEVELKQKNEDADKLIQKVGVETEKVSKEKAIADDEEKKVQVIAKDVSEKQRSCEEDLAKAEPALLAAQEALNTLNKGNLTELKSFGSPPGAVVNVCSAVMVLLAPANKIPKDRSWKAAKIMMGKVDAFLDQLINYDKENIHESNLKAVQPYLDNPEFEPDFIKGKSLAAGGICAWVINIVQFYYIFCDVEPKRKALEAANAELAAAEEKLSKIKAKIQELDENLAELTANFERATSEKLKCQQEAESTAKTIELANRLVGGLASENVRWGESVKSFKEQEKTLPGDVLLTTAFVSYHGCFTRRYRDNLLNDKWLVFLASQNPKIPITEGLDPLSLLTDNATIATWNNENLPADRMSTENATILTNCERWPLMIDPQLQGVKWIKTREGN------DLRIVRLGQKGYLDTIERAVSNGECVLIENMGENVDPVLDALIGRNTIK-KGRA-IKMGDKEVEYHADFRMILHTKLANPHYKPEMQAQTTLINFTVTREGLEDQLLADVVSKERPDLEETKASDRIFPLTQQQNAFTIKLKELEDSLLARLSAAGGNFLGDYALVENLEITKRTAAEIEVQVTEAKQTEIKINDAREAYRPAAARASLLYFILNDLNKINPMYQFSLKAFSVVFQKAIERAEPAEEVKARVVNLIDCITYSVFIYTTRGLFEKDKIIFTAQVAFQVLLMKKEIIPHELDFLLRFPAVMNVTSP---VDFLSNLSWGGIKALS-NMEEFRNLDRDIEGSAKRWKKFAESECPEKEKFPQEWKNKTALQKLCMMRALRPDRMTYAVSNFVEEKLGHKYVEDAPTPFAMSFEESGPATPIFFILSPGVDPLKDVEAHGKKIGFTFDAKNFHNVSLGQGQEIVAEQCLDLAAKEGHWVILQNVHLVKNWLPKLEKKLEAFSEGSNPDYRVYISAEPAGTPDAHIIPQGILETSIKITNEPPTGMMANLHKALNNFNQDTLEMCARENEFKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVDVLYNYL-----EANAKVPWTDLRYLFGEIMYGGHITDDWDRRLCKTYLEEYMKPEMLEGELNLA-----------PGFPLPPNSDFKGYHLYIDETLPPE-SPYLYGLHPNAEIGFLTTTSDNLFRTLLEMQPR--DAGGGEGASQTREEKVKQVLDDIFEKLPEEFNVPE----MMARVEDRTPYTVVAFQECERMNMLTNEMKTSLKQLDLGLKGELTITSEMEDLSNALFLDDVPESWTRRAYPSMFGLAAWFVDLLLRIKELEQWTS--DFCLPNVVWLSGFFNPQSFLTAIEQSMARKNEWPLDKMALQVDVTK---KNKEDFNSPPREGAYVHGLFMEGARWDTQTGMIADSKLKDLTPAMPVMFIRAIPVDKQDTKNVYECPVYKTRQR----GPTYVWNFFLKTRENPSKWTLAGVALLLSS 4471          
BLAST of Dynein heavy chain vs. Ensembl Nematostella
Match: EDO31800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW2])

HSP 1 Score: 969.533 bits (2505), Expect = 0.000e+0
Identity = 625/1895 (32.98%), Postives = 998/1895 (52.66%), Query Frame = 1
Query:   61 ILREIKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEF--PKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPE-NKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDEL-SIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENL-TNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNN------SFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLI----KPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPH---PKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSS--NEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTII----TNEEDRSSEN--------LTISSELGC-----YVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAM-----GIGLVTVLDLATTEHNSHWILQGIAL 5619
            I   +   +LPTP K HY  NLRDLSK  QG+ Q+         Q+ RL+ HE  RVF DR+I  EDK    TI+  +    F   +     + NPIL+GD+     D   +LYE+L D   +K+   ++++ YN     ++ LV F DA+EH++ I R++R   G+ALLVGV G+GK+SL+RLA   +    F+I L++GY    FREDLK +Y+    +  + +FLF D  +  E FLE INN+L  G VP LF  +E E +L        ++G PE +++G++ YF +     LHIVL MSPVG   R RCR FP +VN   IDWF  WP +AL SV+    +  + L      + V    V IH SV   +  F  +LRR  Y T T+++  I  YLS+L+ K   L   R R+  GL KL  T   +  +  ++   +  +++K++  E+LM ++ +  EEA   + + + +     +++   +    EA++ L  A+PALEAA+++LD LDK+D++E+R F  PP+ V  V E +C++L   +  W SA+ ++ DA F+K+L   D + IP   +  +K  I   K   E V   SKA    + ++ ++  +  V R + PK+ ++   + E       L   Q  + ++E ++  L+  +D +  E E L K +A    +L  A KLT  L  E+ RW  +VA F+ E  N++G+  +A+A + Y G FT  YRH L+ N W+   + + +P S +F + N+L    EI +WNS GLP D L +I++ IL   + R  + +    +A +WI+      K+    +KI  L D+ FLRTLEN I+ G+P L E+  E +DP ++ +L K      GR  + LGD ++D++  FR Y+T+KL+NP + P +  +  IIN+TVT SGLE QLLS +V+ ER +LE++R  LI+  + +K  LK +ED++L  L    GNILD+  LINTL ++K  +  ++ +L ++      I   R+ YRP A RG+V++FV+ +L+ ++ MYQ+SL  +  +F   I  S     L +RL  ++   T  VY     G+FEK K++ S  +   +      IT  E +FF++G   ++   P      WL D  W     L   +  F               +   LQ  E    D  ++P +      SF++L  ++ ++ +++  A  DFV   +GK FV  P       F + + ++P++ I+S GSDP    ++ A  +++   +I+ +S+GQGQ   A  L   A   G W+ LQN HL   ++  +E  + DL     + H DFRL+L++ P   FP+ +LQ S K+  EPP G++ N    + ++  + F    H    ++R+ +F + F HAI+QER++FG +GWNI Y+F +SD   +L+ L+ +L   +      +PW+ + ++ G++ YGGR  D +D+R L T +  +     F    L   Y+      Y P   E   SL + Y EY+ +LP    P VFG+HENA I + T  T +L   ++E+QP+    +  +G   + ++++ E+   IL KL  + D+ K +++L  +      +  T VL QE+DRFN LLK +  SL  L+KA+ G V MS+ELD +  S  N  +P+ W   +  ++K LGSW++ L  R +  E WI  G     S W+SG   PQ +LT  +Q   R+ N  +D  T +  +     N+E+ + E         L +  EL C      V G+Y++G  WD  +  +   +  ++   +PI+ + P + +     +    P+Y TS R   +         V  + L T    + WI +G AL
Sbjct: 2032 IYARMSTDLLPTPAKSHYVFNLRDLSKCIQGVLQADPGVIRDKGQIFRLFCHEASRVFQDRLINKEDKTFFNTIMSEMAHKHFQQARSPEKFESNPILFGDFMKMGADPADKLYEELTDLKKVKNLLTDYLDDYNMNSSKEMKLVFFMDAIEHISRIARMVRQPRGNALLVGVGGTGKQSLTRLACHMSAYKCFQIELTRGYDYSAFREDLKKLYDVAGVKGENTVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEPEEYEAVLNGTRPLAKEAGIPEGDRDGVFDYFISRVRNNLHIVLCMSPVGDAFRTRCRMFPSLVNCCTIDWFTEWPREALLSVSSNFFEEVD-LGAEGVKDKVAEMCVEIHTSVSTMADRFYAELRRRYYTTPTSYLELITLYLSMLDEKRKQLIGARDRVKNGLKKLLETNDLVDTMQVELVALEPQLKQKSLDVEKLMEKLQVDQEEADKVRNVVQAEEAVAKEKADETSAIAAEAQKDLDEALPALEAAQKALDSLDKSDISELRVFTKPPELVMTVMESICILL-GVKPDWPSAKTMLGDAGFLKKLMDYDKDKIPDSTLRKLKKYIDNPKFVVEVVEKVSKACRSMVMWVRAMDLYARVYRTVEPKRAKLAAAQAELEVVMSTLREKQASLAEVESKIAELQAAYDHSIAEKETLTKNIAQTAARLKRASKLTTALGDEQGRWTENVAAFELEIGNVVGNVFVAAACVAYFGAFTSLYRHELI-NSWIEQCKELGVPVSDDFSLINVLADPYEIRQWNSDGLPRDSLKAIEDRILKLLNMRSTLFL----KANRWIR-----TKEAKNGLKIIKLTDNNFLRTLENCIRIGMPVLLEEVGESLDPALEPILLKQTFVQGGRLLIRLGDSDIDYDKNFRFYMTTKLANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLERPDLEDQRNQLIVRINSDKNQLKAIEDRILKLLFHSEGNILDDEVLINTLNESKVTSGVISTRLKEAERTEEKITIAREKYRPVATRGSVMYFVVASLAEVDPMYQYSLKYFKQLFNACIESSEKTDDLDRRLEILLNNCTESVYVNVARGLFEKDKLVFSFMLCGDIMRQQEIITDEEWNFFLRGTGGLDKERPAKPDVPWLTDFMWNTCCDLEDVLHSFKGFKGDFVKAPITI-SMGNLQQSEVGDDDQAEKPRSWQDRLTSFERLIFIKAFKEEKVVFAAVDFVCENLGKTFVESPSIDLPVLFENVSNMIPLIFILSTGSDPMNAFLRFARDMNY-TERIQAISLGQGQGPVAEKLIANASKNGDWVFLQNCHLAASWMLAMETTIKDLTNNEAEVHEDFRLFLSSMPTKAFPVTVLQNSVKVTNEPPKGLRANTKRAFGELMADPF--ESHVLGVRWRKLVFGICFFHAIIQERKKFGPLGWNIKYEFNDSDRMCALENLKMFLVDEN------IPWDALTFITGQITYGGRVTDEWDQRCLTTILGRF-----FSPKILEDNYKFSESGIYFPPGFE---SLHD-YREYVDNLPLTDEPEVFGMHENANIAFQTQETHQLIYTVLEVQPR----LASSGGGKTNDEIVYELADSILGKLMDVLDMEKAEKSLFETDAKGRYNSLTTVLGQEVDRFNNLLKVIKNSLTQLQKAIKGLVVMSLELDKVYTSFLNNQVPDMWANSSYPSLKPLGSWVKDLVLRTMFVEQWIIHGPPK--SFWISGFFFPQGFLTGTLQNHARKYNLPIDQLTFSYNVLPQYRNQEEVAEETAKLEYGQALPLDEELDCPDDGVLVHGLYLDGARWDDDSMMLGDARYGEMNPPLPILHMEP-QMNLVPDPSQYMSPLYKTSARAGVLSTTGHSTNFVVSVYLPTDLPQAFWIEKGTAL 3888          
BLAST of Dynein heavy chain vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 941.799 bits (2433), Expect = 0.000e+0
Identity = 530/1487 (35.64%), Postives = 852/1487 (57.30%), Query Frame = 1
Query:   61 ILREIKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQG--QLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININH--VFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPE-SEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLI--KPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDS-PHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDE 4497
            I   I  KMLPTPT+ HY  NLRD+SK+FQGL ++  D       + RLW HEC RVF+DR+I N D+E   T+L + + + F   + +  + P      +   + D+  +YEDL D+  IK + ++ +E YN ++ G   ++LVLF DA+EH+  I R++    G+ LLVG+ GSG++SL+RLA++  +   F+I ++K Y  +EFR+DLK +Y +   +N   +FLF D    +EGFLE +NN+L+ G VP L+  DE EE+   + D  AK    +  E ++ +F     + LHIVL MSPVG   RNR R +P  VN T IDWF  WP  AL  VA   ++    L   +   +V    VT+HRSV   S    L+L+R NY+T TN++  +  Y SLL  K  +L     +L  GLDK+++T  ++ +++ ++ +  + V E    CE  ++ I     EA  ++KM + +S +I  +          A+  L  A+PAL+ A ++L+ L+K D+TEI+++  PP  V+ V E + ++L+  E +W  A+  + D NFIK+L   D + +  + +  +    A+     E +   S A      ++ ++  +  + R + PKK+R+     +  + +  L   + +++++  +++ LK+Q+D+   + E L  +  +++ +L  A KL  GLA E++RW + V   ++    L+GDCLIA+AF++Y GPF   YR  LV   WLA +R + +  + NF     L     + +WN QGLP D  S +N ++ T+  R+P+ IDPQ QA+KWIK ME         +KI +L  S +LRTLEN+++FG P L ++  E +DP +  +L+K+++K  GR  + LGD+EV++ P FR Y+T+KLSNP ++P + ++  I+N+ V   GLE QLL  +V+ ER ELEE+++ L++  +  K+ L+ELED++L  L T  G++LD+ +L+NTL  +K  + +VA+QL+ S      I+  R+GYRP A+R ++LFFVL ++  I+ MYQFSL +Y+ +F  +I +S    +L  R+ N+    T+ VY Y C G+FE+HK+L S Q+  ++ E  G +  +E +FF++G + ++         T WL D SW ++ +L   +P F  I+        +W  WY    PE +     ++   N  +++ ++R  R DR+    T F+   +G +FV PP+    +    S+   P++ ++SPG DP + +++LA +     ++   LS+GQGQ   A  +    V  G W+ L N HL + ++  ++K ++ L    PHPDFRLWL++ P   FPI ILQ   K+  EPP G+K N+   Y  I  + F       KY++ +F L F H++L ERR+F  +GWNI Y F +SDF+VS  +L  YL +  E      PW+ +KYL+  V YGG   D FDRR+L +Y++E
Sbjct: 2416 IYNTIVAKMLPTPTRIHYLFNLRDISKIFQGLLRANKDLHDTKTAISRLWVHECFRVFSDRLIDNTDRESFVTLLSDKLGSMF--DLTFHNLCPNKQSPIFGNFMKDDT-MYEDLVDFKAIKRYMEDQMEDYN-MEPGVIAINLVLFRDAIEHVTRIVRVIGQPRGNMLLVGIGGSGRQSLTRLASYIIEYKVFQIEVTKHYRRQEFRDDLKRLYYQAGVDNKPTVFLFNDTQALEEGFLEDVNNILSSGEVPNLYKPDEFEEVRTALSDIAAKEDVQDTPESMFHFFIERVRSNLHIVLCMSPVGDPFRNRIRMYPAFVNCTTIDWFSEWPGDALLEVAERYLE-NIELGDEETKANVAQIFVTVHRSVVDMSARMLLELKRHNYVTPTNYLELVSGYQSLLAEKKKELGDAASKLRNGLDKIDDTRAKVEVMSVELEDATLKVAEFQKQCEEYLVVIVQQKREADEQQKMVQARSEKIAIEEDKCRVMAENAQHDLDEAIPALQEAMKALESLNKKDMTEIKSYGRPPALVEKVMEAV-MILRQSEPTWAEAKRQLGDGNFIKQLVNYDKDNMTDRILKKIGTYCAQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKKQRLHQATAQLEEKQAILAEAKAKLKEVTDRMEELKRQYDEKSAQKEELRAKAELLEIKLDRAGKLVSGLAGERDRWEASVTILEENIGYLVGDCLIAAAFMSYAGPFLSNYRDELVLKTWLAQVRQLGVACNPNFSFSGFLAKPTTVREWNIQGLPSDAFSTENGVMVTRGNRWPLMIDPQGQALKWIKNMEGK-----SGLKIIDLQQSDYLRTLENAVQFGSPVLLQNVQEELDPSLAPILNKSVVKVGGRYLIKLGDKEVEYSPDFRFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDALVINIAAGKKKLEELEDEILRLLQTAQGSLLDDEQLVNTLNSSKTTSQEVAEQLTVSEQTEIKIDAAREGYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNNSIEKSQRSPNLDNRIQNLNEYHTYAVYKYTCRGLFERHKLLFSFQMCSKILEAAGKLNMDEYNFFLRGGVVLDREGQMDNPCTQWLTDTSWDNVTELD-KLPNFHGIVTSFEQYPRDWNQWYTSSEPENTPLPGEWENACNELQRMLVVRSLRPDRVSFTATSFIVNNLGSKFVEPPVLDMSSVVDDSSTRTPLIFVLSPGVDPTSALLQLAENCGMS-NRFHALSLGQGQAPIATRMIKEGVKDGNWVFLANCHLSLSWMPQLDKLVEQLQVEDPHPDFRLWLSSSPHPEFPISILQVGIKMTTEPPKGLKANMKRLYQLITEQQFSRCHKQDKYKKLLFGLCFFHSVLLERRKFLMLGWNIVYGFNDSDFEVSENLLSIYLDEYEE-----TPWDALKYLVAGVNYGGHVTDDFDRRLLHSYINE 3884          
BLAST of Dynein heavy chain vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 1391.33 bits (3600), Expect = 0.000e+0
Identity = 776/1857 (41.79%), Postives = 1150/1857 (61.93%), Query Frame = 1
Query:   91 PTPTKFHYTLNLRDLSKVFQGLCQSTVD-RFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMER--NVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIP-KFSDILDQVTNNEDEWRNWYKLQSPE-SEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGR-IGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETW-IAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIIT--NEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD 5634
            PTP+KFHYT + R+LS+++ GL  +  D       Q +R+WR+ECLR F+DR+    DK +V   +  +++  F      V  +PIL+GDY     + E R+YED+ DY V K+ FQ                 LF+DA+EHL  +HRILR D GHALL+G  GS  ++L++LAAF AD   FEI L +GY E  FR DLK +Y KL  EN   +FLF D H+ +EGFLE INNML + MVPTLF DDEKE ++  +  +  + G   +KE +WQYF       LHIVL +S  G  L+ RCRNFP +++NT IDW+ PW  QAL +VA   ++  NP IP  ++  VI H+  +H S+   S+   LK +R NY T+ +F+++I +Y +LLE K+                                       E  + C+ L   +N   E     ++  +E ++++  Q  V+ K+                     L+E+DKN      +FA PPK VQ+V E + ++    E++W +A+ +M++A F+  L  +D ++I   +I+ +K  +   + + E++++ SKAG+G LKF+ S + ++D+A+E++PKK++VK LE+EF +++ ELE ++ ++  ++ +  +LK++++DA  E E    E  +M+R+L AA+KL  GL SE+  W  D+   +Q+   LLGDCLIA+AFL+Y G F +++R+N+V + W   ++   IP S+ FKI+N LT+ +EIS W S+GLP DE S+QN ILTTK +RFP+CIDPQ+QA+ WIK  E+  N+K      ++S+LND  FL+ LE SIK+G P+L +D +E +DP+I NVL +N++ S+GR  ++LGD+EV+++P F+L+L + L+NP++SPS++ +A +INY+ TL GLE QLLS       +  +++   L+ E SENK +LK L D LL+EL T TGN+LDN ELI TLE TK +A +  K+LS +   + +    R+GYRP AKRGAVLFF L++++++N MYQ+SL SYL +F  +++ S+   +L +RL NII TLT++V+ Y    +F KHK+L S+ + +++E+  G +   E+DF IK N++ +    +    W+PD +W+D+ +L+   P +FS +   +  N   W++W+ L++PE + F   Y E  ++F+KL LLRC R DR+  A+ D+VT  MG   V PP+  F   +  ST   PIV I+S GSDP T+++K A        K   +++GQGQE+  L L + AVS G WL+LQN HLL+K++  +EK L+ +  P+ +FR+W+TT  +  FPIGILQKS K+V EPP  IK N+  TY+KI  +      HP +   ++ LAF HA++QER ++GK GW++  +F +SDF  SL++L TYLTK HE+  + +PW +++YLIGEV+YGGRAIDSFDRRILK YMDEYFGDFLF  FQ FHF+ +  + Y IP         K +YTE I+ +P   +P V GL     IGY T   +E+W ++  LQP+T     + GR IG  E + S +   I  +LP L+DIN +   L     ++SPT+VVLLQEL RFN L+  M  S+  L +AL GEVGMS E DD++ +  N ++P  W+ LAPET+K L  W+ HL +R  QY  W +  G+  +  +WLSGLH+P+SYL A+VQ ACR+  W LD  T  T +T    ED   + L       CY+ G+++EG  WD++NGC+   K + L+  +PI+++ P++ +  +  NT++ PVY TS RRNA G GLV   DL TT H SHW+L G+ L LNSD
Sbjct: 2442 PTPSKFHYTFSQRELSRIYCGLTLTKPDFSCLTVEQFVRVWRNECLRNFHDRLTDETDKALVHGHIKKLVEEYFETDSEAVLADPILFGDYRAAREECEQRVYEDIGDYDVSKAIFQ-----------------LFEDAVEHLTRVHRILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNML-ISMVPTLFADDEKESIIKQINSEALQEGAGSSKESVWQYFLRKSANNLHIVLCLSATGDALKTRCRNFP-LMSNTVIDWYLPWSAQALHAVAQCVLE--NPTIPKAHFGAVIDHICMVHASLCDFSKQLLLKHQRCNYATSKSFLDFISSYSTLLEEKN---------------------------------------EHVLQCKCLEGSLNRLRE----AREQIDELNLKLADQKVVLAKKTA--------------TCTAFLEEIDKNQTI---SFAKPPKQVQVVCECILVLRGKKELNWLTAKKMMSEAGFLHSLMQMDCDSISNSHISTIK-FLKNLQTSVEEMQSISKAGSGILKFVESFMSYWDIAKEVQPKKDQVKRLEKEFLQSKAELECIKNDLNNMQKEASSLKEKYEDANLEKELQLDEAKLMERRLTAADKLVLGLTSER-EWTKDLEELKQQHECLLGDCLIAAAFLSYAGAFNWDFRNNMVYDKWTQDVKQKGIPLSQPFKIENFLTNQLEIS-WGSEGLPPDEQSVQNGILTTKGSRFPLCIDPQQQALNWIKNKEKDNNLK------QVSSLNDPDFLKQLELSIKYGYPFLLQDVNEDIDPIIINVLERNVVVSEGRTVIVLGDKEVNYDPNFKLFLHTTLANPQYSPSVFEKALVINYS-TLRGLEDQLLSVTTGFLEKVFQQQHLLLVEEISENKTLLKSLGDSLLMELGTSTGNMLDNTELIQTLEKTKTEASETIKKLSVAQSKTVEFANLREGYRPVAKRGAVLFFALSDMALVNRMYQYSLTSYLSLFELSLQESLAHPNLQQRLENIINTLTYNVHNY----LFGKHKLLFSMNMTVKIEQTEGGVPQKELDFLIK-NLSGDGTKVQKPHEWIPDQAWQDITKLAELFPEQFSSLPSDIEQNSTNWKSWWDLRAPEQAPFPLQYSESLSAFQKLLLLRCLRADRLHRAMADYVTVTMGN-CVHPPLINFTTIYERSTAFSPIVFIMSSGSDPTTDLIKFAEKSG---TKFTLIAVGQGQEQVVLKLLEKAVSIGSWLILQNCHLLVKWLKDLEKALEKITNPNINFRMWITTNAIDDFPIGILQKSQKVVAEPPEDIKLNMKATYSKISQQTLSSCQHPAFCSLVYVLAFFHAVVQERSKYGKTGWSVPCNFNDSDFSASLEVLSTYLTKCHEQGDSFIPWESLQYLIGEVVYGGRAIDSFDRRILKVYMDEYFGDFLFSPFQHFHFFRNKDVGYKIPP-----PGRKHVYTE-IEKMPLITTPEVAGLPSTVEIGYYTQAVEEMWTHLRVLQPET-----QVGRGIGGDEHI-SHIAQDIQKQLPELFDINLVGEEL---GTDLSPTSVVLLQELRRFNKLVLCMQQSVVELLRALTGEVGMSKESDDLAHAFCNDLVPAMWKRLAPETLKSLDDWMSHLRRRYEQYSNWQVREGEPKV--MWLSGLHVPESYLAAVVQAACRKKGWPLDQSTFHTEVTRYRTEDDIDDRLK-----QCYLSGLFLEGADWDMENGCLARSKPKVLVVELPILKVIPVQKNSLRLRNTLRTPVYTTSLRRNASGAGLVFEADLFTTMHTSHWVLSGVCLYLNSD 4176          
BLAST of Dynein heavy chain vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 986.867 bits (2550), Expect = 0.000e+0
Identity = 615/1887 (32.59%), Postives = 1012/1887 (53.63%), Query Frame = 1
Query:   76 KLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKH-------------MPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQ-LDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKS--GYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKV--ITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSG----EI---------SWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININ-HVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKP---HPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDD---HIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRN-NWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIAL 5619
            K+KMLPTP KFHY  NLRDLS+++QG+  +  +     + +L LW+HEC RV  DR    +D E     L  +++ +  +              + +++  P   G+   E+  D P++YE ++ +  +K     F+  YN+  +G  +D+V F DA+ HL  + RI+R  GG+ALLVGV GSGK+SL+RLA+F A    F+I+L++ Y      EDLK +Y     +     F++ D  + +E FLE +NN+L+ G V  LF  +E +E+L  +     +     P   E ++ YF +     LH+VL  SPVG   RNR   FP +++   +DWF  WP+ AL  V+ + +   +     Q    V+  + +    V  +   + L+ RR  ++T  +++++I+ Y      K   +E + + +  GL KL+  +  +  L+ ++  ++  ++      + ++ E+ +  E + + K   E + V+   Q+ V  IT +K  AEE L  A PALE A+ +L  +  +D+  +R  + PP  +    + + L+L+      EI         SW+ +  LM   +F+ EL+    + I  + +  ++          E  R AS   AG L +  ++  F+ + +E+ P K  + + E     A  +LE+ Q E+   + +L  ++ ++++A  E   L ++    +R++  A  L  GLA EK RW      F  +   L+GD L+A+AFL+Y GPF  E+R +L+ N W   L+  +IP   N  I  LL     +S+WN QGLP DELSI N I+ TK+ RFP+ IDPQ Q   WIK      K+    ++I++LN   F   LE S+  G P L ED  E +DPV+DNVL KN IK+     V +GD+EVD    F+LY+T+KL NP ++P + +R +II++TVT+ GLE QLL  ++  E+RE+E++R +L+ + + NKR +KELED LL  L +  G+++D+  LI  L +TK  A +V ++L  +      I   R+ YRP A RG++L+F++T +S++N MYQ SL  +L +F  ++ RS   S+ ++R+ +II  +TF VY Y   G++E+HK L +L + L+++    N+TH E    IKG  +++    P+    W+ D SW +L +LS  + +FS+ILDQ++++E  W++W+  ++PE E +    +  + F++L L+RCW  DR       ++   MG+++    I      +  S P  P++  +S GSDP   I+ L   +  E    +Y+SMGQGQE +A  L    ++ G W +LQN HL + F   +++ +D +I+    +  FRLW+TTE    FPI +LQ S K   EPP G+K  L  TY  I  ++   S   +++  ++ +AFLH+ +QERR+FG +GWNI Y+F ++DF  +++ +Q +L     ++   V WNT++Y+IGE+ YGGR  D +D+R+L T+   +            + +E D   +  Y IP    +CSS+ + Y  YI+ LP   +P VFGLH NA I + +   K++   ++ +QP+       +G   ++E  +S M   +L KLP  Y   ++KR  L     + P  + L QE+DR   ++  + ++L  LK A+ G + MS  L D    + +  +P  W  +       LG W   L +R  Q++TW+  G+ +    W++G   PQ +LTA+ Q+  R N  WALD   L   +T       +++      G YV G+Y+EG  WD  N  +   K + L + MP+I ++  E++  K       P+Y    R +   I  +  + L TT+   HW+L+G+AL
Sbjct: 2276 KIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGY------KTIYVEKRAEVMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVK--VEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFR-SLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKN-----KEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELS-KLWQFSEILDQISHHEKLWKSWFDKEAPEEEVLPNSYQSLDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIE---TRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNF---MDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQ--LVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVW---------FNKNMFERDFNFYKGYGIP----KCSSVDQ-YLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSS----SGGGETREAAVSRMADDMLEKLPPDYIPFEVKR--LQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARW--MKSWASSTLGFWFTELLERNRQFQTWLFKGRPN--CFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTK---WMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA-ENNVVKDPRLYSCPIYKKPTRTD---INCIASVGLKTTQPPEHWVLRGVAL 4108          
BLAST of Dynein heavy chain vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 971.459 bits (2510), Expect = 0.000e+0
Identity = 615/1895 (32.45%), Postives = 1009/1895 (53.25%), Query Frame = 1
Query:   76 KLKMLPTPTKFHYTLNLRDLSKVFQG-LCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKH-------------MPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQ-LDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKS--GYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKV--ITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSG----EI---------SWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININ-HVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKP---HPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDD---HIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRN-NWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTI-------QVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIAL 5619
            K+KMLPTP KFHY  NLRDLS+++QG LC +   R      +L LW+HEC RV  DR    +D E     L  +++ +  +              + +++  P   G+   E+  D P++YE ++ +  +K     F+  YN+  +G  +D+V F DA+ HL  + RI+R  GG+ALLVGV GSGK+SL+RLA+F A    F+I+L++          LK +Y     +     F++ D  + +E FLE +NN+L+ G V  LF  +E +E+L  +     +     P   E ++ YF +     LH+VL  SPVG   RNR   FP +++   +DWF  WP+ AL  V+ + +   +     Q    V+  + +    V  +   + L+ RR  ++T  +++++I+ Y ++   K  +++    R+  GL KL+  +  +  L+ ++  ++  ++      + ++ E+ +  E + + K   E + V+   Q+ V  IT +K  AEE L  A PALE A+ +L  +  +D+  +R  + PP  +    + + L+L+      EI         SW+ +  LM   +F+ EL+    + I  + +  ++          E  R AS   AG L +  ++  F+ + +E+ P K  + + E     A  +LE+ Q E+   + +L  ++ ++++A  E   L ++    +R++  A  L  GLA EK RW      F  +   L+GD L+A+AFL+Y GPF  E+R +L+ N W   L+  +IP   N  I  LL     +S+WN QGLP DELSI N I+ TK+ RFP+ IDPQ Q   WIK      K+    ++I++LN   F   LE S+  G P L ED  E +DPV+DNVL KN IK+     V +GD+EVD    F+LY+T+KL NP ++P + +R +II++TVT+ GLE QLL  ++  E+RE+E++R +L+ + + NKR +KELED LL  L +  G+++D+  LI  L +TK  A +V ++L  +      I   R+ YRP A RG++L+F++T +S++N MYQ SL  +L +F  ++ RS   S+ ++R+ +II  +TF VY Y   G++E+HK L +L + L+++    N+TH E    IKG  +++    P+    W+ D SW +L +LS  + +FS+ILDQV ++E  W++W+  ++PE E +    +  + F++L L+RCW  DR       ++   MG+++    I      +  S P  P++  +S GSDP   I+ L   +  E    +Y+SMGQGQE +A  L    ++ G W +LQN HL + F   +++ +D +I+    +  FRLW+TTE    FPI +LQ S K   EPP G+K  L  TY  I  ++   S   +++  ++ +AFLH+ +QERR+FG +GWNI Y+F ++DF  +++ +Q +L     ++   V WNT++Y+IGE+ YGGR  D +D+R+L T+   +            + +E D   +  Y IP    +CSS+ + Y  YI+ LP   +P VFGLH NA I + +   K++   ++ +QP+       +G   ++E  +S M   +L KLP  Y   ++KR  L     + P  + L QE+DR   ++  + ++L  LK A+ G + MS  L D    + +  +P  W +        LG W   L +R  Q++TW+  G+ +    W++G   PQ +LTA+ Q+  R N  WALD   L   +T       +++      G YV G+Y+EG  WD  N  +   K + L + MP+I ++   +   +    I         P+Y    R +   I  +  + L TT+   HW+L+G+AL
Sbjct:  834 KIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNHSSRNIIFQVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSGLLEGLIAYLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVQMLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVK--VEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFR-SLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKN-----KEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGGASLDLKTCPQKPAEWILDMSWLNLVELS-KLWQFSEILDQVHHHEKLWKSWFDKEAPEEEVLPNSYQSLDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIE---TRYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNF---MDELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQ--LVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVW---------FNKNMFERDFNFYKGYGIP----KCSSVDQ-YLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSS----SGGGETREAAVSRMADDMLEKLPPDYIPFEVKR--LQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARW-MKESWASSTLGFWFTELLERNRQFQTWLFKGRPN--CFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTK---WMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNGSSEKKKKIVKDPRLYSCPIYKKPTRTD---INCIASVGLKTTQPPEHWVLRGVAL 2682          
BLAST of Dynein heavy chain vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 615/1907 (32.25%), Postives = 1002/1907 (52.54%), Query Frame = 1
Query:   85 MLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQI---------------NPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLA-TENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELL--LHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDK-NDVTEIRAFATPPKPVQIVGELLCLV--LQSGEIS------------WKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYED-----VRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAK--QLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPES-EFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDD--LIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIP---NEVFLDSP--HPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGIL-HKLPILYDINKI--KRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAM-----GIGLVTVLDLATTEHNSHWILQGIALTLNSDD 5637
            +LPTP K HYT NLRD S+V QG              ++RL+ HE  RV++DR++ +ED+  +  ++ +I+K+ F  ++P+ Q+                 +L+GDY    L+ + RLY ++          +  +E YN++ + +++LV+F   LEHL+ I R+L+  GG+ALLVGV GSG++S++RLA   A ++ F+  +SK YG  E+R+DLK M  + A  +    +FL  D  +  E FLE I+++L  G VP LF  DEK+E++  +       K     +   ++ +F   C   LH+V+A SP+G   R R R FP ++N   IDWF PWPE+AL  VA   ++     +     + VIT   T H S    S  FQ +L R NYIT T+++  I T+  L+  K   +   +QR   GLD+L     ++  +  ++ + +  +E+  I   ++M  I + + E   K ++          ++      K E E  L+ A+PALEAA  +LD L + +D++ ++A   PP  V++V   +C++  ++   I             W  ++ L+ D NF+++L+  D + IP+     V  TI    +T  D     V  AS A  G  K+I ++  +  VA+ + PKK ++   +      +  L++ + E++++E +L  L+K F++  +E  RL  ++    R+L  AEKL  GL+ EK  W       Q    NL GD LI++  + YLGPFT  +R N  +  W    +S NIP S +F +   L + +EI  WN  GLP D  SI N ++   S R P+ IDPQ QA KW+K +E++      ++ +  L D  ++RTLEN I+FG P L E+  E +DP ++ +L K   K +G E + LG+R +++   FR Y+T++L NP + P + ++ +++N+ +T  GLE QLL  +V  +  ELEE+R  LIL+++ NKR LKE+ED +L  L +  GNIL++   I  L+  K  + ++ K  Q+  +      I   R+GYR  AK  ++LFF + +L+ I+ MYQ+SL  ++ +++ +I + +    L +RL  +    T+++YC  C  +FEK K+L S  +   L      I H+++ F + G I + +       +WL D SW ++ + S  +P F   L+    N ++++  Y  + P S +    + E     +K+ + RC R D +P A+T FVT  +GK+FV PP      +F  S   +P+V ++SPG+D P  ++K A+    +  + + +S+GQGQ   A  +  TA+  G W+ LQN HL + +++ +EK  +D  L   H DFRLWLT+ P   FP+GILQ   K+  E P+G++ NL  +Y   P      F   P   P + + +F L F HA++QER++FG +GWNI Y F ESD  +S++ LQ ++ +  +     VP+  I YL GE  YGGR  D +DRR+L T + +++ + +   F+          +Y+ P +     S  E Y ++I++LP  Q P VFGLHEN  I      TK L+ +++     T+      G     +  L ++   IL  +LP  +D   +  K  +LY  +       VL+QE++R+N L   +  SL  L KAL G V M  EL+ ++ +L  G +P  W   +  ++K LGS++     R    + W   G+  +   WLSG    Q++LT ++Q   R+    +D  T      + E    +      E G YV G++++G  WD K G +  Q  R L  SMPII + P + +  +T +    P+Y TS+R+  +         V  + L+T +   HWI +G+A+ L  DD
Sbjct: 1832 LLPTPAKSHYTFNLRDFSRVIQGCLLLKKGSLEGKQTLIRLFVHEVYRVYHDRLVDDEDRTWLYQLMNSIVKDHF--NVPFDQVFGQLKQGDKLEEKDMQNLLFGDYMNPDLEGDERLYTEVPSIETFAEVVKSCLEEYNQMHKNRMNLVIFY-LLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATSMAHMTLFQPEISKNYGMTEWRDDLKQMLLRNAGVKGQKTVFLITDTQIKDEAFLEDIDSVLNTGEVPNLFAVDEKQEIIETIRPIAQAGKKSVELSPLTLFAFFVARCKENLHVVVAFSPIGKAFRKRLRQFPSLINCCTIDWFQPWPEEALERVANSFLESLE--MSENERQEVITICKTFHTSANQLSD-FQAELGRYNYITPTSYLELIATFQQLISQKRETIMNAKQRYINGLDQLAFAESEVAKMKKELVDLQPKLEQAKIDNTKMMEVIEVESIEVEAKSRVVHVDEEAAAMKANEAQALKSECENDLAEALPALEAALTALDTLKQPSDISIVKAMKNPPSGVKLVMAAVCVMKNVKPDRIPDPAGTGKKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPV----PVMQTIRNEFMTNPDFDPSKVANASSAAEGLCKWITAMEVYDKVAKVVAPKKAKLAEAQESLAATKAVLDQKRAELKEVEDRLTALQKTFEEKTEEKARLEMQVESCARKLERAEKLIGGLSGEK-IWSKAADDLQNTYDNLTGDVLISAGVIAYLGPFTSGFRQNCTK-LWTTLCQSKNIPSSDDFSLSKTLGNPIEIRAWNIAGLPNDSFSIDNGVIVRNSRR-PLMIDPQGQANKWVKNLEKD-----NNLNVIKLTDGDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQTFK-QGVESIKLGERVIEYSADFRFYVTTRLKNPHYLPEVATKVSLLNFMITPEGLEDQLL-GIVVAKEPELEEERTALILQSANNKRQLKEIEDSILETLQSSKGNILEDESAIQILDSAKIMSNEITKKQQIQIAEKTELKIAESREGYREVAKHSSILFFSIADLTNIDPMYQYSLIWFVNLYINSI-QDIKSKVLKQRLEYLKDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNLLAR-KEIEHSDLMFLLTGGIGLQNTVANPDPSWLQDKSWDEICRAS-ELPGFQG-LEAFIKNPEDFKLIYDSREPCSIDLPAPWCEKLTDLQKMIIFRCLRPDMVP-AVTKFVTRNLGKKFVQPPAFDLTKSFLDSNSTIPLVFVLSPGAD-PMALLKFASDKKMDGSRFQSISLGQGQGPIAAKMIFTAMQNGSWVCLQNCHLAVSWMSNLEKICEDFSLTTCHQDFRLWLTSYPSPKFPVGILQNGVKMTNEQPTGLRLNLLQSYLTDPVSDPNFFNGCPDKKPVWEKLLFGLCFFHALVQERKKFGPLGWNIPYGFNESDLHISMRQLQQFVNEYDK-----VPFEAITYLTGECNYGGRVTDDWDRRLLMTTLADFYCEDIIKTFRYPLSPSG---KYFAPPK-----SSYEDYIQFIENLPISQQPEVFGLHENVDISKDLQQTKLLFDSLL----LTQGGGAMGGVSSGGDNTLYDIANNILTQQLPPTFDREAVLLKYPVLYEES----MNTVLVQEMERYN-LCSTICVSLQNLLKALKGLVVMDSELEAVAGNLIVGKVPEKWAKFSYPSLKPLGSYITDFLARLKFLQVWYENGQPKV--FWLSGFFFTQAFLTGVMQNFARKYQIPIDLLTF-----DFEVLPIDKSETPPEDGVYVNGLFLDGARWD-KEGVLTEQHPRILFDSMPIIWVKPEKKNMIQTDSLYVCPLYKTSERKGTLSTTGHSTNFVIAMMLSTKKRPQHWIKRGVAMLLQLDD 3682          
BLAST of Dynein heavy chain vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 836.254 bits (2159), Expect = 0.000e+0
Identity = 569/1889 (30.12%), Postives = 931/1889 (49.29%), Query Frame = 1
Query:   76 KLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEF-PKHMPYVQINPILYG-DYWTETLD----------DEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQ-LDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKS--GYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKV--ITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSG----EI---------SWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQ-VTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDR-IPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKP---HPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLD-SPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDD---HIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIK-RNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRN-NWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIAL 5619
            K+KMLPTP KFHY  NLRDLS+++QG+  +  +     + +L LW+HEC RV  DR    +D E     L  +++ +   +H   V      Y  D+  +  +          D P++YE ++ +  +K     F+  YN+  +G  +D+V F DA+ HL  + RI+R  GG+ALLVGV GSGK+SL+RLA+F A    F+I+L+  Y      EDLK +Y     +     F++ D  + +E FLE +NN+L+ G V  LF  +E +E+L  +     +     P   E ++ YF +     LH+VL  SPVG   RNR   FP +++   +DWF  WP+ AL                     H       I  S +++S++ Q      + + A   ++Y                     +  GL KL+  +  +  L+ ++  ++  ++      + ++ E+ +  E + + K   E + V+   Q+ V  IT +K  AEE L  A PALE A+ +L  +  +D+  +R  + PP  +    + + L+L+      EI         SW+ +  LM   +F+ EL+    + I  + +  ++          E  R AS   AG L +  ++  F+ + +E+ P K  + + E     A  +LE+ Q E+   + +L  ++ ++++A  E   L ++    +R++  A  L  GLA EK RW      F  +   L+ D L+A+AFL+Y GPF  E+R +L+ N W   L+  +IP   N  I  LL     +S+WN                                                  ++I++LN   F   LE S+  G P L ED  E +DPV+DNVL KN IK+     V +GD+EVD    F+LY+T+KL NP ++P + +R +II++TVT+ GLE QLL  ++                                     T+  +++D+  LI  L +TK  A +V ++L  +      I   R+ YRPA  RG++L+F++T +S++N MYQ SL  +L +F  ++  S   S+ ++R+ +II  +TF VY Y   G++E+HK L +L + L+++    N+TH E    IKG        P+    W+ D SW +L +LS  + +FS+ILDQ ++++E  W++W+  ++PE E +    +  + F++L L+RCW  DR I      ++   MG+++    I      +  S P  P++  +S GSDP   I+ L   +  E    +Y+SMGQGQE +A  L    ++ G W +LQN HL + F+   ++ +D +I+    +  FRLW+TTE    FPI +LQ S K   EPP G+K  L  TY    N+  LD S   +++  ++ +AFLH+ +QERR+FG +GWNI Y+F ++DF  +++ +Q +L     ++   V WNT++Y+IGE+ YGGR  D +D+R+L T+   +            + +E D   +  Y IP    +CSS+ + Y  YI+ LP   +P VFGLH NA I + +   K++   ++ +QP+       +G   ++E  +S M   +L KLP  Y   +I+ R  L     + P  + L QE+DR   ++  + ++L  LK A+ G + MS  L D    + +  +P  W          LG W   L +R  Q++TW+  G+ +    W++G   PQ +LTA+ Q+  R N  WALD   L   +T       +++      G YV G+Y+EG  WD  N  +   K + L + MP+I ++    +  K       P+Y    R +   I  +  + L TT+   HW+L+G+AL
Sbjct: 2437 KIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDDVEWFDQTLAKLVEQQLGEEHKKVVDCGVERYFVDFLRDPPEATEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTL-YNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRRPPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVE------------------SHHFLSAFDIDCSPQVKSEVVQCMGSFQDCV-AEKCVDYF--------------------MNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEVTVKAEASELVK--VEVQKVKDKAQAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLV-DVLLATAFLSYSGPFNQEFR-SLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWN--------------------------------------------------LQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVIL------------------------------------TEKRSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPAT-RGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLASS-KSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLTLIKGASLDLKTCPQKPAEWILDMSWLNLVELS-KLWQFSEILDQQISHHEKLWKSWFDKEAPEEEVLPNSYQSLDCFRRLLLIRCWCPDRTIAQQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIET---RYVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFM---DELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYG--INQDLLDVSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQ--LVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVW---------FNKNMFERDFNFYKGYGIP----KCSSVDQ-YLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSS----SGGGETREAAVSRMADDMLEKLPPDYIPFEIQVRERLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKQESWASSTLGFWFTELLERNRQFQTWLFKGRPN--CFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTK---WMKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYA--ENNVKDPRLYSCPIYKKPTRTD---INCIASVGLKTTQPPEHWVLRGVAL 4154          
BLAST of Dynein heavy chain vs. Planmine SMEST
Match: SMESG000073407.1 (SMESG000073407.1)

HSP 1 Score: 3551.14 bits (9207), Expect = 0.000e+0
Identity = 1802/1857 (97.04%), Postives = 1805/1857 (97.20%), Query Frame = 1
Query:   70 EIKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPL-AFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSDD 5637
            EIKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVKNERRELEEKRENLILETSENKRILKELEDKLLLELATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFTSSTPIVPIVVIISPGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNE+F   P  K    +  L    H ILQ                            Q +      RKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYFGDFLFDQFQLFHFYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDL TTEHNSHWILQGIALTLNSDD
Sbjct:  336 EIKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVKNERRELEEKRENLILETSENKRILKELEDKLLLELATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFTSSTPIVPIVVIISPGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNELFF-MPFCKKDDVLERLVGIFHMILQN---------------------------QIF------RKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYFGDFLFDQFQLFHFYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLETTEHNSHWILQGIALTLNSDD 2158          
BLAST of Dynein heavy chain vs. Planmine SMEST
Match: SMESG000073407.1 (SMESG000073407.1)

HSP 1 Score: 3549.99 bits (9204), Expect = 0.000e+0
Identity = 1802/1857 (97.04%), Postives = 1805/1857 (97.20%), Query Frame = 1
Query:   70 EIKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPL-AFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSDD 5637
            EIKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVKNERRELEEKRENLILETSENKRILKELEDKLLLELATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFTSSTPIVPIVVIISPGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNE+F   P  K    +  L    H ILQ                            Q +      RKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYFGDFLFDQFQLFHFYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDL TTEHNSHWILQGIALTLNSDD
Sbjct:  342 EIKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVKNERRELEEKRENLILETSENKRILKELEDKLLLELATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFTSSTPIVPIVVIISPGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNELFF-MPFCKKDDVLERLVGIFHMILQN---------------------------QIF------RKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYFGDFLFDQFQLFHFYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLETTEHNSHWILQGIALTLNSDD 2164          
BLAST of Dynein heavy chain vs. Planmine SMEST
Match: SMESG000073407.1 (SMESG000073407.1)

HSP 1 Score: 3549.99 bits (9204), Expect = 0.000e+0
Identity = 1802/1857 (97.04%), Postives = 1805/1857 (97.20%), Query Frame = 1
Query:   70 EIKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPL-AFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSDD 5637
            EIKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVKNERRELEEKRENLILETSENKRILKELEDKLLLELATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFTSSTPIVPIVVIISPGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNE+F   P  K    +  L    H ILQ                            Q +      RKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYFGDFLFDQFQLFHFYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDL TTEHNSHWILQGIALTLNSDD
Sbjct:  345 EIKLKMLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVFNDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDEPRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRILRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFREDLKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDEKEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLRNRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVITHVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDLETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEINISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKRSLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMADANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVKNERRELEEKRENLILETSENKRILKELEDKLLLELATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFTSSTPIVPIVVIISPGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNELFF-MPFCKKDDVLERLVGIFHMILQN---------------------------QIF------RKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYFGDFLFDQFQLFHFYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLETTEHNSHWILQGIALTLNSDD 2167          
BLAST of Dynein heavy chain vs. Planmine SMEST
Match: SMESG000073414.1 (SMESG000073414.1)

HSP 1 Score: 2230.68 bits (5779), Expect = 0.000e+0
Identity = 1124/1275 (88.16%), Postives = 1202/1275 (94.27%), Query Frame = 1
Query: 1813 IAKRKLTYEDVRAASKAGAGFLKFIISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLKTLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAGFQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHSRNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSDD 5637
            +AKRKLTYEDVR+ASKAG GFLKFIISVLGFYDVAREI+PK+ERVKMLE+EFNKA+KELERLQEEV++LE QLK L+KQFDDAQDEMERLNKEMAIMQRQLLAAEKLT GLASEK RWISDVAGFQQERVNLLGDCLIASAFL+YLGPFTYEYRHNL+EN W+ SLR+INIP S N+K+QNLLTSDVEISKWNSQGLPLDELSIQNAILTTK+ RFPVCIDPQEQAVKWIKKME+N+KDESKSIKISN ND  FLRTLEN IKFGLPYLFEDCDE++DPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSP+LYSRANIINYTVTLSGLEGQLLSALVKNERRELEEKRE+LI+ETSENKRILKELEDKLLLELATQTGNILDNWELINTLEDTKAKAV+VAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVIN MYQFSLGSYLVVFLKAIR++MPDSSLAKRL NIITTLT HVYCYGCTGIFEKHK+LLSLQ+A+RLEED GNI H EIDFFIKGN+NI    P+   NW+P++SWKDL+QL ITIPKFS IL+ +  +ED W++WY LQ+PE+E  D Y E +NSFKKLCLLRC RIDRIP AITDFVTAVMGKEFVSPPITTFHAAFTSSTP VP+VVIISPGSDPP EI+KLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFP+GILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSL+ILQTYLTKAHE+KQ ++PW+TIKYLIGEVMYGGRAIDSFDRRILKTYMDEYFGDFLFDQFQLFHFYEDDH+EYYIPDEPEECSSLKEIYTEYIKSLPQEQSP+VFGLHENALIGYSTNFTKELWQNMIELQPQTEDE+ E G+IG KEK++ E+VIGIL+KLP LYD  KIK+NLL SSNE+SP  VVLLQELDRFN+LLKKMF SLN LKKALVGEVGMS ELDDISKSLSNGM+PNCWR LAPET+KMLGSWLEHLE RK QYE WI AGKVD+P IWLSGLHLP+SYLTAL+QKACRRNNWALD CTL+TI+T  + RSSE+LT++ E GCY VG Y+EGCGW+V NGCI+PQKSR+ LQSMPIIQLHPIESHKYKTTNTI+VPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSDD
Sbjct:    1 MAKRKLTYEDVRSASKAGGGFLKFIISVLGFYDVAREIKPKRERVKMLEKEFNKAKKELERLQEEVQRLEDQLKALRKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTTGLASEKLRWISDVAGFQQERVNLLGDCLIASAFLSYLGPFTYEYRHNLIENSWIESLRNINIPLSTNYKVQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKAARFPVCIDPQEQAVKWIKKMEKNLKDESKSIKISNFNDPTFLRTLENGIKFGLPYLFEDCDENIDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPNLYSRANIINYTVTLSGLEGQLLSALVKNERRELEEKRESLIVETSENKRILKELEDKLLLELATQTGNILDNWELINTLEDTKAKAVEVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINTMYQFSLGSYLVVFLKAIRKAMPDSSLAKRLRNIITTLTHHVYCYGCTGIFEKHKLLLSLQLAMRLEEDKGNIKHIEIDFFIKGNVNIGQKLPDKQFNWMPESSWKDLSQLKITIPKFSKILEHIQEHEDLWKDWYMLQNPENEIPDEYFESHNSFKKLCLLRCLRIDRIPTAITDFVTAVMGKEFVSPPITTFHAAFTSSTPTVPVVVIISPGSDPPAEIIKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPVGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRFGKIGWNISYDFAESDFQVSLQILQTYLTKAHEKKQASIPWSTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYFGDFLFDQFQLFHFYEDDHVEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPKVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEISEEGQIGGKEKIIREIVIGILYKLPNLYDTGKIKKNLLLSSNEVSPIAVVLLQELDRFNLLLKKMFTSLNALKKALVGEVGMSGELDDISKSLSNGMLPNCWRKLAPETVKMLGSWLEHLEMRKKQYEAWIEAGKVDLPIIWLSGLHLPESYLTALIQKACRRNNWALDACTLSTIVTKVDGRSSESLTMTPEFGCYSVGFYLEGCGWNVDNGCIMPQKSRKFLQSMPIIQLHPIESHKYKTTNTIKVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSDD 1275          
BLAST of Dynein heavy chain vs. Planmine SMEST
Match: SMESG000073407.1 (SMESG000073407.1)

HSP 1 Score: 1984.15 bits (5139), Expect = 0.000e+0
Identity = 1045/1101 (94.91%), Postives = 1048/1101 (95.19%), Query Frame = 1
Query: 2338 NFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVXXXXXXXXXXXXXXXXXTSENKRIXXXXXXXXXXXXATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFXXXXXXXXXXXXXXXGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPL-AFLHAILQERRRFGKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYXXXXXXXXXXXXXXYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSDD 5637
            N KIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVKNERRELEEKRENLILETSENKRILKELEDKLLLELATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFTSSTPIVPIVVIISPGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNE+F   P  K    +  L    H ILQ                            Q +      RKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYFGDFLFDQFQLFHFYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDL TTEHNSHWILQGIALTLNSDD
Sbjct:    2 NIKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQEQAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCDEHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKFSPSLYSRANIINYTVTLSGLEGQLLSALVKNERRELEEKRENLILETSENKRILKELEDKLLLELATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSVIVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLKAIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRLEEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIPKFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWRIDRIPIAITDFVTAVMGKEFVSPPITTFHAAFTSSTPIVPIVVIISPGSDPPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQNAHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVMEPPSGIKQNLTGTYAKIPNELFF-MPFCKKDDVLERLVGIFHMILQN---------------------------QIF------RKQTAVPWNTIKYLIGEVMYGGRAIDSFDRRILKTYMDEYFGDFLFDQFQLFHFYEDDHIEYYIPDEPEECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIELQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSSNEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISKSLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSIWLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTISSELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYKTTNTIQVPVYVTSQRRNAMGIGLVTVLDLETTEHNSHWILQGIALTLNSDD 1068          
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH100.000e+051.65dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH100.000e+051.59dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH100.000e+051.65dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH100.000e+051.65dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
DNAH20.000e+034.25dynein axonemal heavy chain 2 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhc-14.326e-17726.44Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-14.326e-17726.44Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-15.802e-17726.44Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
che-32.260e-11023.89Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-35.276e-2021.86Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhc98D0.000e+046.05gene:FBgn0013813 transcript:FBtr0301303[more]
Dhc98D0.000e+046.05gene:FBgn0013813 transcript:FBtr0301302[more]
Dhc98D0.000e+046.05gene:FBgn0013813 transcript:FBtr0337034[more]
Dhc93AB0.000e+034.10gene:FBgn0013812 transcript:FBtr0273236[more]
Dhc93AB0.000e+034.10gene:FBgn0013812 transcript:FBtr0336774[more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkeyp-86b9.10.000e+051.62si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
DNAH100.000e+051.62si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
DNAH100.000e+051.62si:dkeyp-86b9.1 [Source:ZFIN;Acc:ZDB-GENE-060531-1... [more]
dnah20.000e+034.44dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
dnah20.000e+034.44dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH100.000e+052.59dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
DNAH100.000e+052.59dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
DNAH100.000e+052.59dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
DNAH20.000e+034.08dynein, axonemal, heavy chain 2 [Source:NCBI gene;... [more]
asxl20.000e+033.16ASXL transcriptional regulator 2 [Source:Xenbase;A... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah100.000e+051.35dynein, axonemal, heavy chain 10 [Source:MGI Symbo... [more]
Dnah100.000e+051.35dynein, axonemal, heavy chain 10 [Source:MGI Symbo... [more]
Dnah20.000e+035.23dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
Dnah20.000e+035.23dynein, axonemal, heavy chain 2 [Source:MGI Symbol... [more]
Dnah80.000e+032.75dynein, axonemal, heavy chain 8 [Source:MGI Symbol... [more]
back to top
BLAST of Dynein heavy chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IVF4|DYH10_HUMAN0.000e+051.65Dynein heavy chain 10, axonemal OS=Homo sapiens OX... [more]
sp|Q9SMH3|DYH1A_CHLRE0.000e+044.20Dynein-1-alpha heavy chain, flagellar inner arm I1... [more]
sp|P0C6F1|DYH2_MOUSE0.000e+035.23Dynein heavy chain 2, axonemal OS=Mus musculus OX=... [more]
sp|Q9MBF8|DYH1B_CHLRE0.000e+033.93Dynein-1-beta heavy chain, flagellar inner arm I1 ... [more]
sp|Q9P225|DYH2_HUMAN0.000e+034.25Dynein heavy chain 2, axonemal OS=Homo sapiens OX=... [more]
back to top
BLAST of Dynein heavy chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JWZ80.000e+053.65Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9JWZ00.000e+053.65Uncharacterized protein OS=Biomphalaria glabrata O... [more]
V4BRT30.000e+053.46Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A2T7PHE30.000e+053.86Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2R2MKY40.000e+053.75dynein heavy chain 10, axonemal-like OS=Lingula un... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkeyp-86b9.10.000e+051.76dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
dnah20.000e+034.46dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
ENSAMXT00000016172.20.000e+033.01pep primary_assembly:Astyanax_mexicanus-2.0:4:1379... [more]
dnah50.000e+032.22dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
dnah120.000e+032.15dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009595.10.000e+051.05pep scaffold:Pmarinus_7.0:GL478108:144315:184457:1... [more]
DNAH60.000e+033.75dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
ENSPMAT00000000736.15.089e-14632.35pep scaffold:Pmarinus_7.0:GL477446:167298:178455:-... [more]
ENSPMAT00000001140.17.896e-11031.41pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 ge... [more]
ENSPMAT00000010791.13.075e-10332.01pep scaffold:Pmarinus_7.0:GL476647:224020:289570:-... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN13.616e-7323.15Cytoplasmic heavy chain dynein; microtubule motor ... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO358520.000e+051.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356030.000e+032.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479200.000e+033.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318000.000e+032.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340770.000e+035.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein heavy chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkeyp-86b9.10.000e+041.79dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
dnah50.000e+032.59dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah50.000e+032.45dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah120.000e+032.25dynein axonemal heavy chain 12 [Source:NCBI gene;A... [more]
dnah50.000e+030.12dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Dynein heavy chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073407.10.000e+097.04SMESG000073407.1[more]
SMESG000073407.10.000e+097.04SMESG000073407.1[more]
SMESG000073407.10.000e+097.04SMESG000073407.1[more]
SMESG000073414.10.000e+088.16SMESG000073414.1[more]
SMESG000073407.10.000e+094.91SMESG000073407.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017158 ID=SMED30017158|Name=Dynein heavy chain|organism=Schmidtea mediterranea sexual|type=transcript|length=5668bp
TTATTCAAACTTTGTGGAATATAAATTTTAAAGGAAGCATTTTCAGCCAC
GTTCTATTGAATTTTACGGGAAATAAAATTAAAAATGTTACCAACTCCAA
CCAAATTTCATTACACATTAAATTTAAGAGACCTCTCCAAAGTATTTCAA
GGATTATGTCAGTCCACAGTTGATAGGTTTACAAAAGCTAATCAAATGTT
AAGGCTCTGGAGACATGAATGTTTAAGAGTATTTAATGATCGAATGATAA
CTAACGAGGATAAAGAAATTGTACAGACAATATTATTAAATATCATGAAA
AATGAATTCCCAAAACACATGCCATATGTTCAAATTAATCCAATTTTATA
TGGTGATTATTGGACAGAAACATTAGATGATGAACCAAGACTTTATGAGG
ATTTACAGGATTATGCAGTAATTAAATCTTTTTTTCAAGAGTTTATTGAA
AGTTATAACGAATTAGATCAAGGACAATTAGACCTAGTTTTATTTGATGA
TGCCCTAGAACATCTAAATAGTATTCATAGAATCCTCAGAATGGATGGTG
GCCATGCTTTACTAGTTGGTGTCAGTGGATCAGGAAAGCGGAGTTTGTCA
CGACTTGCTGCTTTTGCGGCTGATTTAAGTTTTTTTGAAATTTCATTAAG
TAAAGGGTACGGAGAAAGAGAATTTCGAGAAGATTTGAAAGTCATGTACA
ATAAACTTGCTACTGAAAACTCTGATTTTATGTTTTTATTCGGAGATCAA
CATGTAGCTCAAGAAGGTTTTCTAGAGTTAATTAATAATATGTTAACAAT
GGGTATGGTTCCCACATTATTCACAGATGATGAAAAAGAAGAATTATTAT
TGCATGTATGGGATGATGGTGCCAAAAGTGGCTATCCAGAAAATAAAGAA
GGAATATGGCAATATTTTTGTACGTTATGCATTGCTAGATTGCATATAGT
CTTGGCAATGAGTCCAGTTGGTGGCACTTTACGAAATAGATGTCGAAATT
TTCCAGGAATTGTTAACAATACTAACATTGATTGGTTTTATCCATGGCCT
GAACAAGCTCTGTTTTCAGTGGCTTGTTATGCAATTGATCCAAAGAATCC
GTTAATACCTTCACAGTACTGGGAGCACGTAATTACGCATGTGGTTACAA
TTCACCGATCAGTTGAAATAGAATCTCAAATTTTCCAGCTCAAGTTACGG
CGAGATAATTACATAACGGCCACAAACTTTATGAATTATATAAAAACGTA
TTTATCATTATTAGAAACAAAAGATTTTGACCTTGAAACAAAAAGGCAAC
GATTGACAGTTGGACTGGACAAACTTGAAAACACTGCTAGGCAAATCCAT
TTGCTAAATGCTAAAGTAGCAGAGCAAAAAATAATTGTTGAAGAGAAAAC
GATATCATGTGAACGTTTAATGATTGAGATCAATATCTCAACTGAAGAAG
CAACAATAAAAAAGAAAATGACTGAAGAAAAATCGGTTGAAATTACTCAA
CAGTCAAAAGTGATTACTAAAGAAAAAGGCGAAGCTGAAGAAGCTTTGAG
TTTGGCAATGCCAGCATTAGAAGCTGCTAAAAGATCTTTAGATGAACTAG
ATAAAAATGATGTTACTGAAATTAGAGCTTTCGCCACTCCTCCTAAACCC
GTTCAAATAGTTGGTGAATTGCTTTGTTTGGTATTACAATCTGGAGAAAT
CAGTTGGAAATCAGCTAGAGGATTAATGGCAGATGCCAACTTTATTAAAG
AACTTCAAACTTTAGATGTAGAAGCAATTCCACTTAAAAATATCAACGCT
GTCAAAGATACTATTGCCAAAAGAAAATTAACATATGAAGACGTTAGAGC
AGCCAGTAAAGCTGGAGCGGGGTTTCTGAAGTTTATTATCTCTGTGCTTG
GATTCTATGATGTTGCTCGTGAAATAAGACCTAAAAAAGAGAGAGTTAAG
ATGTTAGAAAGGGAATTCAATAAAGCAAGAAAAGAATTAGAGAGATTACA
AGAAGAAGTTAGAAAATTAGAATTTCAATTGAAAACATTAAAGAAACAAT
TTGATGATGCTCAAGATGAAATGGAAAGACTAAATAAGGAAATGGCAATT
ATGCAGCGGCAATTATTAGCAGCTGAAAAATTAACAAAGGGATTGGCATC
GGAAAAAAATAGATGGATTTCTGATGTAGCAGGTTTTCAGCAAGAAAGAG
TAAATCTATTAGGAGATTGTTTAATCGCATCGGCGTTTTTAAACTATTTG
GGACCATTCACATATGAATATAGACATAATTTAGTTGAAAATTATTGGCT
GGCAAGTTTGCGTTCTATAAATATCCCTCACAGTCGAAATTTTAAAATTC
AGAATCTTTTAACGTCAGATGTTGAAATATCGAAATGGAATAGTCAAGGC
CTTCCATTAGATGAATTGAGCATTCAAAATGCAATTTTAACAACGAAATC
TACAAGATTTCCAGTTTGTATTGATCCTCAAGAGCAAGCTGTTAAATGGA
TTAAAAAAATGGAAAGAAATGTCAAAGATGAATCAAAATCAATCAAAATT
TCCAATTTAAATGATTCTTTATTTCTGAGAACTCTAGAAAACAGTATAAA
ATTTGGTTTACCATATTTATTTGAGGATTGTGATGAACATGTAGATCCAG
TCATAGACAATGTCTTGTCAAAGAATATTATAAAATCCAAAGGCAGAGAA
TATGTCATGTTAGGGGATCGTGAAGTTGACTGGGAGCCGCCATTTAGATT
ATATTTAACTTCAAAATTAAGTAATCCAAAATTTTCACCAAGTCTCTATA
GTCGAGCAAATATTATTAACTATACTGTGACGTTATCTGGTCTGGAAGGT
CAGTTGTTATCAGCTCTTGTTAAAAATGAAAGACGAGAATTGGAAGAAAA
GCGGGAAAATTTAATTTTAGAAACTAGTGAAAACAAAAGAATTTTAAAGG
AGCTTGAAGATAAACTTTTATTAGAACTCGCAACTCAGACTGGAAATATT
CTTGATAACTGGGAGCTAATAAACACTCTTGAAGACACAAAAGCTAAGGC
GGTTGATGTTGCAAAGCAATTATCTCAGTCAGTGATAGTTTCAGCTGATA
TTGAGCGCCAAAGAGATGGATACAGACCAGCTGCAAAACGTGGCGCAGTT
TTATTTTTTGTATTAACTAATTTATCTGTTATTAATGCAATGTATCAATT
TTCTCTTGGATCGTATTTGGTAGTATTCTTAAAAGCGATTCGTAGATCAA
TGCCGGATAGTTCACTTGCTAAACGGTTGAATAACATAATAACAACGTTA
ACATTCCATGTTTATTGTTATGGTTGTACAGGAATTTTTGAAAAACATAA
AATGCTGTTATCATTGCAAATTGCTCTGAGATTAGAAGAAGATATAGGAA
ATATTACCCACAATGAAATAGATTTTTTTATCAAAGGAAATATAAATATA
AATCATGTCTTCCCAGAGAATTTAACTAATTGGTTACCAGACAATTCTTG
GAAAGATTTGAATCAGTTATCAATAACAATTCCAAAATTTTCTGATATAT
TAGATCAAGTTACAAACAATGAAGATGAATGGAGAAATTGGTATAAACTT
CAAAGTCCGGAATCAGAATTTATTGATTATTATAAAGAACCAAACAACAG
TTTTAAAAAGTTATGCCTGTTACGCTGTTGGAGAATTGATCGTATACCAA
TTGCAATTACTGATTTCGTAACAGCTGTTATGGGTAAAGAATTTGTCAGC
CCTCCGATAACCACTTTTCATGCTGCGTTCACATCATCAACTCCGATAGT
ACCAATTGTGGTTATAATTAGCCCTGGTAGTGATCCGCCTACCGAAATTG
TCAAATTAGCTAATTCAATTGATTTCGAGATACATAAAATCAAATATTTG
TCAATGGGCCAAGGTCAAGAAAAAAATGCCTTGGCTTTATTTGATACAGC
GGTATCTCGTGGACAATGGTTAATGCTCCAAAATGCCCATTTACTGATCA
AATTTATTGCAGTTATTGAAAAGAAACTTGATGATTTAATTAAACCGCAT
CCAGATTTTAGATTATGGCTAACAACAGAGCCCGTTTCAACTTTCCCTAT
TGGAATTCTTCAAAAGTCATATAAGATAGTAATGGAACCTCCGTCAGGAA
TTAAACAAAATTTAACGGGAACTTATGCAAAAATTCCTAACGAAGTCTTC
CTAGATTCTCCTCATCCTAAGTATAGACAATGCATTTTCCCATTAGCTTT
TCTTCATGCCATTTTGCAAGAAAGACGACGTTTTGGAAAGATTGGTTGGA
ATATTTCATATGATTTTGCAGAATCAGATTTTCAGGTTTCTTTGAAAATT
CTTCAAACATATTTGACTAAAGCTCATGAAAGGAAGCAAACTGCTGTACC
ATGGAATACAATAAAATATTTAATTGGCGAAGTTATGTATGGTGGTCGAG
CTATTGATAGTTTTGATCGGAGAATTCTTAAAACATATATGGATGAGTAT
TTTGGTGATTTTCTATTCGACCAATTCCAATTATTTCATTTTTATGAAGA
TGATCACATTGAATATTACATACCGGATGAGCCGGAAGAATGTAGTTCTT
TGAAAGAAATTTATACAGAGTACATCAAATCTTTACCTCAAGAACAAAGT
CCAAGAGTTTTTGGATTGCATGAAAATGCATTAATTGGATACTCAACAAA
TTTTACAAAAGAACTCTGGCAGAATATGATCGAATTACAACCTCAAACTG
AAGACGAAATGTTCGAAGCAGGACGAATAGGAAGCAAAGAAAAAGTTTTA
AGCGAGATGGTCATTGGGATTCTGCATAAATTACCGATTCTTTACGATAT
AAATAAAATTAAAAGAAATCTTTTATACAGTTCGAATGAAATTAGTCCAA
CAACAGTCGTATTACTTCAAGAATTAGACAGATTTAATGTGTTATTAAAA
AAAATGTTTGCATCTTTAAATACACTAAAAAAGGCATTAGTTGGTGAAGT
TGGAATGTCGATTGAATTAGATGATATTAGCAAGTCGTTATCAAATGGAA
TGATGCCAAACTGCTGGAGAATACTTGCACCAGAAACTATGAAAATGCTT
GGAAGTTGGTTGGAGCATTTAGAACAGAGAAAAATACAATATGAAACATG
GATAGCAGCAGGTAAAGTAGATATGCCTTCTATATGGCTTTCAGGCCTTC
ACTTACCACAGTCTTATTTGACAGCCTTGGTTCAAAAAGCATGTAGACGA
AACAATTGGGCATTGGATACATGTACGTTAACTACAATTATAACAAATGA
AGAAGACCGAAGCTCAGAAAATTTAACAATATCTTCCGAACTTGGTTGTT
ATGTGGTCGGTATCTATATTGAAGGGTGTGGATGGGATGTAAAGAATGGA
TGTATAATACCACAAAAATCCCGACAACTACTTCAATCAATGCCGATTAT
TCAATTGCATCCAATCGAGTCCCATAAATATAAAACTACAAACACAATTC
AAGTACCTGTTTATGTTACTTCTCAAAGACGCAATGCAATGGGGATAGGT
TTAGTTACTGTTTTGGATCTTGCAACTACTGAGCATAATAGTCATTGGAT
ATTACAGGGTATCGCATTGACTTTGAATTCTGACGATTGAAATAATCCAC
TTAATGCTTTTAATCAAA
back to top

protein sequence of SMED30017158-orf-1

>SMED30017158-orf-1 ID=SMED30017158-orf-1|Name=SMED30017158-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1852bp
MLPTPTKFHYTLNLRDLSKVFQGLCQSTVDRFTKANQMLRLWRHECLRVF
NDRMITNEDKEIVQTILLNIMKNEFPKHMPYVQINPILYGDYWTETLDDE
PRLYEDLQDYAVIKSFFQEFIESYNELDQGQLDLVLFDDALEHLNSIHRI
LRMDGGHALLVGVSGSGKRSLSRLAAFAADLSFFEISLSKGYGEREFRED
LKVMYNKLATENSDFMFLFGDQHVAQEGFLELINNMLTMGMVPTLFTDDE
KEELLLHVWDDGAKSGYPENKEGIWQYFCTLCIARLHIVLAMSPVGGTLR
NRCRNFPGIVNNTNIDWFYPWPEQALFSVACYAIDPKNPLIPSQYWEHVI
THVVTIHRSVEIESQIFQLKLRRDNYITATNFMNYIKTYLSLLETKDFDL
ETKRQRLTVGLDKLENTARQIHLLNAKVAEQKIIVEEKTISCERLMIEIN
ISTEEATIKKKMTEEKSVEITQQSKVITKEKGEAEEALSLAMPALEAAKR
SLDELDKNDVTEIRAFATPPKPVQIVGELLCLVLQSGEISWKSARGLMAD
ANFIKELQTLDVEAIPLKNINAVKDTIAKRKLTYEDVRAASKAGAGFLKF
IISVLGFYDVAREIRPKKERVKMLEREFNKARKELERLQEEVRKLEFQLK
TLKKQFDDAQDEMERLNKEMAIMQRQLLAAEKLTKGLASEKNRWISDVAG
FQQERVNLLGDCLIASAFLNYLGPFTYEYRHNLVENYWLASLRSINIPHS
RNFKIQNLLTSDVEISKWNSQGLPLDELSIQNAILTTKSTRFPVCIDPQE
QAVKWIKKMERNVKDESKSIKISNLNDSLFLRTLENSIKFGLPYLFEDCD
EHVDPVIDNVLSKNIIKSKGREYVMLGDREVDWEPPFRLYLTSKLSNPKF
SPSLYSRANIINYTVTLSGLEGQLLSALVKNERRELEEKRENLILETSEN
KRILKELEDKLLLELATQTGNILDNWELINTLEDTKAKAVDVAKQLSQSV
IVSADIERQRDGYRPAAKRGAVLFFVLTNLSVINAMYQFSLGSYLVVFLK
AIRRSMPDSSLAKRLNNIITTLTFHVYCYGCTGIFEKHKMLLSLQIALRL
EEDIGNITHNEIDFFIKGNININHVFPENLTNWLPDNSWKDLNQLSITIP
KFSDILDQVTNNEDEWRNWYKLQSPESEFIDYYKEPNNSFKKLCLLRCWR
IDRIPIAITDFVTAVMGKEFVSPPITTFHAAFTSSTPIVPIVVIISPGSD
PPTEIVKLANSIDFEIHKIKYLSMGQGQEKNALALFDTAVSRGQWLMLQN
AHLLIKFIAVIEKKLDDLIKPHPDFRLWLTTEPVSTFPIGILQKSYKIVM
EPPSGIKQNLTGTYAKIPNEVFLDSPHPKYRQCIFPLAFLHAILQERRRF
GKIGWNISYDFAESDFQVSLKILQTYLTKAHERKQTAVPWNTIKYLIGEV
MYGGRAIDSFDRRILKTYMDEYFGDFLFDQFQLFHFYEDDHIEYYIPDEP
EECSSLKEIYTEYIKSLPQEQSPRVFGLHENALIGYSTNFTKELWQNMIE
LQPQTEDEMFEAGRIGSKEKVLSEMVIGILHKLPILYDINKIKRNLLYSS
NEISPTTVVLLQELDRFNVLLKKMFASLNTLKKALVGEVGMSIELDDISK
SLSNGMMPNCWRILAPETMKMLGSWLEHLEQRKIQYETWIAAGKVDMPSI
WLSGLHLPQSYLTALVQKACRRNNWALDTCTLTTIITNEEDRSSENLTIS
SELGCYVVGIYIEGCGWDVKNGCIIPQKSRQLLQSMPIIQLHPIESHKYK
TTNTIQVPVYVTSQRRNAMGIGLVTVLDLATTEHNSHWILQGIALTLNSD
D*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042219AAA_lid_11_sf
IPR041589DNAH3_AAA_lid_1
IPR043160Dynein_C_barrel
IPR041658AAA_lid_11
IPR035706AAA_9
IPR041228Dynein_C
IPR024317Dynein_heavy_chain_D4_dom
IPR024743Dynein_HC_stalk
IPR027417P-loop_NTPase
IPR004273Dynein_heavy_D6_P-loop
IPR017899VPS28_C
Vocabulary: cellular component
TermDefinition
GO:0030286dynein complex
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005929cilium
GO:0042995cell projection
Vocabulary: molecular function
TermDefinition
GO:0003777microtubule motor activity
GO:0000166nucleotide binding
GO:0003774motor activity
GO:0005524ATP binding
GO:0016887ATPase activity
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 926..960
NoneNo IPR availableCOILSCoilCoilcoord: 614..683
NoneNo IPR availableGENE3DG3DSA:1.20.1270.280coord: 1540..1706
e-value: 1.8E-13
score: 52.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1226..1350
e-value: 1.2E-32
score: 114.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.11510coord: 759..928
e-value: 3.5E-60
score: 203.9
NoneNo IPR availableGENE3DG3DSA:1.20.920.30coord: 1..99
e-value: 2.3E-27
score: 97.8
NoneNo IPR availableGENE3DG3DSA:1.20.920.20coord: 929..1009
e-value: 1.2E-12
score: 49.1
NoneNo IPR availableGENE3DG3DSA:1.20.920.20coord: 380..718
e-value: 6.7E-87
score: 293.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 111..318
e-value: 1.5E-72
score: 245.1
NoneNo IPR availableGENE3DG3DSA:1.10.8.1220coord: 1013..1102
e-value: 1.2E-12
score: 49.9
NoneNo IPR availablePANTHERPTHR45703FAMILY NOT NAMEDcoord: 3..1845
NoneNo IPR availablePANTHERPTHR45703:SF3coord: 3..1845
NoneNo IPR availableCDDcd00890Prefoldincoord: 554..668
e-value: 0.00278856
score: 37.6953
IPR042219Dynein heavy chain AAA lid domain superfamilyGENE3DG3DSA:1.10.8.720coord: 1351..1529
e-value: 6.9E-53
score: 180.8
IPR041589Dynein heavy chain 3, AAA+ lid domainPFAMPF17857AAA_lid_1coord: 2..75
e-value: 1.2E-18
score: 67.2
IPR043160Dynein heavy chain, C-terminal domain, barrel regionGENE3DG3DSA:3.10.490.20coord: 1708..1845
e-value: 2.5E-11
score: 45.5
IPR024743Dynein heavy chain, coiled coil stalkPFAMPF12777MTcoord: 406..740
e-value: 1.0E-51
score: 176.0
IPR041658Dynein heavy chain AAA lid domainPFAMPF18198AAA_lid_11coord: 1357..1532
e-value: 1.9E-52
score: 177.4
IPR004273Dynein heavy chain region D6 P-loop domainPFAMPF03028Dynein_heavycoord: 1237..1356
e-value: 6.9E-35
score: 119.7
IPR024317Dynein heavy chain, AAA module D4PFAMPF12780AAA_8coord: 132..392
e-value: 4.3E-86
score: 288.5
IPR035706Dynein heavy chain, ATP-binding dynein motor regionPFAMPF12781AAA_9coord: 767..992
e-value: 5.4E-82
score: 274.2
IPR041228Dynein heavy chain, C-terminal domainPFAMPF18199Dynein_Ccoord: 1539..1845
e-value: 1.5E-74
score: 251.0
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 133..399