E3 ubiquitin-protein ligase UBR4

Overview
NameE3 ubiquitin-protein ligase UBR4
Smed IDSMED30017151
Length (bp)17018
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase UBR4 (SMED30017151) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase UBR4 (SMED30017151) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase UBR4 (SMED30017151) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase UBR4 (SMED30017151) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017151

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30017151h1SMcG0004788 dd_Smed_v4_2422_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017151h1SMcG0004788 dd_Smed_v4_2422_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017151h1SMcG0004788 dd_Smed_v4_2422_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017151h1SMcG0004788 dd_Smed_v4_2422_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017151h1SMcG0004788 dd_Smed_v4_2422_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017151h1SMcG0004788 dd_Smed_v6_2422_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017151h1SMcG0004788 dd_Smed_v4_2422_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Human
Match: UBR4 (ubiquitin protein ligase E3 component n-recognin 4 [Source:HGNC Symbol;Acc:HGNC:30313])

HSP 1 Score: 337.035 bits (863), Expect = 1.175e-108
Identity = 264/970 (27.22%), Postives = 479/970 (49.38%), Query Frame = 1
Query: 13936 EIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESLRKEVPLEH-----YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHKN---SRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDA-LKEGI-KLDLKRPDTIXXXXXXXXXXXXXXG-QACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVL 16788
            E+ +I   +++ +V  +L   L +R+L+V R+K+  + +    + ++D++  +E   ++F+ + +    ++ + D ++   I E++ + I P + E   F V L+    QEDFL  RM G   SS   G  P + D+ N + ++  + +    D  ++L+ + K++  DL + ++Y+ VW C+   N+  PMR+  R+ GL+ D    ++ESL      E      Y+ +  + + GG+  ++ RLA + +   G  ++   ++L +Y +KV  N  +L++  ++T+ V+L  L + L    + K       +    +++++  IL    A  +++    +    +   + +LLD I+     S   + Q  +  IP  L+F    +M ++++   P+      +     + K  L C C + + I ++  G   +  +++KG+    +D++    P    L   I K  L RP     L       +   G Q  +G++          ++P     LHKLE V S + IG L+E+ L AL+E   D+NK I   R  T+   +  A+ +RQK L  + MT N+KGQV  + + L     +++EEPG  C IC +GY  +P + LG+YTF K+V + +     M+  P       Q  Y++VS++  VH+ CH  AV++     EW  A   N N KCN L+P+ GPH P++ F   L R+ T +   T   E  YQL +HD+K L LRFA  + F+ DTGGG R SNI L+P II   +  +++     ++E + +  +LEQ     + + ++ ++     Y  V  L     E W   RV+IL+ LL  +  R +     +++    ++   YS Y   L+ + ++   YN+  K  TS+  T   W  +++ Y R ND+ + + ++K ++ +++  +P E+ SEF DV  L   I   E +L  +L
Sbjct: 4250 EVESIKRHFKSRLVGTVLNGYLCLRKLVVQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYNLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYKKVW-CT--TNEGEPMRIVYRMRGLLGDATEEFIESLDSTTDEEEDEEEVYKMAGVMAQCGGLECMLNRLAGIRDFKQGRHLLTVLLKLFSYCVKVKVNRQQLVKLEMNTLNVMLGTLNLALVAEQESK--DSGGAAVAEQVLSIMEIILDESNAEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQGLLRIIP-YLSFGEVEKMQILVERFKPYCNFDKYDEDHSGDDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQNALDYMKKHIPSAKNLDADIWKKFLSRPALPFILRLLRGLAIQHPGTQVLIGTD----------SIPN----LHKLEQVSSDEGIGTLAENLLEALRE-HPDVNKKIDAARRETRAEKKRMAMAMRQKALGTLGMTTNEKGQV-VTKTALLKQMEELIEEPGLTCCICREGYKFQPTKVLGIYTFTKRVALEE-----MENKPR-----KQQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDIKLLFLRFAMEQSFSADTGGGGRESNIHLIPYIIHTVLY-VLNTTRATSREEKNLQGFLEQPK---EKWVESAFEVDGPYYFTVLALHILPPEQWRATRVEILRRLLVTSQARAVAPGGATRLTDKAVK--DYSAYRSSLLFWALVDLIYNMFKKVPTSN--TEGGWSCSLAEYIRHNDMPIYEAADKALKTFQEEFMPVETFSEFLDVAGLLSEITDPESFLKDLL 5179          

HSP 2 Score: 81.6481 bits (200), Expect = 1.175e-108
Identity = 119/517 (23.02%), Postives = 218/517 (42.17%), Query Frame = 2
Query: 12392 SHSKHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYD--TRLARAKNNLVNVNESLFESNKIRQ------------NCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNLVSENEPAIEHKSSLIFPSMPVLCINQ-WLQDDSSQLFETWLQCTREENQIP-RDITLN------SDQGNVGLIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDSWRNGQARPGLSN 13876
            S S  ++  + QL  +Y  D K    E+  + ++++A++K +  YD   R A  K++  +V  + F +++ R              CY C  +  +  I L++ L+  P +RH + +   ++++        L   +++MR+E+  L+  +TRD  E   ++N LI  ++  AL+  + +    S ++  + LL  SI+  DS WELRLR A+++ L        + N    VV   I L+  C+R L   +K P    K N     +  +E  +++      +    Q WL+ D    ++ W +C      +P R I  N      S+  ++ L +K+  RW      K+    +  +   ++       WL Q L + +  + RQA   +VE L      R + VL +L   L           D+L                      E + +Y+AL ++L    HW+ YL  +  L  + +L    + + LA  E +     + G A   L+ 
Sbjct: 3787 STSASVNRYILQLAQEYCGDCKNSFDELSKIIQKVFASRKELLEYDLQQREAATKSSRTSVQPT-FTASQYRALSVLGCGHTSSTKCYGCASAVTEHCITLLRALATNPALRHILVSQGLIREL----FDYNLRRGAAAMREEVRQLMCLLTRDNPEATQQMNDLIIGKVSTALKGHWANPDLASSLQYEMLLLTDSISKEDSCWELRLRCALSLFL-------MAVNIKTPVVVENITLM--CLRILQKLIKPPAPTSKKN----KDVPVEALTTVKPYCNEIHAQAQLWLKRDPKASYDAWKKC------LPIRGIDGNGKAPSKSELRHLYLTEKYVWRW------KQFLSRRGKRTSPLDLKLGHNNWLRQVLFTPATQAARQAACTIVEALATIP-SRKQQVLDLLTSYL-----------DEL------------------SIAGECAAEYLALYQKLITSAHWKVYLAARGVLPYVGNLITKEIARLLALEEATLSTDLQQGYALKSLTG 4243          

HSP 3 Score: 250.366 bits (638), Expect = 7.825e-65
Identity = 192/734 (26.16%), Postives = 336/734 (45.78%), Query Frame = 2
Query: 5642 TVGKNKQMKEAFKSVRTSEKISERVTTIMGSSIQLRNAEAPSDMSGIPPTSVLASEIAGANSHVRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNE---AEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKV--------QRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQEFLRSKESSKTKIQNKSSSNMEG 7807
             VG + + ++A   + T EK  E    +M  +  L + E   +       +V  +        +R ++ +  +RR  + V+S   G    +  LAV+ +K +I + ++S LL++                   D   ++  + ++ +  +PFTVLS+  NP  + Y+AVCGLK+  VL F+S GS+S   V+ P L   N FII ++WLPGS   L ++    V+I+DL      P ++F    S+ +D TF F          + E K+   +++MS +G I+ + +++   A  G FY+  +L+ N E     +D  + V G GG S++Y H LQ+LF SY  G++F + +     E+   + + ++I++    ++    L  W  + +HPGL+  + Q T  P+ + V+P+ +  Q ++                        T P +  ++D + +        QRT  ++L  DG ++I MAN+ + +    +WLQ                       P+L+   + S      KR      I    SS    P+DFFEH +Q  +V FGG+  L++Y+ + +  R+ S    V+       ++ I+N     ++ G+RI I      + P Y EI+ R + +   L+++R  D    + E L  DK L+L IG S +   + +ID VK++ + K    W +E  E   S   S     N + SN  G
Sbjct: 1831 AVGSSSRAQQALSELHTVEKAVEMTDQLMVPT--LGSQEGAFE-------NVRMNYSGDQGQTIRQLISAHVLRRVAMCVLSSPHG---RRQHLAVSHEKGKITVLQLSALLKQ------------------ADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTFSSSGSVSDHLVLHPQLATGN-FIIKAVWLPGSQTELAIVTADFVKIYDLCVDALSPTFYFLLPSSKIRDVTFLF----------NEEGKN--IIVIMSSAGYIYTQLMEEASSAQQGPFYVTNVLEINHEDL---KDSNSQVAG-GGVSVYYSHVLQMLFFSYCQGKSFAATISRTTLEVL--QLFPINIKSSNGGSKTSPALCQWSEVMNHPGLVCCVQQTTGVPLVVMVKPDTFLIQEIK------------------------TLPAKAKIQDMVAIRHTACNEQQRTTMILLCEDGSLRIYMANVENTS----YWLQ-----------------------PSLQPSSVISIMKPVRKRKTAT--ITTRTSSQVTFPIDFFEHNQQLTDVEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEISNNNSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLN--LSRSRWFDFPFTREEALQADKKLNLFIGASVDPAGVTMIDAVKIYGKTKEQFGWPDEPPEEFPSASVSNICPSNLNQSNGTG 2460          

HSP 4 Score: 176.792 bits (447), Expect = 1.114e-42
Identity = 117/439 (26.65%), Postives = 212/439 (48.29%), Query Frame = 2
Query: 10880 QEAKLCRALTSKM----DNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHLLTKYPNWERIESFSHQLTNDIVQSSQELLSNSC-TPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEY-DCFTGSVSNSDNVKCPRCHSASIQGN--VCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITS 12160
            QE +LC AL +++    D   L +F++ +L E   S VRW    +  ++Y +   + +  LL+ +   W    ++   + Q  DL+G+   K P  E+      Q   +I+++   +L+N   +  YN L  LV+  GYYL+S+PC VC  P                           +    +  +S  +        + R   T  V  L   ++I  +TVK    +R +    + LYY++ +  +  ++ ++   W K K V ++    E+K+D P+ + A  L+ E+ D +    ++++ ++CPRC SAS+  N  VC NC +N+ QC +CR+INY   D F+C  C  C+Y R DF ++AKPC   ++ +++EE R+  ++ I T  +  ++   +++  + +LE  L   K+ +AA    Q     +  I+S
Sbjct: 3387 QEDQLCTALVNQLNKFADKETLIQFLRCFLLESNSSSVRWQAHCLTLHIYRNSSKSQQELLLDLMWSIWPELPAYGRKAAQFVDLLGYFSLKTPQTEKKLKEYSQKAVEILRTQNHILTNHPNSNIYNTLSGLVEFDGYYLESDPCLVCNNPE--------------------------VPFCYIKLSSIKV--------DTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTINLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFYENYQASTETLQCPRC-SASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAKPCCA-VDPIENEEDRKKAVSNINTLLDKADRVYHQLMGHRPQLENLL--CKVNEAAPEKPQDDSGTAGGISS 3787          

HSP 5 Score: 126.716 bits (317), Expect = 1.623e-27
Identity = 64/142 (45.07%), Postives = 86/142 (60.56%), Query Frame = 2
Query: 4778 NDFNMNQLSID--KRAIEEILFCQVKHNPNFGENDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHASQS 5197
            N    + LS+D  +RAIE         + ++ E   +  E  + +    + L ++LCTF  TQKEF +QHWYHCHTC MV+  GVCT+CAKVCH  H+++YAK GSFFCDCGAK    C AL +RT  + +S   +  A QS
Sbjct: 1614 NGQGPSHLSVDGEERAIEV--------DSDWVEELAVEEEDSQAEDSDEDSLCNKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGMSSTMKESAFQS 1747          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Human
Match: UBR4 (ubiquitin protein ligase E3 component n-recognin 4 [Source:HGNC Symbol;Acc:HGNC:30313])

HSP 1 Score: 320.472 bits (820), Expect = 1.116e-90
Identity = 254/925 (27.46%), Postives = 454/925 (49.08%), Query Frame = 1
Query: 14071 VDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESLRKEVPLEH-----YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHKN---SRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDA-LKEGI-KLDLKRPDTIXXXXXXXXXXXXXXG-QACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVL 16788
            ++D++  +E   ++F+ + +    ++ + D ++   I E++ + I P + E   F V L+    QEDFL  RM G   SS   G  P + D+ N + ++  + +    D  ++L+ + K++  DL + ++Y+ VW C+   N+  PMR+  R+ GL+ D    ++ESL      E      Y+ +  + + GG+  ++ RLA + +   G  ++   ++L +Y +KV  N  +L++  ++T+ V+L  L + L    + K       +    +++++  IL    A  +++    +    +   + +LLD I+     S   + Q  +  IP  L+F    +M ++++   P+      +     + K  L C C + + I ++  G   +  +++KG+    +D++    P    L   I K  L RP     L       +   G Q  +G++          ++P     LHKLE V S + IG L+E+ L AL+E   D+NK I   R  T+   +  A+ +RQK L  + MT N+KGQV  + + L     +++EEPG  C IC +GY  +P + LG+YTF K+V + +     M+  P       Q  Y++VS++  VH+ CH  AV++     EW  A   N N KCN L+P+ GPH P++ F   L R+ T +   T   E  YQL +HD+K L LRFA  + F+ DTGGG R SNI L+P II   +  +++     ++E + +  +LEQ     + + ++ ++     Y  V  L     E W   RV+IL+ LL  +  R +     +++    ++   YS Y   L+ + ++   YN+  K  TS+  T   W  +++ Y R ND+ + + ++K ++ +++  +P E+ SEF DV  L   I   E +L  +L
Sbjct:    2 LEDMTTGTESETKAFMAVCIETAKRYNLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYKKVW-CT--TNEGEPMRIVYRMRGLLGDATEEFIESLDSTTDEEEDEEEVYKMAGVMAQCGGLECMLNRLAGIRDFKQGRHLLTVLLKLFSYCVKVKVNRQQLVKLEMNTLNVMLGTLNLALVAEQESK--DSGGAAVAEQVLSIMEIILDESNAEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQGLLRIIP-YLSFGEVEKMQILVERFKPYCNFDKYDEDHSGDDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQNALDYMKKHIPSAKNLDADIWKKFLSRPALPFILRLLRGLAIQHPGTQVLIGTD----------SIPN----LHKLEQVSSDEGIGTLAENLLEALRE-HPDVNKKIDAARRETRAEKKRMAMAMRQKALGTLGMTTNEKGQV-VTKTALLKQMEELIEEPGLTCCICREGYKFQPTKVLGIYTFTKRVALEE-----MENKPR-----KQQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDIKLLFLRFAMEQSFSADTGGGGRESNIHLIPYIIHTVLY-VLNTTRATSREEKNLQGFLEQPK---EKWVESAFEVDGPYYFTVLALHILPPEQWRATRVEILRRLLVTSQARAVAPGGATRLTDKAVK--DYSAYRSSLLFWALVDLIYNMFKKVPTSN--TEGGWSCSLAEYIRHNDMPIYEAADKALKTFQEEFMPVETFSEFLDVAGLLSEITDPESFLKDLL 886          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Human
Match: UBR4 (ubiquitin protein ligase E3 component n-recognin 4 [Source:HGNC Symbol;Acc:HGNC:30313])

HSP 1 Score: 251.521 bits (641), Expect = 1.548e-65
Identity = 181/671 (26.97%), Postives = 314/671 (46.80%), Query Frame = 2
Query: 5831 VRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNE---AEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKV--------QRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQEFLRSKESSKTKIQNKSSSNMEG 7807
            +R ++ +  +RR  + V+S   G    +  LAV+ +K +I + ++S LL++                   D   ++  + ++ +  +PFTVLS+  NP  + Y+AVCGLK+  VL F+S GS+S   V+ P L   N FII ++WLPGS   L ++    V+I+DL      P ++F    S+ +D TF F          + E K+   +++MS +G I+ + +++   A  G FY+  +L+ N E     +D  + V G GG S++Y H LQ+LF SY  G++F + +     E+   + + ++I++    ++    L  W  + +HPGL+  + Q T  P+ + V+P+ +  Q ++                        T P +  ++D + +        QRT  ++L  DG ++I MAN+ + +    +WLQ                       P+L+   + S      KR      I    SS    P+DFFEH +Q  +V FGG+  L++Y+ + +  R+ S    V+       ++ I+N     ++ G+RI I      + P Y EI+ R + +   L+++R  D    + E L  DK L+L IG S +   + +ID VK++ + K    W +E  E   S   S     N + SN  G
Sbjct:  595 IRQLISAHVLRRVAMCVLSSPHG---RRQHLAVSHEKGKITVLQLSALLKQ------------------ADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTFSSSGSVSDHLVLHPQLATGN-FIIKAVWLPGSQTELAIVTADFVKIYDLCVDALSPTFYFLLPSSKIRDVTFLF----------NEEGKN--IIVIMSSAGYIYTQLMEEASSAQQGPFYVTNVLEINHEDL---KDSNSQVAG-GGVSVYYSHVLQMLFFSYCQGKSFAATISRTTLEVL--QLFPINIKSSNGGSKTSPALCQWSEVMNHPGLVCCVQQTTGVPLVVMVKPDTFLIQEIK------------------------TLPAKAKIQDMVAIRHTACNEQQRTTMILLCEDGSLRIYMANVENTS----YWLQ-----------------------PSLQPSSVISIMKPVRKRKTAT--ITTRTSSQVTFPIDFFEHNQQLTDVEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEISNNNSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLN--LSRSRWFDFPFTREEALQADKKLNLFIGASVDPAGVTMIDAVKIYGKTKEQFGWPDEPPEEFPSASVSNICPSNLNQSNGTG 1170          

HSP 2 Score: 127.487 bits (319), Expect = 6.398e-28
Identity = 54/91 (59.34%), Postives = 66/91 (72.53%), Query Frame = 2
Query: 4925 LDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHASQS 5197
            L ++LCTF  TQKEF +QHWYHCHTC MV+  GVCT+CAKVCH  H+++YAK GSFFCDCGAK    C AL +RT  + +S   +  A QS
Sbjct:  367 LCNKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGMSSTMKESAFQS 457          

HSP 3 Score: 78.1814 bits (191), Expect = 6.258e-13
Identity = 127/558 (22.76%), Postives = 235/558 (42.11%), Query Frame = 2
Query: 9071 EAVPTMAEVMQEMID---NADDQRMLDYALRKSLE-DQGGSSNDANIEGGAASNISQIFLDSRSLRTDPISSIYTEEEQQSLNNTGTPTIDNWGMNKTNKKNSKQAENLSTPDREYSESNSESDIATYAMLKNASITSKLSP-------NNSQKVFLVCIQKFGIQFIKRIIVKWSSLMISLQGTRVITLYKSVLDVIRYMDMRDEEARSVVQNLVELMLDLVLGIKKDDDQLTILEYDTNEKRIHCQSICVVLRTLLNFILSGSKIQTIVPPIKEDNNSTAAEGKPTPSSCFNQVFTQDSVAFITLKLAYEKKLISFCLLNLDQLLILWRNQSPDQKNSEKELDTSNKILKQNLTSNQGFDVSVTF--DWLPMSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLNKQ--FSDHNVI---NRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETI 10687
            EA+   AE    M+D   +ADD+ M++ A+  SL+ DQ   ++D   EG  A+       D  +LRT P     +   +   +   +   ++    +++      AE    P    S S+S   I+T    +    +            + S ++ +V      +  ++R++     L  ++ G R I   + +L +   +D  DE+ +  + NL+  ++   LG+ K D          NE+    +   VV+R LL+  +S +K                  G  +     + + +  + A +    A     + +CL  L  LL  W++Q    +N E+ + TS ++LK + TS+   D+S  F   ++     D       LLTE++LRLPY + K+           T  +  I   + +       W   L E++ +  +  + +  R LL  + G+K  YR +RD+H +   +  IK LL +Q  F   +V+   +   L +D  + L+E + +C     +R  NW+ +C K   +L FL+  S  + E +
Sbjct: 1512 EALLAGAEGFPPMLDIPPDADDETMVELAIALSLQQDQQAPASDD--EGSTAAT------DGSTLRTSPADHGGSVGSESGGSAVDSVAGEHSVSGRSSAYGDATAEG--HPAGPGSVSSSTGAISTTTGHQEGDGSEGEGEGETEGDVHTSNRLHMV-----RLMLLERLLQTLPQLR-NVGGVRAIPYMQVILMLTTDLDGEDEKDKGALDNLLSQLI-AELGMDKKDVS------KKNERSALNEVHLVVMR-LLSVFMSRTK-----------------SGSKSSICESSSLISSATAAALLSSGA-----VDYCLHVLKSLLEYWKSQ----QNDEEPVATS-QLLKPHTTSSPP-DMSPFFLRQYVKGHAADVFEAYTQLLTEMVLRLPYQIKKI-----------TDTNSRIPPPVFDH-----SWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVRGIKKLLEEQGIFLRASVVTASSGSALQYDTLISLMEHLKACAEIAAQRTINWQKFCIKDDSVLYFLLQVSFLVDEGV 2001          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Human
Match: UBR4 (ubiquitin protein ligase E3 component n-recognin 4 [Source:HGNC Symbol;Acc:HGNC:30313])

HSP 1 Score: 116.701 bits (291), Expect = 5.331e-28
Identity = 60/191 (31.41%), Postives = 111/191 (58.12%), Query Frame = 2
Query: 11564 VTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEY-DCFTGSVSNSDNVKCPRCHSASIQGN--VCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQ 12127
            + LYY++ +  +  ++ ++   W K K V ++    E+K+D P+ + A  L+ E+ D +    ++++ ++CPRC SAS+  N  VC NC +N+ QC +CR+INY   D F+C  C  C+Y R DF ++AKPC   ++ +++EE R+  ++ I T  +  ++   +++  + +LE  L   K+ +AA    Q
Sbjct:    5 INLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFYENYQASTETLQCPRC-SASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAKPCC-AVDPIENEEDRKKAVSNINTLLDKADRVYHQLMGHRPQLENLL--CKVNEAAPEKPQ 191          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Human
Match: UBR4 (ubiquitin protein ligase E3 component n-recognin 4 [Source:HGNC Symbol;Acc:HGNC:30313])

HSP 1 Score: 77.0258 bits (188), Expect = 1.109e-12
Identity = 127/558 (22.76%), Postives = 235/558 (42.11%), Query Frame = 2
Query: 9071 EAVPTMAEVMQEMID---NADDQRMLDYALRKSLE-DQGGSSNDANIEGGAASNISQIFLDSRSLRTDPISSIYTEEEQQSLNNTGTPTIDNWGMNKTNKKNSKQAENLSTPDREYSESNSESDIATYAMLKNASITSKLSP-------NNSQKVFLVCIQKFGIQFIKRIIVKWSSLMISLQGTRVITLYKSVLDVIRYMDMRDEEARSVVQNLVELMLDLVLGIKKDDDQLTILEYDTNEKRIHCQSICVVLRTLLNFILSGSKIQTIVPPIKEDNNSTAAEGKPTPSSCFNQVFTQDSVAFITLKLAYEKKLISFCLLNLDQLLILWRNQSPDQKNSEKELDTSNKILKQNLTSNQGFDVSVTF--DWLPMSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLNKQ--FSDHNVI---NRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETI 10687
            EA+   AE    M+D   +ADD+ M++ A+  SL+ DQ   ++D   EG  A+       D  +LRT P     +   +   +   +   ++    +++      AE    P    S S+S   I+T    +    +            + S ++ +V      +  ++R++     L  ++ G R I   + +L +   +D  DE+ +  + NL+  ++   LG+ K D          NE+    +   VV+R LL+  +S +K                  G  +     + + +  + A +    A     + +CL  L  LL  W++Q    +N E+ + TS ++LK + TS+   D+S  F   ++     D       LLTE++LRLPY + K+           T  +  I   + +       W   L E++ +  +  + +  R LL  + G+K  YR +RD+H +   +  IK LL +Q  F   +V+   +   L +D  + L+E + +C     +R  NW+ +C K   +L FL+  S  + E +
Sbjct:  434 EALLAGAEGFPPMLDIPPDADDETMVELAIALSLQQDQQAPASDD--EGSTAAT------DGSTLRTSPADHGGSVGSESGGSAVDSVAGEHSVSGRSSAYGDATAEG--HPAGPGSVSSSTGAISTTTGHQEGDGSEGEGEGETEGDVHTSNRLHMV-----RLMLLERLLQTLPQLR-NVGGVRAIPYMQVILMLTTDLDGEDEKDKGALDNLLSQLI-AELGMDKKDVS------KKNERSALNEVHLVVMR-LLSVFMSRTK-----------------SGSKSSICESSSLISSATAAALLSSGA-----VDYCLHVLKSLLEYWKSQ----QNDEEPVATS-QLLKPHTTSSPP-DMSPFFLRQYVKGHAADVFEAYTQLLTEMVLRLPYQIKKI-----------TDTNSRIPPPVFDH-----SWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVRGIKKLLEEQGIFLRASVVTASSGSALQYDTLISLMEHLKACAEIAAQRTINWQKFCIKDDSVLYFLLQVSFLVDEGV 923          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Celegans
Match: ubr-4 (UBR E3 ubiquitin ligase homolog [Source:UniProtKB/TrEMBL;Acc:Q7KQG4])

HSP 1 Score: 113.62 bits (283), Expect = 2.036e-24
Identity = 111/444 (25.00%), Postives = 198/444 (44.59%), Query Frame = 1
Query: 15430 LGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVVN---ENEWVVAQRHNQNAKCNSLMPI-LGPHPDNNFKANLNRYQTSIWNNTNVPE--INYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFH-SRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLE--PLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDV 16734
            L  +H+LE V S  +IG L+E+ + AL E     N+ I  +R  T+K  +  A+  R+KQL +M+M V   GQ+  SS  L +  S    +   CC IC +  ++  + S GVY F       D  SGK                ++VS  V VHF+CH  A++       +EW  ++ HN  AKCN + PI +G    + +   L+R++  +   + +    +N   +  D+  L+ RF + R F+  + GG R SN++ +  I+ +    L + A+L                           + +   +R++ FL    + + W   R  +L+                + I  AQ    P  +  + P L+ +  + +++N ++K       TG+  ++    + RE+ V  ++ +   +  ++ N+LPCE ++EF DV
Sbjct:  429 LKLMHRLEQVASDNSIGTLAENVIEALNEDEEVRNQ-IKLVRDETEKKKKQMAMLNREKQLTKMRMKVGTGGQIKVSSRTLHNEPSIDDSDSLPCC-ICRESVISGDK-SAGVYAFA----AIDPDSGKT---------------STVSMMVMVHFNCHKDAIRGGGGRAADEWTRSKLHNAGAKCNVITPISMGVVIGDAWIDALHRFENDVGRVSGLAHGVVNRNFVFVDICNLIDRFIYKRSFSNQSEGGGRESNMQYLA-ILHLLGITLPADAEL---------------------------EISAPNHRLIAFLFTELTADSWNDQRNDVLR----------------AGINDAQTNGAPATWDGFKPTLMTWAFVDAYFNKVIKI------TGEDRLE----WLREHLVETINKTRGFVDDFDSNILPCEDVAEFCDV 796          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Celegans
Match: ubr-4 (UBR E3 ubiquitin ligase homolog [Source:UniProtKB/TrEMBL;Acc:Q7KQG4])

HSP 1 Score: 113.62 bits (283), Expect = 2.036e-24
Identity = 111/444 (25.00%), Postives = 198/444 (44.59%), Query Frame = 1
Query: 15430 LGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVVN---ENEWVVAQRHNQNAKCNSLMPI-LGPHPDNNFKANLNRYQTSIWNNTNVPE--INYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFH-SRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLE--PLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDV 16734
            L  +H+LE V S  +IG L+E+ + AL E     N+ I  +R  T+K  +  A+  R+KQL +M+M V   GQ+  SS  L +  S    +   CC IC +  ++  + S GVY F       D  SGK                ++VS  V VHF+CH  A++       +EW  ++ HN  AKCN + PI +G    + +   L+R++  +   + +    +N   +  D+  L+ RF + R F+  + GG R SN++ +  I+ +    L + A+L                           + +   +R++ FL    + + W   R  +L+                + I  AQ    P  +  + P L+ +  + +++N ++K       TG+  ++    + RE+ V  ++ +   +  ++ N+LPCE ++EF DV
Sbjct:  429 LKLMHRLEQVASDNSIGTLAENVIEALNEDEEVRNQ-IKLVRDETEKKKKQMAMLNREKQLTKMRMKVGTGGQIKVSSRTLHNEPSIDDSDSLPCC-ICRESVISGDK-SAGVYAFA----AIDPDSGKT---------------STVSMMVMVHFNCHKDAIRGGGGRAADEWTRSKLHNAGAKCNVITPISMGVVIGDAWIDALHRFENDVGRVSGLAHGVVNRNFVFVDICNLIDRFIYKRSFSNQSEGGGRESNMQYLA-ILHLLGITLPADAEL---------------------------EISAPNHRLIAFLFTELTADSWNDQRNDVLR----------------AGINDAQTNGAPATWDGFKPTLMTWAFVDAYFNKVIKI------TGEDRLE----WLREHLVETINKTRGFVDDFDSNILPCEDVAEFCDV 796          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Celegans
Match: ubr-4 (UBR E3 ubiquitin ligase homolog [Source:UniProtKB/TrEMBL;Acc:Q7KQG4])

HSP 1 Score: 112.079 bits (279), Expect = 1.456e-23
Identity = 110/444 (24.77%), Postives = 198/444 (44.59%), Query Frame = 1
Query: 15430 LGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVVN---ENEWVVAQRHNQNAKCNSLMPI-LGPHPDNNFKANLNRYQTSIWNNTNVPE--INYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFH-SRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLE--PLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDV 16734
            L  +H+LE V S  +IG L+E+ + AL E   ++   I  +R  T+K  +  A+  R+KQL +M+M V   GQ+  SS  L +  S    +   CC IC +  ++  + S GVY F       D  SGK                ++VS  V VHF+CH  A++       +EW  ++ HN  AKCN + PI +G    + +   L+R++  +   + +    +N   +  D+  L+ RF + R F+  + GG R SN++ +  I+ +    L + A+L                           + +   +R++ FL    + + W   R  +L+                + I  AQ    P  +  + P L+ +  + +++N ++K       TG+  ++    + RE+ V  ++ +   +  ++ N+LPCE ++EF DV
Sbjct: 3833 LKLMHRLEQVASDNSIGTLAENVIEALNE-DEEVRNQIKLVRDETEKKKKQMAMLNREKQLTKMRMKVGTGGQIKVSSRTLHNEPSIDDSDSLPCC-ICRESVISGDK-SAGVYAFA----AIDPDSGKT---------------STVSMMVMVHFNCHKDAIRGGGGRAADEWTRSKLHNAGAKCNVITPISMGVVIGDAWIDALHRFENDVGRVSGLAHGVVNRNFVFVDICNLIDRFIYKRSFSNQSEGGGRESNMQYLA-ILHLLGITLPADAEL---------------------------EISAPNHRLIAFLFTELTADSWNDQRNDVLR----------------AGINDAQTNGAPATWDGFKPTLMTWAFVDAYFNKVIK------ITGEDRLE----WLREHLVETINKTRGFVDDFDSNILPCEDVAEFCDV 4200          

HSP 2 Score: 98.9821 bits (245), Expect = 1.370e-19
Identity = 36/63 (57.14%), Postives = 50/63 (79.37%), Query Frame = 2
Query: 4925 LDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAK 5113
            +D   CT+ +T + +  QHWY+C+TC+M+E+EGVC++CA  CH GHDL Y+K+GSFFCDCG K
Sbjct: 1218 MDLNFCTYKSTGRAYVTQHWYNCYTCNMMESEGVCSVCAINCHRGHDLAYSKKGSFFCDCGEK 1280          

HSP 3 Score: 80.4925 bits (197), Expect = 5.522e-14
Identity = 48/167 (28.74%), Postives = 83/167 (49.70%), Query Frame = 2
Query: 11444 LTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEYDCFTGSVSNSDNVKCPRCH-SASIQGNVCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFA 11941
            +  ++R +    ++ L + Y +  +T+K T  ++ +    V+LYYS   +V +  +     LW+K   VTV+++   + L   V +    LI E++        S  + CPRC         VC +C +N  QC +CRAINY   + F+C +C  C+Y +I  S+F 
Sbjct: 2708 IKSDIRYSANTIIYKLISNYEVSKVTIKLTELKKSKSIKKVSLYYS-AKSVESVDLKLHPELWRKCAMVTVAENETVINLSLAVPVVTSSLIVEFEEVVDH-RGSSQLHCPRCTVPVRTHSGVCESCGENAFQCAKCRAINYVEKEPFLCQSCGFCKYAQI--SLFV 2870          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Celegans
Match: ubr-4 (UBR E3 ubiquitin ligase homolog [Source:UniProtKB/TrEMBL;Acc:Q7KQG4])

HSP 1 Score: 112.079 bits (279), Expect = 1.505e-23
Identity = 110/444 (24.77%), Postives = 198/444 (44.59%), Query Frame = 1
Query: 15430 LGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVVN---ENEWVVAQRHNQNAKCNSLMPI-LGPHPDNNFKANLNRYQTSIWNNTNVPE--INYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFH-SRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLE--PLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDV 16734
            L  +H+LE V S  +IG L+E+ + AL E   ++   I  +R  T+K  +  A+  R+KQL +M+M V   GQ+  SS  L +  S    +   CC IC +  ++  + S GVY F       D  SGK                ++VS  V VHF+CH  A++       +EW  ++ HN  AKCN + PI +G    + +   L+R++  +   + +    +N   +  D+  L+ RF + R F+  + GG R SN++ +  I+ +    L + A+L                           + +   +R++ FL    + + W   R  +L+                + I  AQ    P  +  + P L+ +  + +++N ++K       TG+  ++    + RE+ V  ++ +   +  ++ N+LPCE ++EF DV
Sbjct: 3828 LKLMHRLEQVASDNSIGTLAENVIEALNE-DEEVRNQIKLVRDETEKKKKQMAMLNREKQLTKMRMKVGTGGQIKVSSRTLHNEPSIDDSDSLPCC-ICRESVISGDK-SAGVYAFA----AIDPDSGKT---------------STVSMMVMVHFNCHKDAIRGGGGRAADEWTRSKLHNAGAKCNVITPISMGVVIGDAWIDALHRFENDVGRVSGLAHGVVNRNFVFVDICNLIDRFIYKRSFSNQSEGGGRESNMQYLA-ILHLLGITLPADAEL---------------------------EISAPNHRLIAFLFTELTADSWNDQRNDVLR----------------AGINDAQTNGAPATWDGFKPTLMTWAFVDAYFNKVIK------ITGEDRLE----WLREHLVETINKTRGFVDDFDSNILPCEDVAEFCDV 4195          

HSP 2 Score: 98.9821 bits (245), Expect = 1.369e-19
Identity = 36/63 (57.14%), Postives = 50/63 (79.37%), Query Frame = 2
Query: 4925 LDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAK 5113
            +D   CT+ +T + +  QHWY+C+TC+M+E+EGVC++CA  CH GHDL Y+K+GSFFCDCG K
Sbjct: 1211 MDLNFCTYKSTGRAYVTQHWYNCYTCNMMESEGVCSVCAINCHRGHDLAYSKKGSFFCDCGEK 1273          

HSP 3 Score: 80.4925 bits (197), Expect = 5.521e-14
Identity = 48/167 (28.74%), Postives = 83/167 (49.70%), Query Frame = 2
Query: 11444 LTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEYDCFTGSVSNSDNVKCPRCH-SASIQGNVCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFA 11941
            +  ++R +    ++ L + Y +  +T+K T  ++ +    V+LYYS   +V +  +     LW+K   VTV+++   + L   V +    LI E++        S  + CPRC         VC +C +N  QC +CRAINY   + F+C +C  C+Y +I  S+F 
Sbjct: 2701 IKSDIRYSANTIIYKLISNYEVSKVTIKLTELKKSKSIKKVSLYYS-AKSVESVDLKLHPELWRKCAMVTVAENETVINLSLAVPVVTSSLIVEFEEVVDH-RGSSQLHCPRCTVPVRTHSGVCESCGENAFQCAKCRAINYVEKEPFLCQSCGFCKYAQI--SLFV 2863          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Celegans
Match: dre-1 (F-box protein dre-1 [Source:UniProtKB/Swiss-Prot;Acc:Q94251])

HSP 1 Score: 55.8398 bits (133), Expect = 1.332e-6
Identity = 23/59 (38.98%), Postives = 32/59 (54.24%), Query Frame = 2
Query: 4937 LCTF-AATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGA 5110
            LC F  ++   F   ++Y C TC+  E   +CT C + CH GH +   +   FFCDCGA
Sbjct:  930 LCLFKVSSNNSFPMHNFYRCTTCNTTERNAICTNCIRTCHRGHSVELVRFDRFFCDCGA 988          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Fly
Match: poe (gene:FBgn0011230 transcript:FBtr0079545)

HSP 1 Score: 311.612 bits (797), Expect = 3.938e-90
Identity = 264/987 (26.75%), Postives = 490/987 (49.65%), Query Frame = 1
Query: 13936 EIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESL----RKEVPLEH-YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAG---SITQQNHMINQVENMHAIPILLDY--IHKNSRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQ-----ILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDALKEGIKLDLKRPDTIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMS--------KWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQ--IQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVLTEL 16797
            E P I   Y+T ++  +L S L +R L+V R+++  D + +  + ++D++  +EE  R+F++I +  + +  + D+++   + E++ + I P +++   F + L+    QEDFL  RM+G    S   G  P + DV N +  +  + +    D  ++L+ + K++  DL ++D+Y+ VWL    +  +  MR+  R+ GL+ D    +VE+L    +++V  E  Y+ +N L +  G+  ++ER+ ++  ++    +I   ++L    +KV      L +P +  +  LL+ L +CL+   D  +    E+     L+ ++  IL+   +    S  Q +      E + A+    D   +  N  V    +H+ ++ A L +    +M L+ +    HF+  + N +  DN++       L   C L + I  +  G   + +++  G++   + ++   AP       +K  L R D+    E  +   L  + +   G +   EA Q+ ++   ++  +H+LE V S + +G L+E+ L AL   SA   +V   +R  T+   +  A+  R+KQL+ + M  N+KGQV    S+L+ +     +E G  C IC +GY  +P + LG+YTF K+  V +      + +           YT+V+++  VH  CH  A+++    +EW  A   N N +CN L+P+ GP   +  F A + R+ + +  +T   +I+Y   VHDLK LL+RFA  R F++D GGG   SN+  VP ++  ++  L+S           ++        KWLE    G +V +  L+ AT +       L  HSRELW +H++  LK ++  A  RH++ A + +  + PA  +   Y++Y PFL+++ ++   Y+ L K V S+P   + W  ++  Y R+ND ALL  ++ +++   +  LPC S  EF DV  L + I   ++++  +L  L
Sbjct: 4376 ECPNIRRTYKTRMLGPVLESYLALRSLVVQRTRLIDDAQEKLLEMLEDMTSGTEEETRAFMEILIDTVEKTRMNDIKTPVFVFERLYSIIHPEEHDESEFYMTLEKDPQQEDFLQGRMLGNPYPSSEMGLGPLMRDVKNKICTDCELIALLEDDNGMELLVNNKIISLDLPVKDVYKKVWLAEGGDRDA--MRIVYRMRGLLGDATEEFVETLNNKSQEQVDTEQLYRMANVLADCNGLRVMLERIGSLQRISRNRELIQVLLKLFLICVKVRRCQEVLCQPEIGAINTLLKVLQMCLQSENDSIQSAVTEQ-----LLEIMETILSKAASDTLDSFLQFSLTFGGPEYVSALISCTDCPNVRNNPSV---LRHLIRVLAALVYGNEVKMALLCE----HFKDTL-NFNRFDNERTPEEEFKLELFCVLTNQIEHNCIGGTLKDYIVSLGIVERSLAYITEHAP------CVKPTLLRTDSDELKEFISRPSLKYILRFLTGLSNHHEATQVAIS-KDIIPIIHRLEQVSSDEHVGSLAENLLEALSTDSATAARV-QQVRDFTRAEKKRLAMATREKQLDALGMRTNEKGQVTAKGSILQKIEKLR-DETGLTCFICREGYACQPDKVLGIYTFTKRCNVEEFELKSRKTIG----------YTTVTHFNVVHVDCHTSAIRLTRGRDEWERASLQNANTRCNGLLPLWGPAVGEAAFSACMTRHSSYMQESTQRCDISYTSSVHDLKLLLVRFAWERSFHDDAGGGGPQSNMHFVPYLLFYSVYLLLSSRSAARDSKTLLTYLQAPPSEKWLE---CGYEV-DGPLFMATIS-------LSLHSRELWNKHKLAHLKRMIAVAQGRHVSPAVLCKALLAPADRQVKDYTVYKPFLMMWALVDLIYDNLFKTV-STPKE-EDWPISLFDYLRKNDEALLKSTDSILQTLTEEFLPCTSFVEFCDVAGLLHLIEHPDNFIEEILAAL 5315          

HSP 2 Score: 44.2838 bits (103), Expect = 3.938e-90
Identity = 100/508 (19.69%), Postives = 198/508 (38.98%), Query Frame = 2
Query: 12371 VKEEKKDSHS-KHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYDTRLARAKNNLVNVNESLFESNKIRQNCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLI-KKPNLVSENEPAIEHKSSLIFPSMPVLCINQWLQDDSSQLFETWLQCTREENQI----PRDITLNSDQGN------------VGLIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDS 13840
            V++     HS   ++  +  L  KY  +++    E+  + +++ A +  +  YD +  +     VN   +    N     CY C L+  +Q + L++ +++  D R  + +   + ++        L   +  +++E+  L+V +T+D  E  + L QL+T+ +  AL         E+ +   ++LL+  +   D  WE +L+    + +          NC ++   P  A++  C+R ++  L  PVL   KPN     + A     S+       +    WL  D +  +  W +     NQ      +D  + +  G+              L +K+  RW  +V  K+           ++ +  +  W+ Q LL ++N    +     +     ++ ER +  L++L   L                             K      E S +Y+ L K +  E+ W  YLV+K  L +I  L    + K + ++EE  L S
Sbjct: 3910 VEDNMASVHSTSQVNKIIQLLAQKYCVESRTSFEELSKIVQKVKACRSELVAYDRQ--QQDQPPVNPGSTTGAENPTTNRCYGCALASTEQCLTLLRAMAYNYDCRVCLYSQGLVSELAE----HNLRRGTPLIQEEVRNLLVVLTKDNAEACMHLLQLVTTRVKNALMGSIPLISLEAAVHQEMTLLEVLLGQDDICWEYKLKVIFELFI---------SNC-RLPRGPVTAVLHPCLR-IMQNLICPVLPGSKPN----QKVATTDLCSMKMFEGNTVDYRAWLNSDRNHEYAAWSKRMPSNNQAKLKNAKDQNVAASGGSDAPPKSRREVRVAFLSEKYGKRWRERVLDKQRV---------IKPLVFNAKWI-QPLLFNANSRFGRQLACSLLSSLSRTNERRQQALNMLTSFL-----------------------------KHVGEAGEASAEYLMLYKNMATEQPWLQYLVLKGVLSQISQLLAIEISK-VHRMEEYSLSS 4356          

HSP 3 Score: 255.758 bits (652), Expect = 8.306e-67
Identity = 178/642 (27.73%), Postives = 310/642 (48.29%), Query Frame = 2
Query: 5831 VRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVL---DSGQDEIY-VDKNYYVDIRNEAEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQE 7741
            ++ +L SG VRR     +S   G    +  LAV+ +K ++ I ++S LL++                   D   ++  + Q+ +  +  TV+S+ ANP N+  +AVCGLKE  +L F+S GS +   VV P LE+ N +I  ++WLPGS   L ++ +  V+I+DL+  T  P Y++     + +D TF +                +  +L  + SG I+ ++LD+  +A  G FY+   L    EL + +     G +G GG SI+Y H LQLLF+SY+ GR+F S L     G   IY +D N      ++      LV W  +  HPGL+ A  Q +N+P+ + + PE+   Q + K++++++ I D+       +  A+    +TTL           ++L  DG ++I  A     +    FWL  +    F N+    T  +      +      ++     + R  ++ +           P+DFFEHC    +V FGG+  L++Y+++ L  R+ S    V+    N  +L + N  P+ +IVG+R+ I   D  + P+   I  R IP P  + + R  DI L + E+L +DK L ++   + +   + ++D ++V+ + K  + W +E ++
Sbjct: 2014 IKHLLSSGVVRRVAFCCLSSPHG---RRQQLAVSHEKGKVTILQLSALLKQ------------------ADASKRKLTLTQLSSAPIACTVISLAANPCNEDCLAVCGLKECHILTFSSSGSTNEHIVVNPQLENGN-YIKKAVWLPGSQTLLAVVTSDYVKIYDLAVDTYSPKYYYLVAVGKIRDCTFVY-------------QDGNYNMLTFASSGYIYTQQLDQQSLAVHGDFYVTNTL----ELSHQHIKDIAGHIGGGGVSIYYSHTLQLLFYSYSCGRSFFSPLTNVSEGVKGIYHLDTNSASKSASKGPLQ-PLVQWTEVTGHPGLVYASMQTSNNPIILMITPERIYLQEI-KAQSAKSRIMDVV-----GIRHAVAGVEKTTL-----------LLLCEDGSLRIFSAQPEYTS----FWLSPQ-VQPFGNQLYSSTLMAKGGGSGSTSKSKSNTASGKMTSRKASQQQKQPTAGGQPVFPIDFFEHCNMLADVEFGGNDLLQIYNKQKLKTRLFSTGMFVASTRSNGFTLEVINNDPNVVIVGIRVLIGTQDVQRAPQSVTILGRTIPTP--VRRARWFDIPLTREEMLQSDKLLKVVFAKAPDPEHVTLLDCIEVYGKSKELVGWPDESED 2591          

HSP 4 Score: 218.009 bits (554), Expect = 1.827e-55
Identity = 255/1093 (23.33%), Postives = 465/1093 (42.54%), Query Frame = 2
Query: 9113 DNADDQRMLDYALRKSLEDQGGSSND--------ANIEG-------------------GAASN--ISQIFLDSRSLRTDPISSIYTEEEQQSLNNTGTPTIDNWGMNKTNKKNSKQAENLSTP-------DREYSESNSESDIATYAMLKNASITSKLSPNNSQKVFLVCIQKFGIQFIKRIIVKWSSLMISLQGTRVITLYKSVLDVIRYMDMRDEEARSVVQNLVELMLDLVLGIKKDDDQLTILEYDTNEKRIHCQSICVVLRTLLNFILSGSKIQ---TIVPPIKEDNNSTAAEGKPTPSSCFNQVFTQDSVAFITLKLAYEKKLISFCLLNLDQLLILWRNQSPDQKNSEKELDTSNKILKQNLTSNQGF------------DVSVTF--DWLP-MSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLN----KQFSDHNVINRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLM-VNSVSLHETIGXXXXXXXXXXXXXXXXXXXXXXTASSNPPXXXXXXXXXXXXXXXXXDKNTQR-KSAGSAPEVNKQEAKLCRALTSKMD----NTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHL-LTKYPNWERIESFSHQLTNDIVQSSQELLSNSCTPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEYDCFTGSVSNS-DNVKCPRCHSA-SIQGNVCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKV-NNSAFITSGTNI 12172
            ++ADD+ ++D A+  SL+  GG +N         AN++G                   G + +   S +  D  +LRT P      E      + +G   +++ G       N     N S P       D+E    +  +     A+L   S +     N   K  L  +    I  ++ II    +  +   G + I L + +L +   ++  +E  + V+ +L+  ++D V   K+        +   NE R+        L +L   ++  +K +   T  PP +  +NS+                    VA  T  +  +     + L  L+ LL+ W+N   D   +   L  S         S  G             D+S+    ++L    DI  ++D   LLTE+I+RLPY +L+L            + D      +  +          LCE++ +N++  + +  R LL  + G+K  +R  RD H +      +K + N    K  + +N  N   L +D  ++L E + +C    + R  NW+ +C    + L  LM +    L + +   ++ LLQ A              +  PP G+  A     TSS +    T R KS  +    +K +   C     ++     + ++  FV+++L E+  + +RW   + ++ L+ H     R  LLN   + W    ++   + Q  DL+G+L L+     ER+  F  +  + + Q ++ L  +   P Y  L+ ++++ GYYL+SEPC VC  P              P  N +                 +  S++ Y T       T  ++ L   ++I  + V+    +R +    + +YY++ S  +  ++ ++  LW K ++V++     E+K+DFP+ +TA  L+ E+  F  +VS S +N++CPRC +A      VC NC +N+ QC +CRAINY   D F+C +C  C+Y + DFSM+A+ C   ++ ++S E R   ++ I +  E  ++N ++++  KQ LE+ + ++    A   SS + V +N A + S + +
Sbjct: 2936 EDADDEAIMDIAIALSLQQHGGDANALQSLQQGLANLQGIRQATAMAAAVNAAANVSLGGSDDDEGSNVATDGSTLRTSP-----AEPAGSGGSESGGSGVESIGGTSARSSNFGDHANASPPRQGSTKDDQEQPGPSGVAGSGGVAVLSAMSSSEDNEANEDDK--LSKLHDLRIAVLESIIQHLGTFDLC-NGLQAIPLIQVILMLTTDLNGNNERDQQVLHDLLTALVDYVEIGKRGAAARMETKCPGNEVRL-------ALLSLFGVLMGKTKSKQTGTTSPPHQFKDNSSF-------------------VASTTANVLSKSGAFVYALEALNTLLVHWKNVLGDPYAAGGGL-ASQSAQASGGASGPGVQLLKPIKHGPKPDISILIPHNYLKNYPDIFESYDG--LLTEIIVRLPYQILRLS------SAHPDNYDSGFCEAMTFT----------LCEYMMLNLNTLLRRQVRKLLMYICGSKEKFRMYRDGHSLDAHFRVVKRVCNIVSSKTGAPYNA-NPPMLSYDALVELTEHLRTCQEISQMRTGNWQKFCVVHEDALAMLMEIACYQLDDGVSPIIIQLLQAA------------VCNLPPPSGSKQAQPQPSTSSASGKLRTDREKSEDTDAYYSKFDPAQCGTFVHQIFRYACDALIIRFVRIFLLENNITQLRWQAHSFMTGLFEHANERQREKLLNIFWNLWPLVPTYGRRTAQFVDLLGYLTLSTRSITERLPEFVSRAVDVLRQQNELLCKHPNAPIYTTLESILQVNGYYLESEPCLVCNNPEV------------PMANIK---------------LPSVKSDSKYTT-------TTMIYKLVQCHTISKLIVRIADLKRTKMVRTINVYYNNRSVQAVVELKNRPALWHKARSVSLQSAQTELKIDFPLPITACNLMIEFADFFETVSGSSENLQCPRCSAAVPAYPGVCGNCGENVFQCHKCRAINYDEKDPFLCHSCGFCKYAKFDFSMYARVCCA-VDPIESAEDRVKTVSLIHSSLERADRNYRQLLTNKQMLELLIQKV----AEHRSSDRMVEDNMASVHSTSQV 3923          

HSP 5 Score: 128.257 bits (321), Expect = 2.858e-28
Identity = 48/74 (64.86%), Postives = 63/74 (85.14%), Query Frame = 2
Query: 4925 LDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRR 5146
            L+++LCTF+ TQKEF +QHWYHCHTC+M+   GVC++CA+VCH GHD++YAK G+FFCDCGAK    C+AL+RR
Sbjct: 1791 LNNKLCTFSQTQKEFMNQHWYHCHTCNMINTVGVCSVCARVCHKGHDVSYAKYGNFFCDCGAKEDGSCQALSRR 1864          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Fly
Match: poe (gene:FBgn0011230 transcript:FBtr0333088)

HSP 1 Score: 311.612 bits (797), Expect = 3.938e-90
Identity = 264/987 (26.75%), Postives = 490/987 (49.65%), Query Frame = 1
Query: 13936 EIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESL----RKEVPLEH-YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAG---SITQQNHMINQVENMHAIPILLDY--IHKNSRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQ-----ILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDALKEGIKLDLKRPDTIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMS--------KWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQ--IQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVLTEL 16797
            E P I   Y+T ++  +L S L +R L+V R+++  D + +  + ++D++  +EE  R+F++I +  + +  + D+++   + E++ + I P +++   F + L+    QEDFL  RM+G    S   G  P + DV N +  +  + +    D  ++L+ + K++  DL ++D+Y+ VWL    +  +  MR+  R+ GL+ D    +VE+L    +++V  E  Y+ +N L +  G+  ++ER+ ++  ++    +I   ++L    +KV      L +P +  +  LL+ L +CL+   D  +    E+     L+ ++  IL+   +    S  Q +      E + A+    D   +  N  V    +H+ ++ A L +    +M L+ +    HF+  + N +  DN++       L   C L + I  +  G   + +++  G++   + ++   AP       +K  L R D+    E  +   L  + +   G +   EA Q+ ++   ++  +H+LE V S + +G L+E+ L AL   SA   +V   +R  T+   +  A+  R+KQL+ + M  N+KGQV    S+L+ +     +E G  C IC +GY  +P + LG+YTF K+  V +      + +           YT+V+++  VH  CH  A+++    +EW  A   N N +CN L+P+ GP   +  F A + R+ + +  +T   +I+Y   VHDLK LL+RFA  R F++D GGG   SN+  VP ++  ++  L+S           ++        KWLE    G +V +  L+ AT +       L  HSRELW +H++  LK ++  A  RH++ A + +  + PA  +   Y++Y PFL+++ ++   Y+ L K V S+P   + W  ++  Y R+ND ALL  ++ +++   +  LPC S  EF DV  L + I   ++++  +L  L
Sbjct: 4376 ECPNIRRTYKTRMLGPVLESYLALRSLVVQRTRLIDDAQEKLLEMLEDMTSGTEEETRAFMEILIDTVEKTRMNDIKTPVFVFERLYSIIHPEEHDESEFYMTLEKDPQQEDFLQGRMLGNPYPSSEMGLGPLMRDVKNKICTDCELIALLEDDNGMELLVNNKIISLDLPVKDVYKKVWLAEGGDRDA--MRIVYRMRGLLGDATEEFVETLNNKSQEQVDTEQLYRMANVLADCNGLRVMLERIGSLQRISRNRELIQVLLKLFLICVKVRRCQEVLCQPEIGAINTLLKVLQMCLQSENDSIQSAVTEQ-----LLEIMETILSKAASDTLDSFLQFSLTFGGPEYVSALISCTDCPNVRNNPSV---LRHLIRVLAALVYGNEVKMALLCE----HFKDTL-NFNRFDNERTPEEEFKLELFCVLTNQIEHNCIGGTLKDYIVSLGIVERSLAYITEHAP------CVKPTLLRTDSDELKEFISRPSLKYILRFLTGLSNHHEATQVAIS-KDIIPIIHRLEQVSSDEHVGSLAENLLEALSTDSATAARV-QQVRDFTRAEKKRLAMATREKQLDALGMRTNEKGQVTAKGSILQKIEKLR-DETGLTCFICREGYACQPDKVLGIYTFTKRCNVEEFELKSRKTIG----------YTTVTHFNVVHVDCHTSAIRLTRGRDEWERASLQNANTRCNGLLPLWGPAVGEAAFSACMTRHSSYMQESTQRCDISYTSSVHDLKLLLVRFAWERSFHDDAGGGGPQSNMHFVPYLLFYSVYLLLSSRSAARDSKTLLTYLQAPPSEKWLE---CGYEV-DGPLFMATIS-------LSLHSRELWNKHKLAHLKRMIAVAQGRHVSPAVLCKALLAPADRQVKDYTVYKPFLMMWALVDLIYDNLFKTV-STPKE-EDWPISLFDYLRKNDEALLKSTDSILQTLTEEFLPCTSFVEFCDVAGLLHLIEHPDNFIEEILAAL 5315          

HSP 2 Score: 44.2838 bits (103), Expect = 3.938e-90
Identity = 100/508 (19.69%), Postives = 198/508 (38.98%), Query Frame = 2
Query: 12371 VKEEKKDSHS-KHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYDTRLARAKNNLVNVNESLFESNKIRQNCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLI-KKPNLVSENEPAIEHKSSLIFPSMPVLCINQWLQDDSSQLFETWLQCTREENQI----PRDITLNSDQGN------------VGLIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDS 13840
            V++     HS   ++  +  L  KY  +++    E+  + +++ A +  +  YD +  +     VN   +    N     CY C L+  +Q + L++ +++  D R  + +   + ++        L   +  +++E+  L+V +T+D  E  + L QL+T+ +  AL         E+ +   ++LL+  +   D  WE +L+    + +          NC ++   P  A++  C+R ++  L  PVL   KPN     + A     S+       +    WL  D +  +  W +     NQ      +D  + +  G+              L +K+  RW  +V  K+           ++ +  +  W+ Q LL ++N    +     +     ++ ER +  L++L   L                             K      E S +Y+ L K +  E+ W  YLV+K  L +I  L    + K + ++EE  L S
Sbjct: 3910 VEDNMASVHSTSQVNKIIQLLAQKYCVESRTSFEELSKIVQKVKACRSELVAYDRQ--QQDQPPVNPGSTTGAENPTTNRCYGCALASTEQCLTLLRAMAYNYDCRVCLYSQGLVSELAE----HNLRRGTPLIQEEVRNLLVVLTKDNAEACMHLLQLVTTRVKNALMGSIPLISLEAAVHQEMTLLEVLLGQDDICWEYKLKVIFELFI---------SNC-RLPRGPVTAVLHPCLR-IMQNLICPVLPGSKPN----QKVATTDLCSMKMFEGNTVDYRAWLNSDRNHEYAAWSKRMPSNNQAKLKNAKDQNVAASGGSDAPPKSRREVRVAFLSEKYGKRWRERVLDKQRV---------IKPLVFNAKWI-QPLLFNANSRFGRQLACSLLSSLSRTNERRQQALNMLTSFL-----------------------------KHVGEAGEASAEYLMLYKNMATEQPWLQYLVLKGVLSQISQLLAIEISK-VHRMEEYSLSS 4356          

HSP 3 Score: 255.758 bits (652), Expect = 8.306e-67
Identity = 178/642 (27.73%), Postives = 310/642 (48.29%), Query Frame = 2
Query: 5831 VRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVL---DSGQDEIY-VDKNYYVDIRNEAEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQE 7741
            ++ +L SG VRR     +S   G    +  LAV+ +K ++ I ++S LL++                   D   ++  + Q+ +  +  TV+S+ ANP N+  +AVCGLKE  +L F+S GS +   VV P LE+ N +I  ++WLPGS   L ++ +  V+I+DL+  T  P Y++     + +D TF +                +  +L  + SG I+ ++LD+  +A  G FY+   L    EL + +     G +G GG SI+Y H LQLLF+SY+ GR+F S L     G   IY +D N      ++      LV W  +  HPGL+ A  Q +N+P+ + + PE+   Q + K++++++ I D+       +  A+    +TTL           ++L  DG ++I  A     +    FWL  +    F N+    T  +      +      ++     + R  ++ +           P+DFFEHC    +V FGG+  L++Y+++ L  R+ S    V+    N  +L + N  P+ +IVG+R+ I   D  + P+   I  R IP P  + + R  DI L + E+L +DK L ++   + +   + ++D ++V+ + K  + W +E ++
Sbjct: 2014 IKHLLSSGVVRRVAFCCLSSPHG---RRQQLAVSHEKGKVTILQLSALLKQ------------------ADASKRKLTLTQLSSAPIACTVISLAANPCNEDCLAVCGLKECHILTFSSSGSTNEHIVVNPQLENGN-YIKKAVWLPGSQTLLAVVTSDYVKIYDLAVDTYSPKYYYLVAVGKIRDCTFVY-------------QDGNYNMLTFASSGYIYTQQLDQQSLAVHGDFYVTNTL----ELSHQHIKDIAGHIGGGGVSIYYSHTLQLLFYSYSCGRSFFSPLTNVSEGVKGIYHLDTNSASKSASKGPLQ-PLVQWTEVTGHPGLVYASMQTSNNPIILMITPERIYLQEI-KAQSAKSRIMDVV-----GIRHAVAGVEKTTL-----------LLLCEDGSLRIFSAQPEYTS----FWLSPQ-VQPFGNQLYSSTLMAKGGGSGSTSKSKSNTASGKMTSRKASQQQKQPTAGGQPVFPIDFFEHCNMLADVEFGGNDLLQIYNKQKLKTRLFSTGMFVASTRSNGFTLEVINNDPNVVIVGIRVLIGTQDVQRAPQSVTILGRTIPTP--VRRARWFDIPLTREEMLQSDKLLKVVFAKAPDPEHVTLLDCIEVYGKSKELVGWPDESED 2591          

HSP 4 Score: 218.009 bits (554), Expect = 1.827e-55
Identity = 255/1093 (23.33%), Postives = 465/1093 (42.54%), Query Frame = 2
Query: 9113 DNADDQRMLDYALRKSLEDQGGSSND--------ANIEG-------------------GAASN--ISQIFLDSRSLRTDPISSIYTEEEQQSLNNTGTPTIDNWGMNKTNKKNSKQAENLSTP-------DREYSESNSESDIATYAMLKNASITSKLSPNNSQKVFLVCIQKFGIQFIKRIIVKWSSLMISLQGTRVITLYKSVLDVIRYMDMRDEEARSVVQNLVELMLDLVLGIKKDDDQLTILEYDTNEKRIHCQSICVVLRTLLNFILSGSKIQ---TIVPPIKEDNNSTAAEGKPTPSSCFNQVFTQDSVAFITLKLAYEKKLISFCLLNLDQLLILWRNQSPDQKNSEKELDTSNKILKQNLTSNQGF------------DVSVTF--DWLP-MSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLN----KQFSDHNVINRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLM-VNSVSLHETIGXXXXXXXXXXXXXXXXXXXXXXTASSNPPXXXXXXXXXXXXXXXXXDKNTQR-KSAGSAPEVNKQEAKLCRALTSKMD----NTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHL-LTKYPNWERIESFSHQLTNDIVQSSQELLSNSCTPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEYDCFTGSVSNS-DNVKCPRCHSA-SIQGNVCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKV-NNSAFITSGTNI 12172
            ++ADD+ ++D A+  SL+  GG +N         AN++G                   G + +   S +  D  +LRT P      E      + +G   +++ G       N     N S P       D+E    +  +     A+L   S +     N   K  L  +    I  ++ II    +  +   G + I L + +L +   ++  +E  + V+ +L+  ++D V   K+        +   NE R+        L +L   ++  +K +   T  PP +  +NS+                    VA  T  +  +     + L  L+ LL+ W+N   D   +   L  S         S  G             D+S+    ++L    DI  ++D   LLTE+I+RLPY +L+L            + D      +  +          LCE++ +N++  + +  R LL  + G+K  +R  RD H +      +K + N    K  + +N  N   L +D  ++L E + +C    + R  NW+ +C    + L  LM +    L + +   ++ LLQ A              +  PP G+  A     TSS +    T R KS  +    +K +   C     ++     + ++  FV+++L E+  + +RW   + ++ L+ H     R  LLN   + W    ++   + Q  DL+G+L L+     ER+  F  +  + + Q ++ L  +   P Y  L+ ++++ GYYL+SEPC VC  P              P  N +                 +  S++ Y T       T  ++ L   ++I  + V+    +R +    + +YY++ S  +  ++ ++  LW K ++V++     E+K+DFP+ +TA  L+ E+  F  +VS S +N++CPRC +A      VC NC +N+ QC +CRAINY   D F+C +C  C+Y + DFSM+A+ C   ++ ++S E R   ++ I +  E  ++N ++++  KQ LE+ + ++    A   SS + V +N A + S + +
Sbjct: 2936 EDADDEAIMDIAIALSLQQHGGDANALQSLQQGLANLQGIRQATAMAAAVNAAANVSLGGSDDDEGSNVATDGSTLRTSP-----AEPAGSGGSESGGSGVESIGGTSARSSNFGDHANASPPRQGSTKDDQEQPGPSGVAGSGGVAVLSAMSSSEDNEANEDDK--LSKLHDLRIAVLESIIQHLGTFDLC-NGLQAIPLIQVILMLTTDLNGNNERDQQVLHDLLTALVDYVEIGKRGAAARMETKCPGNEVRL-------ALLSLFGVLMGKTKSKQTGTTSPPHQFKDNSSF-------------------VASTTANVLSKSGAFVYALEALNTLLVHWKNVLGDPYAAGGGL-ASQSAQASGGASGPGVQLLKPIKHGPKPDISILIPHNYLKNYPDIFESYDG--LLTEIIVRLPYQILRLS------SAHPDNYDSGFCEAMTFT----------LCEYMMLNLNTLLRRQVRKLLMYICGSKEKFRMYRDGHSLDAHFRVVKRVCNIVSSKTGAPYNA-NPPMLSYDALVELTEHLRTCQEISQMRTGNWQKFCVVHEDALAMLMEIACYQLDDGVSPIIIQLLQAA------------VCNLPPPSGSKQAQPQPSTSSASGKLRTDREKSEDTDAYYSKFDPAQCGTFVHQIFRYACDALIIRFVRIFLLENNITQLRWQAHSFMTGLFEHANERQREKLLNIFWNLWPLVPTYGRRTAQFVDLLGYLTLSTRSITERLPEFVSRAVDVLRQQNELLCKHPNAPIYTTLESILQVNGYYLESEPCLVCNNPEV------------PMANIK---------------LPSVKSDSKYTT-------TTMIYKLVQCHTISKLIVRIADLKRTKMVRTINVYYNNRSVQAVVELKNRPALWHKARSVSLQSAQTELKIDFPLPITACNLMIEFADFFETVSGSSENLQCPRCSAAVPAYPGVCGNCGENVFQCHKCRAINYDEKDPFLCHSCGFCKYAKFDFSMYARVCCA-VDPIESAEDRVKTVSLIHSSLERADRNYRQLLTNKQMLELLIQKV----AEHRSSDRMVEDNMASVHSTSQV 3923          

HSP 5 Score: 128.257 bits (321), Expect = 2.858e-28
Identity = 48/74 (64.86%), Postives = 63/74 (85.14%), Query Frame = 2
Query: 4925 LDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRR 5146
            L+++LCTF+ TQKEF +QHWYHCHTC+M+   GVC++CA+VCH GHD++YAK G+FFCDCGAK    C+AL+RR
Sbjct: 1791 LNNKLCTFSQTQKEFMNQHWYHCHTCNMINTVGVCSVCARVCHKGHDVSYAKYGNFFCDCGAKEDGSCQALSRR 1864          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Fly
Match: FBXO11 (gene:FBgn0037760 transcript:FBtr0334684)

HSP 1 Score: 60.077 bits (144), Expect = 7.857e-8
Identity = 34/125 (27.20%), Postives = 52/125 (41.60%), Query Frame = 2
Query: 4871 NDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHASQSTSIDAIKKDKPSMKSQ 5245
            N++ N+E E EK +       Q     ++   F    +Y C TC+  +   +C  C K CH GHD+ + +   FFCDCGA                T+S + QL    +   D +      M+S 
Sbjct: 1072 NNIFNNEDEVEKAVS----SGQCLYKISSYTSFPMHDFYRCQTCNTTDRNAICVNCIKNCHAGHDVEFIRHDRFFCDCGAG---------------TLSNQCQLQGEPTQDTDTLYDSAAPMESH 1177          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Fly
Match: FBXO11 (gene:FBgn0037760 transcript:FBtr0082155)

HSP 1 Score: 60.077 bits (144), Expect = 7.857e-8
Identity = 34/125 (27.20%), Postives = 52/125 (41.60%), Query Frame = 2
Query: 4871 NDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHASQSTSIDAIKKDKPSMKSQ 5245
            N++ N+E E EK +       Q     ++   F    +Y C TC+  +   +C  C K CH GHD+ + +   FFCDCGA                T+S + QL    +   D +      M+S 
Sbjct: 1072 NNIFNNEDEVEKAVS----SGQCLYKISSYTSFPMHDFYRCQTCNTTDRNAICVNCIKNCHAGHDVEFIRHDRFFCDCGAG---------------TLSNQCQLQGEPTQDTDTLYDSAAPMESH 1177          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Zebrafish
Match: ubr4 (ubiquitin protein ligase E3 component n-recognin 4 [Source:ZFIN;Acc:ZDB-GENE-090313-341])

HSP 1 Score: 351.673 bits (901), Expect = 1.115e-111
Identity = 267/970 (27.53%), Postives = 483/970 (49.79%), Query Frame = 1
Query: 13936 EIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESLRKEVPLEH-----YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHK---NSRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAP--EDALKEGIKLDLKRPD-TIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVL 16788
            E+ +I   +++ +V  +L   L +R+L+V R+K+  + +    + ++D++  +E   ++F+ + +    ++ + D ++   I E++ + I P + E   F V L+    QEDFL  RM G   SS   G  P + D+ N + ++  + +    D  ++L+ + K++  DL + ++Y+ VW      N+  PMR+  R+ GL+ D    ++ESL      E      Y+ +  + + GG+  ++ RL+ + +   G  ++   ++L +Y +KV  N  +L++P ++T+ V+L  L + L    + K       S    +++++  IL    A ++++    +    +   + +LLD I+     S   + Q  +  IP  L+F    +M ++++   P       +     + K  L C C + + I ++  G   +  +++KG+    +D++    P  ++   +  K  L RP         + L       Q  +G++                  LHKLE V S + IG L+E+ L AL+E  AD+N  I   R  T+   +  A+ +RQK L  + MT N+KGQV+T +SLLK +   + EEPG  C IC +GY  +P + LG+YTF K+V + +  +   +          Q  Y++VS++  VH+ CH  AV++     EW  A   N N KCN L+P+ GPH P++ F   L R+ T +   T   E  YQL +HD K L LRFA  + F+ DTGGG R SNI L+P II   +  +++     ++E + +  +LEQ    C+ + +  ++     Y  +  +     E W   RV IL+ LL  AH R ++    +++    ++   Y++Y   L+ +G++   Y++  K  TS+  T   W  +++ Y R ND+ + + S +V+R ++D L+P ES SEF DV+ L  +IP  + +L  +L
Sbjct: 4239 EVESIKRHFKSRLVGTVLNGYLCLRKLVVQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYNLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLSVAEVYKKVWC---PTNEGEPMRIIYRMRGLLGDATEEFIESLDSTTDEEEDDEEVYKMAGVMAQCGGLECMLNRLSGIKDFKQGRHLLTVLLKLFSYCVKVKINRQQLVKPEMNTLNVMLGTLNLALVAEQESK--DSGGASIAEQVLSIMEIILDEANAETVSEDKGNLLLTGDKDQLVMLLDQINTLFVRSNPSVLQGLLRIIP-YLSFGELEKMHILVERFKPCCNFDKYDEEHSADDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQSALDYMKKQIPCAKNLDADVWKKFLARPALPFILRLLRGLATQHPPTQMLIGTDSITN--------------LHKLEQVSSDEGIGTLAENLLEALRE-HADVNLKIDAARRETRAEKKRMAMAMRQKALGTLGMTTNEKGQVVTKTSLLKQMEELI-EEPGLTCCICREGYKFQPTKVLGIYTFTKRVSLEEFENKPRK----------QQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDTKLLFLRFAMEQSFSVDTGGGGRESNIHLIPYIIHTVLY-VLNTTRATSREEKNLQSFLEQP---CEKWMETSYEVDGPHYFTILAMHILPPERWRTTRVDILRRLLVTAHARKVSPGGANKLTDKAVK--EYAVYRSPLLFWGLVDLIYDMFRKVPTSN--TEGGWSFSLAEYIRHNDMPIYEASERVLRAFQDELMPAESFSEFLDVVGLLSDIPDPDAFLQDLL 5168          

HSP 2 Score: 76.6406 bits (187), Expect = 1.115e-111
Identity = 114/504 (22.62%), Postives = 210/504 (41.67%), Query Frame = 2
Query: 12419 LNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYD--TRLARAKNNLVNVNESLFESNKIRQ------------NCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNLVSENEPAIEHKSSLIFPSMPVLCINQ-WLQDDSSQLFETWLQCTREENQIPRDITLNSDQGNVG---LIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDSWRNGQARPGLSN 13876
            + QL  +YS D K    E+  + +++ A++K +  YD   R A  K++  +  ++ F +++ R              CY C  +     I L++ L+  P IR  +     ++++        L   + +MR+E+  LV  +TRD  E   ++N LI +++  AL+  + +    S ++  + LL  SIA     WELRLR A+++ L        + N    VV   I L+  C+R L   +K P    K N     + A+E  +++   +  +    Q WL+ +    +E W +C     Q    ++  S++  +    L++K+  +W   ++ +       +  +   +      WL Q L + +  + RQA   +VE L      R + VL +L   L           D+L                      E + +Y+AL ++L +  HW+ YL  +  L  I +L    +   LA  E +     + G A   L+ 
Sbjct: 3785 IQQLAQEYSGDCKTSFDELSKIIQKVLASRKELLEYDLHQREAATKSSRTSAQQT-FTASQYRALSVLGCGHTSSTKCYGCASAVTGHCITLLRALATNPAIRQILVLQGLIREL----FEYNLRRGTGAMREEVRQLVCLLTRDHPEATQQMNDLIIAKVSAALKGHWANPDLVSSLQYEMLLLTDSIAKEGGCWELRLRCALSLFL-------MAVNIKTPVVVENITLM--CLRILQKLIKPPAPTSKKN----KDAAVESLTTVKPYNNEIHAQAQLWLKKEPKASYEAWKKCLPARCQ--ETVSKPSNKAEIRRQYLMEKYVWKWKQFMRSRSEGLFPRLLKLGHNN------WLRQVLFTPATQAARQAACTIVEALTTIP-SRKQQVLDLLTSYL-----------DEL------------------SIAGECAAEYLALYQKLIKPAHWKVYLAARGVLPYIGNLITKEIAHLLALEEATLSTDLQQGYALKSLTG 4232          

HSP 3 Score: 346.28 bits (887), Expect = 4.230e-94
Identity = 279/1022 (27.30%), Postives = 464/1022 (45.40%), Query Frame = 2
Query: 4724 SNLNDILYNMKPSS----ELYLNDFNMNQLSIDKRAIEEILFCQVKHNPNFGENDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHASQSTSIDAIKKDKPS--MKSQFFEKSKYNFQTRFSKFSSNEKLLRKSYKADTKSRLTAHKMTAAADSGS---CPEVTNDDESTSTNMISNAISTVFSVNQSKQVAYRNWITAVLRERIXXXXXXXXXXXXXXXXXDDCFTALQIIHESFKVQYSDWTVGKNKQMKEAFKSVRTSEKISERVTTIMGSSIQLRNAEAPSDMSGIPPTSVLASEIAGANSHVRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLK--TGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNE---AEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDM-PTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQE 7741
            S L D++  ++ SS       L D     + +D   +EE+            E D   +E  +E     + L ++LCTF  TQKEF +QHWYHCHTC MV+  GVCT+CAKVCH  H+++YAK GSFFCDCGAK    C+    R N       S  H  ++T+  A+ K  PS  M S   E S +  + R       E  +R             H+ ++ AD G    C    +DD+    + +   I      +   QVA  +    VL   I                       +  I  +F+ Q S   VG + + + A   + T +K  E    +M  +  L + E   +       +V  +        +R ++ +  +RR  + V+S   G    +  LAV+ +K +I + ++S LL++                   D   ++  + ++ +  +PFTVLS+  NP N+ Y+AVCGLK+  VL F+S GS+S   V+ P L   N FII ++WLPGS   L +I    V+I+DLS     P+Y+F    S+ +DATF F          + E K+   +++MS +G ++ + +D++  A  G FY+  +L+ N E      DLK   G +  GG S++Y H LQ+LF SY+ G++F + +     E    + + ++++     ++    L  W  + +HPGL+  + Q T  P+ I ++P+ +  Q ++            ++ + +K+ D +      + E     QRT  ++L  DG ++I MAN+ + +    +WLQ               PSS    M P  +     +   +SS+                  PVDFFEH +Q  EV FGG+  L++Y+ + +  R+ S    V+       ++ + N     ++ G+R+ +      + P Y EI+ R + +   L ++R  D    + E L  DK L + IG S +   + ++D +K++ + K    W +E  E
Sbjct: 1580 SYLADVMNALRQSSGQGSSQLLMDGEEKAIEVDSDWVEELAV----------EEDDSQAEDSDE-----DSLCNKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCQV---RPN------TSGHHGKRATA--ALVKRSPSSGMSSTMKESSAFQSELRMP-----ESAIR-------------HQSSSPADKGKVTICDGKNSDDDKPKKSSVCKNIEGCRE-DLLIQVASSSTAALVLELLIFL---------------------MDAIQTNFQ-QAS--AVGSSSRAQHALNELHTQDKTVEMTDQLMVPT--LGSQEGAFE-------NVRMNYSGDQGQTIRQLISAHVLRRVAMCVLSSPHG---RRQHLAVSHEKGKITVLQLSALLKQ------------------ADSSKRKLTLTRLASAPVPFTVLSLTGNPCNEDYLAVCGLKDCHVLTFSSTGSVSDHLVLHPQLATGN-FIIKAIWLPGSQTELAIITADFVKIYDLSVDALSPMYYFLLPSSKIRDATFLF----------NEEGKN--IIVIMSSAGYMYTQVMDESSSAQHGPFYVTNVLEINHE------DLKDSNGQVAGGGVSVYYSHVLQMLFFSYSQGKSFAATVSRSNME--TQRLFTINVKGSNGGSKTSPALCQWSEVMNHPGLVCCVQQTTGIPLVIMLKPDTFLIQEIK------------TLPAKAKIQDMVAIRHTASNEQ----QRTTMILLCEDGSLRIYMANVENTS----YWLQPSL-----------QPSSVISIMKPVRKRKTATATTRTSSQV---------------TFPVDFFEHNQQLTEVEFGGNDLLQVYNGQQIKHRLNSTGMYVANTKPGGFTVEVVNNNNSMVMTGMRVQVGTQAIERAPSYIEIFGRTMQLN--LTRSRWFDFPFTREEALQADKKLSIFIGASVDPAGVTMLDSIKIYGKTKEQFGWPDEPPE 2433          

HSP 4 Score: 227.639 bits (579), Expect = 2.902e-58
Identity = 199/760 (26.18%), Postives = 345/760 (45.39%), Query Frame = 2
Query: 9983 ISFCLLNLDQLLILWRNQSPDQKNSEKELDTSNKILKQNLTSNQGFDVSVTF--DWLPMSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLNKQ--FSDHNVINRIK---LPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETIGXXXXXXXXXXXXXXXXXXXXXXTASSNPPXXXXXXXXXXXXXXXXXDKNTQRKSAGSAPEVNKQEAKLCRALTSKM----DNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHLLTKYPNWERIESFSHQLTNDIVQSSQELLSNSC-TPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEY-DCFTGSVSNSDNVKCPRCHSASIQGN--VCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITSGTNISGLGTTKLPV 12202
            I +CL  L  LL  W+ Q       E+E   ++++LK + TS+   D+S  F   ++     D       LLTE++LRLPY + K+     ++          I          +  W   L E++ +  +  + +  R LL  + G+K  YR +RD+H +   +  IK LL +Q  F    ++       L +D  + L+E + +C     +R  NW+ +C K   +L FL+  S  + E +   LL LL  AL  S+       ++         +   S    SK  DK   ++  G+      QE +LC AL S++    D   L +F++ +L E   S VRW    +  ++Y +   + +  LL+ +   W    ++   + Q  DL+G+   K P  E+      Q   +I+++   +L+N   +  YN L RLV+  G+YL+S+PC VC  P              P  N              +  +S  +        + R   T  V  L   ++I  +TVK    +R +    + LYY++ +  +  ++ ++   W K K V ++    E+K+D P+ + A  L+ E+ D +    ++++ ++CPRC SAS+  N  VC NC +N+ QC +CR+INY   D F+C  C  C+Y R DF ++AKPC   ++ +++EE R+  +  I T  +  ++   +++  + +LE  L ++   +AA    Q      A         GLGT+   V
Sbjct: 3095 IDYCLHVLKSLLEFWKTQ-----QGEEEPTATSQLLKPH-TSSSPPDMSPFFLRQYVKGHAADVFEAYSQLLTEMVLRLPYQIKKIADANPRI-------PPPIF---------DHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVRGIKKLLEEQGIFLRGGIVTATSGSALQYDTLISLMEHLKACAEIATQRTINWQKFCMKDDSVLYFLLQVSFLVDEGVSPVLLQLLSCALCGSKVMAASSGSSGGGSGTSQPSQSKSSSKKSKKEDKEKDKEGDGAG----SQEDQLCTALVSQLNKFADKETLIQFLRCFLLESNSSSVRWQAHCLTLHIYRNSNKSQQELLLDLMWAIWPELPAYGRKAAQFVDLLGYFSLKTPQTEKKLKEYSQKAVEILRAQNHILTNHPNSNIYNTLSRLVEFDGFYLESDPCLVCNNPEV------------PFSN--------------IKLSSIKV--------DTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTINLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFSDFYENYQASTETLQCPRC-SASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAKPCCA-VDPIENEEDRKKAVTNINTLLDKADRVYHQLMGHRPQLESLLSKVN--EAAPEKPQDDTGAGA---------GLGTSTASV 3781          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Zebrafish
Match: ubr4 (ubiquitin protein ligase E3 component n-recognin 4 [Source:ZFIN;Acc:ZDB-GENE-090313-341])

HSP 1 Score: 351.288 bits (900), Expect = 1.542e-111
Identity = 267/970 (27.53%), Postives = 483/970 (49.79%), Query Frame = 1
Query: 13936 EIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESLRKEVPLEH-----YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHK---NSRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAP--EDALKEGIKLDLKRPD-TIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVL 16788
            E+ +I   +++ +V  +L   L +R+L+V R+K+  + +    + ++D++  +E   ++F+ + +    ++ + D ++   I E++ + I P + E   F V L+    QEDFL  RM G   SS   G  P + D+ N + ++  + +    D  ++L+ + K++  DL + ++Y+ VW      N+  PMR+  R+ GL+ D    ++ESL      E      Y+ +  + + GG+  ++ RL+ + +   G  ++   ++L +Y +KV  N  +L++P ++T+ V+L  L + L    + K       S    +++++  IL    A ++++    +    +   + +LLD I+     S   + Q  +  IP  L+F    +M ++++   P       +     + K  L C C + + I ++  G   +  +++KG+    +D++    P  ++   +  K  L RP         + L       Q  +G++                  LHKLE V S + IG L+E+ L AL+E  AD+N  I   R  T+   +  A+ +RQK L  + MT N+KGQV+T +SLLK +   + EEPG  C IC +GY  +P + LG+YTF K+V + +  +   +          Q  Y++VS++  VH+ CH  AV++     EW  A   N N KCN L+P+ GPH P++ F   L R+ T +   T   E  YQL +HD K L LRFA  + F+ DTGGG R SNI L+P II   +  +++     ++E + +  +LEQ    C+ + +  ++     Y  +  +     E W   RV IL+ LL  AH R ++    +++    ++   Y++Y   L+ +G++   Y++  K  TS+  T   W  +++ Y R ND+ + + S +V+R ++D L+P ES SEF DV+ L  +IP  + +L  +L
Sbjct: 4196 EVESIKRHFKSRLVGTVLNGYLCLRKLVVQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYNLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLSVAEVYKKVWC---PTNEGEPMRIIYRMRGLLGDATEEFIESLDSTTDEEEDDEEVYKMAGVMAQCGGLECMLNRLSGIKDFKQGRHLLTVLLKLFSYCVKVKINRQQLVKPEMNTLNVMLGTLNLALVAEQESK--DSGGASIAEQVLSIMEIILDEANAETVSEDKGNLLLTGDKDQLVMLLDQINTLFVRSNPSVLQGLLRIIP-YLSFGELEKMHILVERFKPCCNFDKYDEEHSADDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQSALDYMKKQIPCAKNLDADVWKKFLARPALPFILRLLRGLATQHPPTQMLIGTDSITN--------------LHKLEQVSSDEGIGTLAENLLEALRE-HADVNLKIDAARRETRAEKKRMAMAMRQKALGTLGMTTNEKGQVVTKTSLLKQMEELI-EEPGLTCCICREGYKFQPTKVLGIYTFTKRVSLEEFENKPRK----------QQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDTKLLFLRFAMEQSFSVDTGGGGRESNIHLIPYIIHTVLY-VLNTTRATSREEKNLQSFLEQP---CEKWMETSYEVDGPHYFTILAMHILPPERWRTTRVDILRRLLVTAHARKVSPGGANKLTDKAVK--EYAVYRSPLLFWGLVDLIYDMFRKVPTSN--TEGGWSFSLAEYIRHNDMPIYEASERVLRAFQDELMPAESFSEFLDVVGLLSDIPDPDAFLQDLL 5125          

HSP 2 Score: 76.2554 bits (186), Expect = 1.542e-111
Identity = 114/504 (22.62%), Postives = 210/504 (41.67%), Query Frame = 2
Query: 12419 LNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYD--TRLARAKNNLVNVNESLFESNKIRQ------------NCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNLVSENEPAIEHKSSLIFPSMPVLCINQ-WLQDDSSQLFETWLQCTREENQIPRDITLNSDQGNVG---LIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDSWRNGQARPGLSN 13876
            + QL  +YS D K    E+  + +++ A++K +  YD   R A  K++  +  ++ F +++ R              CY C  +     I L++ L+  P IR  +     ++++        L   + +MR+E+  LV  +TRD  E   ++N LI +++  AL+  + +    S ++  + LL  SIA     WELRLR A+++ L        + N    VV   I L+  C+R L   +K P    K N     + A+E  +++   +  +    Q WL+ +    +E W +C     Q    ++  S++  +    L++K+  +W   ++ +       +  +   +      WL Q L + +  + RQA   +VE L      R + VL +L   L           D+L                      E + +Y+AL ++L +  HW+ YL  +  L  I +L    +   LA  E +     + G A   L+ 
Sbjct: 3742 IQQLAQEYSGDCKTSFDELSKIIQKVLASRKELLEYDLHQREAATKSSRTSAQQT-FTASQYRALSVLGCGHTSSTKCYGCASAVTGHCITLLRALATNPAIRQILVLQGLIREL----FEYNLRRGTGAMREEVRQLVCLLTRDHPEATQQMNDLIIAKVSAALKGHWANPDLVSSLQYEMLLLTDSIAKEGGCWELRLRCALSLFL-------MAVNIKTPVVVENITLM--CLRILQKLIKPPAPTSKKN----KDAAVESLTTVKPYNNEIHAQAQLWLKKEPKASYEAWKKCLPARCQ--ETVSKPSNKAEIRRQYLMEKYVWKWKQFMRSRSEGLFPRLLKLGHNN------WLRQVLFTPATQAARQAACTIVEALTTIP-SRKQQVLDLLTSYL-----------DEL------------------SIAGECAAEYLALYQKLIKPAHWKVYLAARGVLPYIGNLITKEIAHLLALEEATLSTDLQQGYALKSLTG 4189          

HSP 3 Score: 316.62 bits (810), Expect = 4.376e-85
Identity = 265/1022 (25.93%), Postives = 452/1022 (44.23%), Query Frame = 2
Query: 4724 SNLNDILYNMKPSS----ELYLNDFNMNQLSIDKRAIEEILFCQVKHNPNFGENDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHASQSTSIDAIKKDKPS--MKSQFFEKSKYNFQTRFSKFSSNEKLLRKSYKADTKSRLTAHKMTAAADSGS---CPEVTNDDESTSTNMISNAISTVFSVNQSKQVAYRNWITAVLRERIXXXXXXXXXXXXXXXXXDDCFTALQIIHESFKVQYSDWTVGKNKQMKEAFKSVRTSEKISERVTTIMGSSIQLRNAEAPSDMSGIPPTSVLASEIAGANSHVRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLK--TGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNE---AEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDM-PTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQE 7741
            S L D++  ++ SS       L D     + +D   +EE+            E D   +E  +E     + L ++LCTF  TQKEF +QHWYHCHTC MV+  GVCT+CAKVCH  H+++YAK G          S FC+                  A +  S  A+ K  PS  M S   E S +  + R       E  +R             H+ ++ AD G    C    +DD+    + +   I       +   +   +   A++ E +                       +  I  +F+ Q S   VG + + + A   + T +K  E    +M  +  L + E   +       +V  +        +R ++ +  +RR  + V+S   G    +  LAV+ +K +I + ++S LL++                   D   ++  + ++ +  +PFTVLS+  NP N+ Y+AVCGLK+  VL F+S GS+S   V+ P L   N FII ++WLPGS   L +I    V+I+DLS     P+Y+F    S+ +DATF F          + E K+   +++MS +G ++ + +D++  A  G FY+  +L+ N E      DLK   G +  GG S++Y H LQ+LF SY+ G++F + +     E    + + ++++     ++    L  W  + +HPGL+  + Q T  P+ I ++P+ +  Q ++            ++ + +K+ D +      + E     QRT  ++L  DG ++I MAN+ + +    +WLQ               PSS    M P  +     +   +SS+                  PVDFFEH +Q  EV FGG+  L++Y+ + +  R+ S    V+       ++ + N     ++ G+R+ +      + P Y EI+ R + +   L ++R  D    + E L  DK L + IG S +   + ++D +K++ + K    W +E  E
Sbjct: 1564 SYLADVMNALRQSSGQGSSQLLMDGEEKAIEVDSDWVEELAV----------EEDDSQAEDSDE-----DSLCNKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVCHKDHEISYAKYG----------SFFCDC----------------GAKEDGSCQALVKRSPSSGMSSTMKESSAFQSELRMP-----ESAIR-------------HQSSSPADKGKVTICDGKNSDDDKPKKSSVCKNIE---GCREDLLIQASSSTAALVLELL--------------------IFLMDAIQTNFQ-QAS--AVGSSSRAQHALNELHTQDKTVEMTDQLMVPT--LGSQEGAFE-------NVRMNYSGDQGQTIRQLISAHVLRRVAMCVLSSPHG---RRQHLAVSHEKGKITVLQLSALLKQ------------------ADSSKRKLTLTRLASAPVPFTVLSLTGNPCNEDYLAVCGLKDCHVLTFSSTGSVSDHLVLHPQLATGN-FIIKAIWLPGSQTELAIITADFVKIYDLSVDALSPMYYFLLPSSKIRDATFLF----------NEEGKN--IIVIMSSAGYMYTQVMDESSSAQHGPFYVTNVLEINHE------DLKDSNGQVAGGGVSVYYSHVLQMLFFSYSQGKSFAATVSRSNME--TQRLFTINVKGSNGGSKTSPALCQWSEVMNHPGLVCCVQQTTGIPLVIMLKPDTFLIQEIK------------TLPAKAKIQDMVAIRHTASNEQ----QRTTMILLCEDGSLRIYMANVENTS----YWLQPSL-----------QPSSVISIMKPVRKRKTATATTRTSSQV---------------TFPVDFFEHNQQLTEVEFGGNDLLQVYNGQQIKHRLNSTGMYVANTKPGGFTVEVVNNNNSMVMTGMRVQVGTQAIERAPSYIEIFGRTMQLN--LTRSRWFDFPFTREEALQADKKLSIFIGASVDPAGVTMLDSIKIYGKTKEQFGWPDEPPE 2401          

HSP 4 Score: 227.639 bits (579), Expect = 3.339e-58
Identity = 199/760 (26.18%), Postives = 345/760 (45.39%), Query Frame = 2
Query: 9983 ISFCLLNLDQLLILWRNQSPDQKNSEKELDTSNKILKQNLTSNQGFDVSVTF--DWLPMSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLNKQ--FSDHNVINRIK---LPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETIGXXXXXXXXXXXXXXXXXXXXXXTASSNPPXXXXXXXXXXXXXXXXXDKNTQRKSAGSAPEVNKQEAKLCRALTSKM----DNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHLLTKYPNWERIESFSHQLTNDIVQSSQELLSNSC-TPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEY-DCFTGSVSNSDNVKCPRCHSASIQGN--VCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITSGTNISGLGTTKLPV 12202
            I +CL  L  LL  W+ Q       E+E   ++++LK + TS+   D+S  F   ++     D       LLTE++LRLPY + K+     ++          I          +  W   L E++ +  +  + +  R LL  + G+K  YR +RD+H +   +  IK LL +Q  F    ++       L +D  + L+E + +C     +R  NW+ +C K   +L FL+  S  + E +   LL LL  AL  S+       ++         +   S    SK  DK   ++  G+      QE +LC AL S++    D   L +F++ +L E   S VRW    +  ++Y +   + +  LL+ +   W    ++   + Q  DL+G+   K P  E+      Q   +I+++   +L+N   +  YN L RLV+  G+YL+S+PC VC  P              P  N              +  +S  +        + R   T  V  L   ++I  +TVK    +R +    + LYY++ +  +  ++ ++   W K K V ++    E+K+D P+ + A  L+ E+ D +    ++++ ++CPRC SAS+  N  VC NC +N+ QC +CR+INY   D F+C  C  C+Y R DF ++AKPC   ++ +++EE R+  +  I T  +  ++   +++  + +LE  L ++   +AA    Q      A         GLGT+   V
Sbjct: 3052 IDYCLHVLKSLLEFWKTQ-----QGEEEPTATSQLLKPH-TSSSPPDMSPFFLRQYVKGHAADVFEAYSQLLTEMVLRLPYQIKKIADANPRI-------PPPIF---------DHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVRGIKKLLEEQGIFLRGGIVTATSGSALQYDTLISLMEHLKACAEIATQRTINWQKFCMKDDSVLYFLLQVSFLVDEGVSPVLLQLLSCALCGSKVMAASSGSSGGGSGTSQPSQSKSSSKKSKKEDKEKDKEGDGAG----SQEDQLCTALVSQLNKFADKETLIQFLRCFLLESNSSSVRWQAHCLTLHIYRNSNKSQQELLLDLMWAIWPELPAYGRKAAQFVDLLGYFSLKTPQTEKKLKEYSQKAVEILRAQNHILTNHPNSNIYNTLSRLVEFDGFYLESDPCLVCNNPEV------------PFSN--------------IKLSSIKV--------DTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTINLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFSDFYENYQASTETLQCPRC-SASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAKPCCA-VDPIENEEDRKKAVTNINTLLDKADRVYHQLMGHRPQLESLLSKVN--EAAPEKPQDDTGAGA---------GLGTSTASV 3738          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Zebrafish
Match: CT027552.1 (ubiquitin protein ligase E3 component n-recognin 4 [Source:NCBI gene;Acc:407625])

HSP 1 Score: 351.673 bits (901), Expect = 2.714e-110
Identity = 267/970 (27.53%), Postives = 483/970 (49.79%), Query Frame = 1
Query: 13936 EIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESLRKEVPLEH-----YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHK---NSRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAP--EDALKEGIKLDLKRPD-TIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVL 16788
            E+ +I   +++ +V  +L   L +R+L+V R+K+  + +    + ++D++  +E   ++F+ + +    ++ + D ++   I E++ + I P + E   F V L+    QEDFL  RM G   SS   G  P + D+ N + ++  + +    D  ++L+ + K++  DL + ++Y+ VW      N+  PMR+  R+ GL+ D    ++ESL      E      Y+ +  + + GG+  ++ RL+ + +   G  ++   ++L +Y +KV  N  +L++P ++T+ V+L  L + L    + K       S    +++++  IL    A ++++    +    +   + +LLD I+     S   + Q  +  IP  L+F    +M ++++   P       +     + K  L C C + + I ++  G   +  +++KG+    +D++    P  ++   +  K  L RP         + L       Q  +G++                  LHKLE V S + IG L+E+ L AL+E  AD+N  I   R  T+   +  A+ +RQK L  + MT N+KGQV+T +SLLK +   + EEPG  C IC +GY  +P + LG+YTF K+V + +  +   +          Q  Y++VS++  VH+ CH  AV++     EW  A   N N KCN L+P+ GPH P++ F   L R+ T +   T   E  YQL +HD K L LRFA  + F+ DTGGG R SNI L+P II   +  +++     ++E + +  +LEQ    C+ + +  ++     Y  +  +     E W   RV IL+ LL  AH R ++    +++    ++   Y++Y   L+ +G++   Y++  K  TS+  T   W  +++ Y R ND+ + + S +V+R ++D L+P ES SEF DV+ L  +IP  + +L  +L
Sbjct: 4240 EVESIKRHFKSRLVGTVLNGYLCLRKLVVQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYNLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLSVAEVYKKVWC---PTNEGEPMRIIYRMRGLLGDATEEFIESLDSTTDEEEDDEEVYKMAGVMAQCGGLECMLNRLSGIKDFKQGRHLLTVLLKLFSYCVKVKINRQQLVKPEMNTLNVMLGTLNLALVAEQESK--DSGGASIAEQVLSIMEIILDEANAETVSEDKGNLLLTGDKDQLVMLLDQINTLFVRSNPSVLQGLLRIIP-YLSFGELEKMHILVERFKPCCNFDKYDEEHSADDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQSALDYMKKQIPCAKNLDADVWKKFLARPALPFILRLLRGLATQHPPTQMLIGTDSITN--------------LHKLEQVSSDEGIGTLAENLLEALRE-HADVNLKIDAARRETRAEKKRMAMAMRQKALGTLGMTTNEKGQVVTKTSLLKQMEELI-EEPGLTCCICREGYKFQPTKVLGIYTFTKRVSLEEFENKPRK----------QQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDTKLLFLRFAMEQSFSVDTGGGGRESNIHLIPYIIHTVLY-VLNTTRATSREEKNLQSFLEQP---CEKWMETSYEVDGPHYFTILAMHILPPERWRTTRVDILRRLLVTAHARKVSPGGANKLTDKAVK--EYAVYRSPLLFWGLVDLIYDMFRKVPTSN--TEGGWSFSLAEYIRHNDMPIYEASERVLRAFQDELMPAESFSEFLDVVGLLSDIPDPDAFLQDLL 5169          

HSP 2 Score: 72.0182 bits (175), Expect = 2.714e-110
Identity = 114/505 (22.57%), Postives = 210/505 (41.58%), Query Frame = 2
Query: 12419 LNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYD--TRLARAKNNLVNVNESLFESNKIRQ------------NCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITR-DKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNLVSENEPAIEHKSSLIFPSMPVLCINQ-WLQDDSSQLFETWLQCTREENQIPRDITLNSDQGNVG---LIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDSWRNGQARPGLSN 13876
            + QL  +YS D K    E+  + +++ A++K +  YD   R A  K++  +  ++ F +++ R              CY C  +     I L++ L+  P IR  +     ++++        L   + +MR+E+  LV  +TR D  E   ++N LI +++  AL+  + +    S ++  + LL  SIA     WELRLR A+++ L        + N    VV   I L+  C+R L   +K P    K N     + A+E  +++   +  +    Q WL+ +    +E W +C     Q    ++  S++  +    L++K+  +W   ++ +       +  +   +      WL Q L + +  + RQA   +VE L      R + VL +L   L           D+L                      E + +Y+AL ++L +  HW+ YL  +  L  I +L    +   LA  E +     + G A   L+ 
Sbjct: 3785 IQQLAQEYSGDCKTSFDELSKIIQKVLASRKELLEYDLHQREAATKSSRTSAQQT-FTASQYRALSVLGCGHTSSTKCYGCASAVTGHCITLLRALATNPAIRQILVLQGLIREL----FEYNLRRGTGAMREEVRQLVCLLTRYDHPEATQQMNDLIIAKVSAALKGHWANPDLVSSLQYEMLLLTDSIAKEGGCWELRLRCALSLFL-------MAVNIKTPVVVENITLM--CLRILQKLIKPPAPTSKKN----KDAAVESLTTVKPYNNEIHAQAQLWLKKEPKASYEAWKKCLPARCQ--ETVSKPSNKAEIRRQYLMEKYVWKWKQFMRSRSEGLFPRLLKLGHNN------WLRQVLFTPATQAARQAACTIVEALTTIP-SRKQQVLDLLTSYL-----------DEL------------------SIAGECAAEYLALYQKLIKPAHWKVYLAARGVLPYIGNLITKEIAHLLALEEATLSTDLQQGYALKSLTG 4233          

HSP 3 Score: 346.28 bits (887), Expect = 4.266e-94
Identity = 279/1022 (27.30%), Postives = 464/1022 (45.40%), Query Frame = 2
Query: 4724 SNLNDILYNMKPSS----ELYLNDFNMNQLSIDKRAIEEILFCQVKHNPNFGENDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHASQSTSIDAIKKDKPS--MKSQFFEKSKYNFQTRFSKFSSNEKLLRKSYKADTKSRLTAHKMTAAADSGS---CPEVTNDDESTSTNMISNAISTVFSVNQSKQVAYRNWITAVLRERIXXXXXXXXXXXXXXXXXDDCFTALQIIHESFKVQYSDWTVGKNKQMKEAFKSVRTSEKISERVTTIMGSSIQLRNAEAPSDMSGIPPTSVLASEIAGANSHVRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLK--TGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNE---AEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDM-PTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQE 7741
            S L D++  ++ SS       L D     + +D   +EE+            E D   +E  +E     + L ++LCTF  TQKEF +QHWYHCHTC MV+  GVCT+CAKVCH  H+++YAK GSFFCDCGAK    C+    R N       S  H  ++T+  A+ K  PS  M S   E S +  + R       E  +R             H+ ++ AD G    C    +DD+    + +   I      +   QVA  +    VL   I                       +  I  +F+ Q S   VG + + + A   + T +K  E    +M  +  L + E   +       +V  +        +R ++ +  +RR  + V+S   G    +  LAV+ +K +I + ++S LL++                   D   ++  + ++ +  +PFTVLS+  NP N+ Y+AVCGLK+  VL F+S GS+S   V+ P L   N FII ++WLPGS   L +I    V+I+DLS     P+Y+F    S+ +DATF F          + E K+   +++MS +G ++ + +D++  A  G FY+  +L+ N E      DLK   G +  GG S++Y H LQ+LF SY+ G++F + +     E    + + ++++     ++    L  W  + +HPGL+  + Q T  P+ I ++P+ +  Q ++            ++ + +K+ D +      + E     QRT  ++L  DG ++I MAN+ + +    +WLQ               PSS    M P  +     +   +SS+                  PVDFFEH +Q  EV FGG+  L++Y+ + +  R+ S    V+       ++ + N     ++ G+R+ +      + P Y EI+ R + +   L ++R  D    + E L  DK L + IG S +   + ++D +K++ + K    W +E  E
Sbjct: 1580 SYLADVMNALRQSSGQGSSQLLMDGEEKAIEVDSDWVEELAV----------EEDDSQAEDSDE-----DSLCNKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCQV---RPN------TSGHHGKRATA--ALVKRSPSSGMSSTMKESSAFQSELRMP-----ESAIR-------------HQSSSPADKGKVTICDGKNSDDDKPKKSSVCKNIEGCRE-DLLIQVASSSTAALVLELLIFL---------------------MDAIQTNFQ-QAS--AVGSSSRAQHALNELHTQDKTVEMTDQLMVPT--LGSQEGAFE-------NVRMNYSGDQGQTIRQLISAHVLRRVAMCVLSSPHG---RRQHLAVSHEKGKITVLQLSALLKQ------------------ADSSKRKLTLTRLASAPVPFTVLSLTGNPCNEDYLAVCGLKDCHVLTFSSTGSVSDHLVLHPQLATGN-FIIKAIWLPGSQTELAIITADFVKIYDLSVDALSPMYYFLLPSSKIRDATFLF----------NEEGKN--IIVIMSSAGYMYTQVMDESSSAQHGPFYVTNVLEINHE------DLKDSNGQVAGGGVSVYYSHVLQMLFFSYSQGKSFAATVSRSNME--TQRLFTINVKGSNGGSKTSPALCQWSEVMNHPGLVCCVQQTTGIPLVIMLKPDTFLIQEIK------------TLPAKAKIQDMVAIRHTASNEQ----QRTTMILLCEDGSLRIYMANVENTS----YWLQPSL-----------QPSSVISIMKPVRKRKTATATTRTSSQV---------------TFPVDFFEHNQQLTEVEFGGNDLLQVYNGQQIKHRLNSTGMYVANTKPGGFTVEVVNNNNSMVMTGMRVQVGTQAIERAPSYIEIFGRTMQLN--LTRSRWFDFPFTREEALQADKKLSIFIGASVDPAGVTMLDSIKIYGKTKEQFGWPDEPPE 2433          

HSP 4 Score: 227.639 bits (579), Expect = 2.903e-58
Identity = 199/760 (26.18%), Postives = 345/760 (45.39%), Query Frame = 2
Query: 9983 ISFCLLNLDQLLILWRNQSPDQKNSEKELDTSNKILKQNLTSNQGFDVSVTF--DWLPMSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLNKQ--FSDHNVINRIK---LPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETIGXXXXXXXXXXXXXXXXXXXXXXTASSNPPXXXXXXXXXXXXXXXXXDKNTQRKSAGSAPEVNKQEAKLCRALTSKM----DNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHLLTKYPNWERIESFSHQLTNDIVQSSQELLSNSC-TPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEY-DCFTGSVSNSDNVKCPRCHSASIQGN--VCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITSGTNISGLGTTKLPV 12202
            I +CL  L  LL  W+ Q       E+E   ++++LK + TS+   D+S  F   ++     D       LLTE++LRLPY + K+     ++          I          +  W   L E++ +  +  + +  R LL  + G+K  YR +RD+H +   +  IK LL +Q  F    ++       L +D  + L+E + +C     +R  NW+ +C K   +L FL+  S  + E +   LL LL  AL  S+       ++         +   S    SK  DK   ++  G+      QE +LC AL S++    D   L +F++ +L E   S VRW    +  ++Y +   + +  LL+ +   W    ++   + Q  DL+G+   K P  E+      Q   +I+++   +L+N   +  YN L RLV+  G+YL+S+PC VC  P              P  N              +  +S  +        + R   T  V  L   ++I  +TVK    +R +    + LYY++ +  +  ++ ++   W K K V ++    E+K+D P+ + A  L+ E+ D +    ++++ ++CPRC SAS+  N  VC NC +N+ QC +CR+INY   D F+C  C  C+Y R DF ++AKPC   ++ +++EE R+  +  I T  +  ++   +++  + +LE  L ++   +AA    Q      A         GLGT+   V
Sbjct: 3095 IDYCLHVLKSLLEFWKTQ-----QGEEEPTATSQLLKPH-TSSSPPDMSPFFLRQYVKGHAADVFEAYSQLLTEMVLRLPYQIKKIADANPRI-------PPPIF---------DHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVRGIKKLLEEQGIFLRGGIVTATSGSALQYDTLISLMEHLKACAEIATQRTINWQKFCMKDDSVLYFLLQVSFLVDEGVSPVLLQLLSCALCGSKVMAASSGSSGGGSGTSQPSQSKSSSKKSKKEDKEKDKEGDGAG----SQEDQLCTALVSQLNKFADKETLIQFLRCFLLESNSSSVRWQAHCLTLHIYRNSNKSQQELLLDLMWAIWPELPAYGRKAAQFVDLLGYFSLKTPQTEKKLKEYSQKAVEILRAQNHILTNHPNSNIYNTLSRLVEFDGFYLESDPCLVCNNPEV------------PFSN--------------IKLSSIKV--------DTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTINLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFSDFYENYQASTETLQCPRC-SASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAKPCCA-VDPIENEEDRKKAVTNINTLLDKADRVYHQLMGHRPQLESLLSKVN--EAAPEKPQDDTGAGA---------GLGTSTASV 3781          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Zebrafish
Match: fbxo11a (F-box protein 11a [Source:ZFIN;Acc:ZDB-GENE-061103-70])

HSP 1 Score: 56.9954 bits (136), Expect = 1.327e-7
Identity = 26/87 (29.89%), Postives = 38/87 (43.68%), Query Frame = 2
Query: 4982 WYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHASQSTSIDAIKKDKPSMKS 5242
            +Y CHTC+  +   +C  C K CH GHD+ + +   FFCDCGA                T+S    L    +   D +    P ++S
Sbjct:  156 FYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAG---------------TLSNPCTLAGEPTHDTDTLYDSAPPIES 227          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Zebrafish
Match: fbxo11a (F-box protein 11a [Source:ZFIN;Acc:ZDB-GENE-061103-70])

HSP 1 Score: 56.9954 bits (136), Expect = 8.247e-7
Identity = 25/60 (41.67%), Postives = 33/60 (55.00%), Query Frame = 2
Query: 4982 WYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKG-SNFCEALTRRTNRT 5158
            +Y CHTC+  +   +C  C K CH GHD+ + +   FFCDCGA   SN C      T+ T
Sbjct:  802 FYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDT 861          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Xenopus
Match: UBR4 (ubiquitin protein ligase E3 component n-recognin 4 [Source:NCBI gene;Acc:100329122])

HSP 1 Score: 334.724 bits (857), Expect = 1.283e-108
Identity = 263/956 (27.51%), Postives = 473/956 (49.48%), Query Frame = 1
Query: 13936 EIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESLRKEVPLEH-----YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHKN---SRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLL-NICIDFLVAVAPEDA-LKEGI-KLDLKRPD-TIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIEL 16743
            E+ +I   +++ +V  +L   L +R+L+V R+K+  + +    + ++D++  +E   ++F+ + +    ++ + D ++   I E++ + I P + E   F V L+    QEDFL  RM G   SS   G  P + D+ N + ++  + +    D  ++L+ + K++  DL + ++Y+ VW      N+  PMR+  R+ GL+ D    ++ESL      E      Y+ +  + + GG+  ++ RL  + +   G  ++   ++L +Y +KV  N  +L++  ++T+ V+L  L + L    + K       +    +++++  IL    A  +++    +    +   + +LLD I+     S   + Q  +  IP  L+F    +M +++D   P+      +     + K  L C C + + I ++  G   +  +++KG+  N  +D++    P    L   I K  L RP         + L       QA +G++               +  LHKLE V S + IG L+E+ L AL+E   D+NK I   R  T+   +  A+ +RQK L  + MT N+KGQV+T ++LLK +   + EEPG  C IC +GY  +P + LG+YTF K++ + +L +   +          Q  Y++VS++  VH+ CH  AV++     EW  A   N N KCN L+P+ GPH P++ F   L R+ T +   T   E  YQL +HDLK L LRFA  + F+ DTGGG R SNI L+P II   +  +++    I++E + +  +LEQ     + + ++ +      Y  V  L     E W   R+ +L+ LL  +H R  + +  +++    +    YS+Y   L+ + ++   YN+  K  TS+  T   W  +++ Y R ND+ + + ++K ++ ++D  +P ES SEF DV  L
Sbjct: 4223 EVESIKRHFKSRLVGTVLNGYLCLRKLVVQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYSLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYKRVWC---PTNEGEPMRIIYRMRGLLGDATEEFIESLDSTTDEEEDEEEVYKMAGVMAQCGGLECMLNRLTGIKDFKQGRHLLTVLLKLFSYCVKVKVNRQQLVKLEMNTLNVMLGTLNLALVAEQESK--DSGGAAVAEQVLSIMEIILDESNAEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQGLLRIIP-YLSFGEMEKMQILVDRFKPYCTFEKYDDEHSADDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQNNALDYMKKHIPSAKNLDADIWKKFLSRPALPFILRLLRGLATQHPPTQALIGTDS--------------ISNLHKLEQVSSDEGIGTLAENLLEALRE-HPDVNKKIDAARKETRAEKKRMAMAMRQKALGTLGMTTNEKGQVVTKTTLLKQMEELI-EEPGLTCCICREGYKFQPTKVLGIYTFTKRMNLEELENKSRK----------QQGYSTVSHFNIVHYDCHLAAVRLARGREEWDSAALQNANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDLKLLFLRFAMEQSFSADTGGGGRESNIHLIPYIIHTVLY-VLNTTRAISREEKNVQTFLEQPK---EKWVESAFDVDGPHYYTVLALHLLPTERWKTIRIDVLRRLLVISHARAASPSGANRLTDKSIR--DYSVYRSSLLFWALVDLIYNMYKKVPTSN--TEGGWSYSLADYIRLNDMPIYEAADKALKTFQDEFMPVESFSEFIDVAGL 5138          

HSP 2 Score: 83.5741 bits (205), Expect = 1.283e-108
Identity = 123/542 (22.69%), Postives = 223/542 (41.14%), Query Frame = 2
Query: 12305 ENEPEKESTKPPNVNPITTAETVKEEKKDSHSKHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYD--TRLARAKNNLVNVNESLFESNKIRQ------------NCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPN--LVSENEPAIEHKSSLIFPSMPVLCINQWLQDDSSQLFETWLQC--TREENQIPRDITLNSDQGNVGLIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDSWRNGQARPGLSN 13876
            E  PEK      N   I+           S S  ++  + QL  +Y  D K    E+  + ++++A++K +  YD   R A  K++   V  + F +++ R              CY C  +  +  I L++ L+    IRH + +   ++++        L    ++MR E+  ++  +TRD  E   ++N LI  ++  AL+  + +    S ++  + LL  SI+  D+ WELRLR A+++ L        + N    VV   I L+  C+R L   +K P    K N  +  +    ++  S+ I    P     QWL+ D    +E W +C   R  +Q  +  +  +++  + L +K+  +W      K+    K  +   ++       WL Q L + +  + RQA   +VE L      R + VL +L   L           D+L                      E + +Y+AL ++L +  HW+ YL  +  L  + +L    + + LA  E +     + G A   L+ 
Sbjct: 3742 EAAPEKPQDDSANAGSIS-----------STSASVNRYILQLAQEYCGDCKNSFDELSKIIQKVFASRKELLEYDLQQREAATKSSRTTVQPT-FTASQYRSLSVLGCGHTSSTKCYGCASAVTEHCITLLRALATNSTIRHILVSQGLIREL----FDYNLRRGPATMRDEVRQVMCLLTRDNPEATQQMNDLIIGKVSTALKGHWANPDLASSLQYEMLLLTDSISKEDNCWELRLRCALSLFL-------MAVNIKTPVVVENITLM--CLRILQKLIKPPSPTSKKNKEVPMDTLTTVKPYSNEIHAQAP-----QWLKRDPKASYEAWKKCLSARGTDQSGKSPS-KAERRQLYLQEKYVWKW------KQFMSRKGKRTSPLDLKLGHNNWLRQVLFTPATQAARQAACTIVEALATIPSRRQQ-VLDLLTSYL-----------DEL------------------SVAGECAAEYLALYQKLIKPAHWKVYLAARGVLPYVGNLITKEIARLLALEEATLSTDLQQGYALKSLTG 4216          

HSP 3 Score: 246.128 bits (627), Expect = 1.103e-63
Identity = 171/639 (26.76%), Postives = 310/639 (48.51%), Query Frame = 2
Query: 5831 VRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWN-PELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNE---AEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNE 7732
            +R ++ +  +RR  + V+S   G    +  LAV+ +K +I + ++S LL++                   D   ++  + ++ +  +PFTVLS+  NP  + Y+AVCGLK+  VL F+S GS+S   V+ P L   N FII ++WLPGS   L ++    V+++DLS     P ++F    S+ +D TF F          + E K+   +++MS +G ++ + +++   A  G FY+  +L+ N  EL + N     G +  GG S++Y H LQ+LF SY+ G++F + ++    EI   + + ++I++    ++    L  W  + +HPGL+  + Q T  P+ + V+P+ +  Q ++            ++ + +K+ D +     T   D+   QRT  ++L  DG ++I MAN+ + +    +WLQ               PSS+   +                 + + K +     SS    P+DFFEH +Q  +V FGG+  L+LY+ + +  R+ S    V+       ++ +TN     ++ G+R+ I      + P Y E++ R + +   L++ R  D    + E L  DK L L IG S +   + +ID +K++ + K    W +E
Sbjct: 1867 IRQLISAHVLRRVAMCVLSSPHG---RRQHLAVSHEKGKITVLQLSALLKQ------------------ADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTFSSSGSVSDHLVLHPQLATGN-FIIKAVWLPGSQTELAIVTADFVKVYDLSTDALSPTFYFLLPSSKIRDVTFLF----------NEEGKN--IIVIMSSAGYVYTQLMEEASSARHGPFYVTNVLEVNHEELKDSN-----GQVAGGGVSVYYSHVLQMLFFSYSQGKSFAATINRVTLEIL--RLFPINIKSSNGGSKTSPALCQWSEVMNHPGLVCCVQQTTGIPLVVMVKPDSFLIQEIK------------TLPAKAKIQDMVAI-RHTASNDQ---QRTTMILLCEDGSLRIYMANVENTS----YWLQPSL-----------QPSSSICIL-----------------KPVRKRKPAAVTSSQVTFPIDFFEHNQQLTDVEFGGNDLLQLYNAQQIKHRLNSTGMYVANTKPGGFTVEVTNNNSTMVMTGMRLQIGTQAIERAPSYIEMFGRTMQLN--LSRARWFDFPFTREEALQADKKLTLFIGASVDPAGVTMIDAIKIYGKTKEQFGWPDE 2414          

HSP 4 Score: 228.024 bits (580), Expect = 3.466e-58
Identity = 191/750 (25.47%), Postives = 346/750 (46.13%), Query Frame = 2
Query: 9983 ISFCLLNLDQLLILWRNQSPDQKNSEKELDTSNKILKQNLTSNQGFDVSVTF--DWLPMSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLNKQFSDHNVINRI---------KLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETIGXXXXXXXXXXXXXXXXXXXXXXTASSNPPXXXXXXXXXXXXXXXXXDKNTQRKSAGSAPEVNKQEAKLCRALTSKM----DNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHLLTKYPNWERIESFSHQLTNDIVQSSQELLSNSC-TPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEY-DCFTGSVSNSDNVKCPRCHSASIQGN--VCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITS 12160
            + +CL  L  LL  W++Q      S++E   ++++LK + TS+   D+S  F   ++     D       LLTE++LRLPY + K+   + ++                     +  W  +L E++ +  +  + +  R LL  + G+K  YR  RD+H +   +  IK LL     +H +  R           L +D  + L+E + +C     +R  NW+ +C K   +L FL+  S  + E +   LL LL  AL  S+       + S+  P    A   +  ++ K+  ++ ++   G +   N QE + C AL +++    D   L +F++ +L E   S VRW    +  ++Y +   + +  LL+ +   W    ++   + Q  DL+G+   K P  E+      Q   +I+++   +L+N   +  YN L  LV+  GYYL+S+PC VC  P                           +    +  +S  +        + R   T  V  L   ++I  +TVK    +R +    + LYY++ +  +  ++ ++   W K K V ++    E+K+D P+ + A  L+ E+ D +    ++S+ ++CPRC SAS+  N  VC NC +N+ QC +CR+INY   D F+C  C  C+Y R DF ++A+PC   ++ +++EE R+  +  I T  +  ++   +++  + +LE  L   K+ +AA    Q    N+  I+S
Sbjct: 3077 VDYCLHVLKSLLDYWKSQ-----QSDEEPVATSQLLKPHTTSSPP-DMSPFFLRQYVKGHAADVFQAYTQLLTEMVLRLPYQIKKIADTSSRIPPPVF----------------DHSWFYLLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQQRDLHTLDSHVKSIKKLLE----EHGIFLRAGVVTASSGSALQYDTLINLMEHLKACAEIASQRTINWQKFCIKDDSVLYFLLQVSFLVDEGVSPVLLQLLSCALCGSKVLSASSFSGSNAQPSSGQAGSQTKSSTKKSKKEDKEKDKEGES--ANSQEEQHCTALVNQLNKYADKETLIQFLRCFLLESNASAVRWQAHCLALHIYRNSNKSQQELLLDLMWSIWPELPAYGRKAAQFVDLLGYFSLKTPQSEKKFKEYSQKAVEILRTQNHILTNHPNSNIYNTLSGLVEFDGYYLESDPCLVCNNPE--------------------------VPLCNIKLSSIKV--------DTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTINLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFYENYQASSETLQCPRC-SASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYARPCCA-VDPIENEEDRKKAVTNINTLLDKADRVYHQLMGHRPQLENLL--CKVNEAAPEKPQDDSANAGSISS 3760          

HSP 5 Score: 124.79 bits (312), Expect = 5.948e-27
Identity = 55/100 (55.00%), Postives = 69/100 (69.00%), Query Frame = 2
Query: 4868 ENDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTIS 5167
            E+D    +S+E+       L ++LCTF  TQKEF +QHWYHCHTC MV+  GVCT+CAKVCH  H+++YAK GSFFCDCGAK    C AL +RT  + I 
Sbjct: 1628 EDDSQAEDSDEDS------LCNKLCTFTITQKEFMNQHWYHCHTCRMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGIG 1721          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Xenopus
Match: UBR4 (ubiquitin protein ligase E3 component n-recognin 4 [Source:NCBI gene;Acc:100329122])

HSP 1 Score: 320.087 bits (819), Expect = 1.208e-90
Identity = 255/925 (27.57%), Postives = 453/925 (48.97%), Query Frame = 1
Query: 14071 VDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESLRKEVPLEH-----YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHKN---SRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDA-LKEGI-KLDLKRPD-TIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVL 16788
            ++D++  +E   ++F+ + +    ++ + D ++   I E++ + I P + E   F V L+    QEDFL  RM G   SS   G  P + D+ N + ++  + +    D  ++L+ + K++  DL + ++Y+ VW      N+  PMR+  R+ GL+ D    ++ESL      E      Y+ +  + + GG+  ++ RL  + +   G  ++   ++L +Y +KV  N  +L++  ++T+ V+L  L + L    + K       +    +++++  IL    A  +++    +    +   + +LLD I+     S   + Q  +  IP  L+F    +M +++D   P+      +     + K  L C C + + I ++  G   +  +++KG+    +D++    P    L   I K  L RP         + L       QA +G++               +  LHKLE V S + IG L+E+ L AL+E   D+NK I   R  T+   +  A+ +RQK L  + MT N+KGQV+T ++LLK +   + EEPG  C IC +GY  +P + LG+YTF K++ + +L +   +          Q  Y++VS++  VH+ CH  AV++     EW  A   N N KCN L+P+ GPH P++ F   L R+ T +   T   E  YQL +HDLK L LRFA  + F+ DTGGG R SNI L+P II   +  +++    I++E + +  +LEQ     + + ++ +      Y  V  L     E W   R+ +L+ LL  +H R  + +  +++    +    YS+Y   L+ + ++   YN+  K  TS+  T   W  +++ Y R ND+ + + ++K ++ ++D  +P ES SEF DV  L   I   + +L  +L
Sbjct:    2 LEDMTTGTESETKAFMAVCIETAKRYSLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYKRVWC---PTNEGEPMRIIYRMRGLLGDATEEFIESLDSTTDEEEDEEEVYKMAGVMAQCGGLECMLNRLTGIKDFKQGRHLLTVLLKLFSYCVKVKVNRQQLVKLEMNTLNVMLGTLNLALVAEQESK--DSGGAAVAEQVLSIMEIILDESNAEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQGLLRIIP-YLSFGEMEKMQILVDRFKPYCTFEKYDDEHSADDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQNALDYMKKHIPSAKNLDADIWKKFLSRPALPFILRLLRGLATQHPPTQALIGTDS--------------ISNLHKLEQVSSDEGIGTLAENLLEALRE-HPDVNKKIDAARKETRAEKKRMAMAMRQKALGTLGMTTNEKGQVVTKTTLLKQMEELI-EEPGLTCCICREGYKFQPTKVLGIYTFTKRMNLEELENKSRK----------QQGYSTVSHFNIVHYDCHLAAVRLARGREEWDSAALQNANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDLKLLFLRFAMEQSFSADTGGGGRESNIHLIPYIIHTVLY-VLNTTRAISREEKNVQTFLEQPK---EKWVESAFDVDGPHYYTVLALHLLPTERWKTIRIDVLRRLLVISHARAASPSGANRLTDKSIR--DYSVYRSSLLFWALVDLIYNMYKKVPTSN--TEGGWSYSLADYIRLNDMPIYEAADKALKTFQDEFMPVESFSEFIDVAGLLSEIEDPDGFLRDLL 886          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Xenopus
Match: smad2 (SMAD family member 2 [Source:Xenbase;Acc:XB-GENE-482930])

HSP 1 Score: 56.9954 bits (136), Expect = 1.205e-6
Identity = 25/60 (41.67%), Postives = 33/60 (55.00%), Query Frame = 2
Query: 4982 WYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKG-SNFCEALTRRTNRT 5158
            +Y CHTC+  +   +C  C K CH GHD+ + +   FFCDCGA   SN C      T+ T
Sbjct:  802 FYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDT 861          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Xenopus
Match: smad2 (SMAD family member 2 [Source:Xenbase;Acc:XB-GENE-482930])

HSP 1 Score: 56.9954 bits (136), Expect = 1.279e-6
Identity = 25/60 (41.67%), Postives = 33/60 (55.00%), Query Frame = 2
Query: 4982 WYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKG-SNFCEALTRRTNRT 5158
            +Y CHTC+  +   +C  C K CH GHD+ + +   FFCDCGA   SN C      T+ T
Sbjct:  782 FYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDT 841          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Xenopus
Match: smad2 (SMAD family member 2 [Source:Xenbase;Acc:XB-GENE-482930])

HSP 1 Score: 56.9954 bits (136), Expect = 1.307e-6
Identity = 25/60 (41.67%), Postives = 33/60 (55.00%), Query Frame = 2
Query: 4982 WYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKG-SNFCEALTRRTNRT 5158
            +Y CHTC+  +   +C  C K CH GHD+ + +   FFCDCGA   SN C      T+ T
Sbjct:  773 FYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDT 832          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Mouse
Match: Ubr4 (ubiquitin protein ligase E3 component n-recognin 4 [Source:MGI Symbol;Acc:MGI:1916366])

HSP 1 Score: 337.806 bits (865), Expect = 2.720e-108
Identity = 261/970 (26.91%), Postives = 474/970 (48.87%), Query Frame = 1
Query: 13936 EIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESLRKEVPLEH-----YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHKN---SRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDA-LKEGI-KLDLKRPD-TIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVL 16788
            E+ +I   +++ +V  +L   L +R+L++ R+K+  + +    + ++D++  +E   ++F+ + +    ++ + D ++   I E++ + I P + E   F V L+    QEDFL  RM G   SS   G  P + D+ N + ++  + +    D  ++L+ + K++  DL + ++Y+ VW    A N+  PMR+  R+ GL+ D    ++ESL      E      Y+ +  + + GG+  ++ RLA V +   G  ++   ++L +Y +KV  N  +L++  L+T  + +    + L    +++       +    +++++  IL    A  +++    +    +   + +LLD I+     S   + Q  +  IP  L+F    +M ++++   P+      +     + K  L C C + + I ++  G   +  +++KG+    +D++    P    L   I K  L RP         + L       Q  +G++                  LHKLE V S + IG L+E+ L AL+E   D+NK I   R  T+   +  A+ +RQK L  + MT N+KGQV+T ++LLK +   + EEPG  C IC +GY  +P + LG+YTF K+V + +     M+  P       Q  Y++VS++  VH+ CH  AV++     EW  A   N N KCN L+P+ GPH P++ F   L R+ T +   T   E  YQL +HD+K L LRFA  + F+ DTGGG R SNI L+P II   +  +++     ++E + +  +LEQ     + + ++ +      Y  +  L     E W   RV+IL+ LL  +H R +     +++    ++   YS Y   L+ + ++   YN+  K  TS+  T   W  +++ Y R ND+ + + ++K ++ +++  +P E+ SEF D   L   I   E +L  +L
Sbjct: 4223 EVESIKRHFKSRLVGTVLNGYLCLRKLVLQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYNLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYKKVWC---ATNEGEPMRIVYRMRGLLGDATEEFIESLDSTTDEEEDEEEVYRMAGVMAQCGGLQCMLNRLAGVKDFKQGRHLLTVLLKLFSYCVKVKVNRQQLVK--LETNTLNVMLGTLNLALVAEQESKDSGGAAVAEQVLSIMEIILDESNAEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQGLLRIIP-YLSFGEVEKMQILVERFKPYCSFEKYDEDHSGDDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQNALDYMKKHIPSAKNLDADIWKKFLSRPALPFILRLLRGLAMQHPATQVLIGTDSITS--------------LHKLEQVSSDEGIGTLAENLLEALRE-HPDVNKKIDAARRETRAEKKRMAMAMRQKALGTLGMTTNEKGQVVTKTALLKQMEELI-EEPGLTCCICREGYKFQPTKVLGIYTFTKRVALEE-----MENKPR-----KQQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDIKLLFLRFAMEQSFSADTGGGGRESNIHLIPYIIHTVLY-VLNTTRATSREEKNLQGFLEQPK---EKWTESAFDVDGPHYFTILALHVLPPEQWKAIRVEILRRLLVASHARAVAPGGATRLTDKAVK--DYSAYRSSLLFWALVDLIYNMFKKVPTSN--TEGGWSCSLAEYIRHNDMPIYEAADKALKTFQEEFMPVETFSEFLDAAGLLSEITDPESFLKDLL 5152          

HSP 2 Score: 78.9518 bits (193), Expect = 2.720e-108
Identity = 118/517 (22.82%), Postives = 217/517 (41.97%), Query Frame = 2
Query: 12392 SHSKHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYD--TRLARAKNNLVNVNESLFESNKIRQ------------NCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNLVSENEPAIEHKSSLIFPSMPVLCINQ-WLQDDSSQLFETWLQCTREENQIP-RDITLN------SDQGNVGLIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDSWRNGQARPGLSN 13876
            S S  ++  + QL  +Y  D K    E+  + ++++A++K +  YD   R A  K++  +V  + F +++ R              CY C  +  +  I L++ L+  P +RH + +   ++++        L   ++++R+E+  L+  +TRD  E   ++N LI  ++  AL+  + +    S ++  + LL  SI+  DS WELRLR A+++ L        + N    VV   I L+  C+R L   +K P    K N     +  +E  +++      +    Q WL+ D    +E W +C      +P R +  N      S+   + L +K+  RW      K+    +  +   ++       WL Q L + +  + RQA   +VE L      R + VL +L   L           D+L                      E + +Y+AL ++L    HW+ YL  +  L  + +L    + + LA  E +     + G A   L+ 
Sbjct: 3760 STSASVNRYILQLAQEYCGDCKNSFDELSKIIQKVFASRKELLEYDLQQREAATKSSRTSVQPT-FTASQYRALSVLGCGHTSSTKCYGCASAVTEHCITLLRALATNPALRHILVSQGLIREL----FDYNLRRGAAAIREEVRQLMCLLTRDNPEATQQMNDLIIGKVSTALKGHWANPDLASSLQYEMLLLTDSISKEDSCWELRLRCALSLFL-------MAVNIKTPVVVENITLM--CLRILQKLIKPPAPTSKKN----KDVPVEALTTVKPYCNEIHAQAQLWLKRDPKASYEAWKKC------LPIRGVDGNGKSPSKSELHRLYLTEKYVWRW------KQFLSRRGKRTTPLDLKLGHNNWLRQVLFTPATQAARQAACTIVEALATVP-SRKQQVLDLLTSYL-----------DEL------------------SVAGECAAEYLALYQKLIASCHWKVYLAARGVLPYVGNLITKEIARLLALEEATLSTDLQQGYALKSLTG 4216          

HSP 3 Score: 251.136 bits (640), Expect = 2.678e-65
Identity = 181/671 (26.97%), Postives = 314/671 (46.80%), Query Frame = 2
Query: 5831 VRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNE---AEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKV--------QRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQEFLRSKESSKTKIQNKSSSNMEG 7807
            +R ++ +  +RR  + V+S   G    +  LAV+ +K +I + ++S LL++                   D   ++  + ++ +  +PFTVLS+  NP  + Y+AVCGLK+  VL F+S GS+S   V+ P L   N FII ++WLPGS   L ++    V+I+DLS     P ++F    S+ +D TF F          + E K+   +++MS +G ++ + +++   A  G FY+  +L+ N E     +D  + V G GG S++Y H LQ+LF SY+ GR+F + +     E+   + + ++I++    ++    L  W  + +HPGL+  + Q T  P+ + V+P  +  Q ++                        T P +  ++D + +        QRT  ++L  DG ++I MAN+ + +    +WLQ                       P+L+   + S      KR      I    SS    P+DFFEH +Q  +V FGG+  L++Y+ + +  R+ S    V+       ++ I+N     ++ G+RI I      + P Y EI+ R + +   L+++R  D    + E L  D+ L L IG S +   + +ID VK++ + K    W +E  E   S   S     N + SN  G
Sbjct: 1883 IRQLISAHVLRRVAMCVLSSPHG---RRQHLAVSHEKGKITVLQLSALLKQ------------------ADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTFSSSGSVSDHLVLHPQLATGN-FIIKAVWLPGSQTELAIVTADFVKIYDLSIDALSPTFYFLLPSSKIRDVTFLF----------NEEGKN--IIVIMSSAGYMYTQLMEEASSAQQGPFYVTNVLEINHEDL---KDSNSQVAG-GGVSVYYSHVLQMLFFSYSQGRSFAATVSRSTLEVL--QLFPINIKSSNGGSKTSPALCQWSEVMNHPGLVCCVQQTTGVPLVVMVKPGTFLIQEIK------------------------TLPAKAKIQDMVAIRHTACNEQQRTTMILLCEDGSLRIYMANVENTS----YWLQ-----------------------PSLQPSSVISIMKPVRKRKTAT--ITARTSSQVTFPIDFFEHNQQLTDVEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEISNNSSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLN--LSRSRWFDFPFTREEALQADRKLSLFIGASVDPAGVTMIDAVKIYGKTKEQFGWPDEPPEDFPSASVSNICPPNLNQSNGTG 2458          

HSP 4 Score: 174.866 bits (442), Expect = 3.092e-42
Identity = 117/439 (26.65%), Postives = 212/439 (48.29%), Query Frame = 2
Query: 10880 QEAKLCRALTSKM----DNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHLLTKYPNWERIESFSHQLTNDIVQSSQELLSNSC-TPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEY-DCFTGSVSNSDNVKCPRCHSASIQGN--VCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITS 12160
            QE +LC AL +++    D   L +F++ +L E   S VRW    +  ++Y +   A +  LL+ +   W    ++   + Q  DL+G+   K    E+      Q   +I+++   +L+N   +  YN L  LV+  GYYL+S+PC VC  P                           +    +  +S  +        + R   T  V  L   ++I  +TVK    +R +    + LYY++ +  +  ++ ++   W K K V ++    E+K+D P+ + A  L+ E+ D +    ++++ ++CPRC SAS+  N  VC NC +N+ QC +CR+INY   D F+C  C  C+Y R DF ++AKPC   ++ +++EE R+  ++ I T  +  ++   +++  + +LE  L   K+ +AA    Q+    +  I+S
Sbjct: 3360 QEDQLCTALVNQLNRFADKETLIQFLRCFLLESNSSSVRWQAHCLTLHIYRNSNKAQQELLLDLMWSIWPELPAYGRKAAQFVDLLGYFSLKTAQTEKKLKEYSQKAVEILRTQNHILTNHPNSNIYNTLSGLVEFDGYYLESDPCLVCNNPE--------------------------VPFCYIKLSSIKV--------DTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTINLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFYENYQASTETLQCPRC-SASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAKPCCA-VDPIENEEDRKKAVSNINTLLDKADRVYHQLMGHRPQLENLL--CKVNEAAPEKPQEDSGTAGGISS 3760          

HSP 5 Score: 126.716 bits (317), Expect = 1.086e-27
Identity = 64/142 (45.07%), Postives = 86/142 (60.56%), Query Frame = 2
Query: 4778 NDFNMNQLSID--KRAIEEILFCQVKHNPNFGENDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHASQS 5197
            N    + LS+D  +RAIE         + ++ E   +  E  + +    + L ++LCTF  TQKEF +QHWYHCHTC MV+  GVCT+CAKVCH  H+++YAK GSFFCDCGAK    C AL +RT  + +S   +  A QS
Sbjct: 1613 NGQGPSHLSVDGEERAIEV--------DSDWVEELAVEEEDSQAEDSDEDSLCNKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGMSSTMKESAFQS 1746          

HSP 6 Score: 78.1814 bits (191), Expect = 4.232e-13
Identity = 121/556 (21.76%), Postives = 228/556 (41.01%), Query Frame = 2
Query: 9071 EAVPTMAEVMQEMID---NADDQRMLDYALRKSLE-DQGGSSNDANIEGGAASNISQIFLDSRSLRTDPISSIYTEEEQQSLNNTGTPTIDNWGMNKTNKKNSKQAENLSTPDREYSESNSESDIAT-----YAMLKNASITSKLSPNNSQKVFLVCIQKFGIQFIKRIIVKWSSLMISLQGTRVITLYKSVLDVIRYMDMRDEEARSVVQNLVELMLDLVLGIKKDDDQLTILEYDTNEKRIHCQSICVVLRTLLNFILSGSKIQTIVPPIKEDNNSTAAEGKPTPSSCFNQVFTQDSVAFITLKLAYEKKLISFCLLNLDQLLILWRNQSPDQKNSEKELDTSNKILKQNLTSNQGFDVSVTF--DWLPMSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLNKQ--FSDHNVI---NRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETI 10687
            EA+   AE    M+D   +ADD+ M++ A+  SL+ DQ   ++D   EG  A+       D  +LRT P     +   +   +   +   ++    +++      AE         S S      AT               ++   + S ++ +V      +  ++R++     L  ++ G R I   + +L +   +D  DE+ +  + NL+  ++   LG+ K D          NE+    +   VV+R LL+  +S +K                  G  +     + + +  + A +    A     + +CL  L  LL  W++Q  D+     E   ++++LK + TS+   D+S  F   ++     D       LLTE++LRLPY + K+   + ++                     +  W   L E++ +  +  + +  R LL  + G+K  YR +RD+H +   +  IK LL +Q  F   +V+   +   L +D  + L+E + +C     +R  NW+ +C K   +L FL+  S  + E +
Sbjct: 2799 EALLAGAEGFPPMLDIPPDADDETMVELAIALSLQQDQQAPASDD--EGSTAAT------DGSTLRTSPADHGGSVGSESGGSAVDSVAGEHSVSGRSSAYGDATAEGHPAGPGSVSSSTGAISTATGHQEGDGSEGEGEGEAEGDVHTSNRLHMV-----RLMLLERLLQTLPQLR-NVGGVRAIPYMQVILMLTTDLDGEDEKDKGALDNLLAQLI-AELGMDKKDVS------KKNERSALNEVHLVVMR-LLSVFMSRTK-----------------SGSKSSICESSSLISSATAAALLSSGA-----VDYCLHVLKSLLEYWKSQQSDE-----EPVAASQLLKPHTTSSPP-DMSPFFLRQYVKGHAADVFEAYTQLLTEMVLRLPYQIKKIADTSSRIPPPVF----------------DHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVRGIKKLLEEQGIFLRASVVTASSGSALQYDTLISLMEHLKACAEIAAQRTINWQKFCIKDDSVLYFLLQVSFLVDEGV 3288          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Mouse
Match: Ubr4 (ubiquitin protein ligase E3 component n-recognin 4 [Source:MGI Symbol;Acc:MGI:1916366])

HSP 1 Score: 337.806 bits (865), Expect = 2.789e-108
Identity = 261/970 (26.91%), Postives = 474/970 (48.87%), Query Frame = 1
Query: 13936 EIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESLRKEVPLEH-----YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHKN---SRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDA-LKEGI-KLDLKRPD-TIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVL 16788
            E+ +I   +++ +V  +L   L +R+L++ R+K+  + +    + ++D++  +E   ++F+ + +    ++ + D ++   I E++ + I P + E   F V L+    QEDFL  RM G   SS   G  P + D+ N + ++  + +    D  ++L+ + K++  DL + ++Y+ VW    A N+  PMR+  R+ GL+ D    ++ESL      E      Y+ +  + + GG+  ++ RLA V +   G  ++   ++L +Y +KV  N  +L++  L+T  + +    + L    +++       +    +++++  IL    A  +++    +    +   + +LLD I+     S   + Q  +  IP  L+F    +M ++++   P+      +     + K  L C C + + I ++  G   +  +++KG+    +D++    P    L   I K  L RP         + L       Q  +G++                  LHKLE V S + IG L+E+ L AL+E   D+NK I   R  T+   +  A+ +RQK L  + MT N+KGQV+T ++LLK +   + EEPG  C IC +GY  +P + LG+YTF K+V + +     M+  P       Q  Y++VS++  VH+ CH  AV++     EW  A   N N KCN L+P+ GPH P++ F   L R+ T +   T   E  YQL +HD+K L LRFA  + F+ DTGGG R SNI L+P II   +  +++     ++E + +  +LEQ     + + ++ +      Y  +  L     E W   RV+IL+ LL  +H R +     +++    ++   YS Y   L+ + ++   YN+  K  TS+  T   W  +++ Y R ND+ + + ++K ++ +++  +P E+ SEF D   L   I   E +L  +L
Sbjct: 4247 EVESIKRHFKSRLVGTVLNGYLCLRKLVLQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYNLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYKKVWC---ATNEGEPMRIVYRMRGLLGDATEEFIESLDSTTDEEEDEEEVYRMAGVMAQCGGLQCMLNRLAGVKDFKQGRHLLTVLLKLFSYCVKVKVNRQQLVK--LETNTLNVMLGTLNLALVAEQESKDSGGAAVAEQVLSIMEIILDESNAEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQGLLRIIP-YLSFGEVEKMQILVERFKPYCSFEKYDEDHSGDDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQNALDYMKKHIPSAKNLDADIWKKFLSRPALPFILRLLRGLAMQHPATQVLIGTDSITS--------------LHKLEQVSSDEGIGTLAENLLEALRE-HPDVNKKIDAARRETRAEKKRMAMAMRQKALGTLGMTTNEKGQVVTKTALLKQMEELI-EEPGLTCCICREGYKFQPTKVLGIYTFTKRVALEE-----MENKPR-----KQQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDIKLLFLRFAMEQSFSADTGGGGRESNIHLIPYIIHTVLY-VLNTTRATSREEKNLQGFLEQPK---EKWTESAFDVDGPHYFTILALHVLPPEQWKAIRVEILRRLLVASHARAVAPGGATRLTDKAVK--DYSAYRSSLLFWALVDLIYNMFKKVPTSN--TEGGWSCSLAEYIRHNDMPIYEAADKALKTFQEEFMPVETFSEFLDAAGLLSEITDPESFLKDLL 5176          

HSP 2 Score: 79.337 bits (194), Expect = 2.789e-108
Identity = 118/517 (22.82%), Postives = 217/517 (41.97%), Query Frame = 2
Query: 12392 SHSKHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYD--TRLARAKNNLVNVNESLFESNKIRQ------------NCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNLVSENEPAIEHKSSLIFPSMPVLCINQ-WLQDDSSQLFETWLQCTREENQIP-RDITLN------SDQGNVGLIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDSWRNGQARPGLSN 13876
            S S  ++  + QL  +Y  D K    E+  + ++++A++K +  YD   R A  K++  +V  + F +++ R              CY C  +  +  I L++ L+  P +RH + +   ++++        L   ++++R+E+  L+  +TRD  E   ++N LI  ++  AL+  + +    S ++  + LL  SI+  DS WELRLR A+++ L        + N    VV   I L+  C+R L   +K P    K N     +  +E  +++      +    Q WL+ D    +E W +C      +P R +  N      S+   + L +K+  RW      K+    +  +   ++       WL Q L + +  + RQA   +VE L      R + VL +L   L           D+L                      E + +Y+AL ++L    HW+ YL  +  L  + +L    + + LA  E +     + G A   L+ 
Sbjct: 3784 STSASVNRYILQLAQEYCGDCKNSFDELSKIIQKVFASRKELLEYDLQQREAATKSSRTSVQPT-FTASQYRALSVLGCGHTSSTKCYGCASAVTEHCITLLRALATNPALRHILVSQGLIREL----FDYNLRRGAAAIREEVRQLMCLLTRDNPEATQQMNDLIIGKVSTALKGHWANPDLASSLQYEMLLLTDSISKEDSCWELRLRCALSLFL-------MAVNIKTPVVVENITLM--CLRILQKLIKPPAPTSKKN----KDVPVEALTTVKPYCNEIHAQAQLWLKRDPKASYEAWKKC------LPIRGVDGNGKSPSKSELHRLYLTEKYVWRW------KQFLSRRGKRTTPLDLKLGHNNWLRQVLFTPATQAARQAACTIVEALATVP-SRKQQVLDLLTSYL-----------DEL------------------SVAGECAAEYLALYQKLIASCHWKVYLAARGVLPYVGNLITKEIARLLALEEATLSTDLQQGYALKSLTG 4240          

HSP 3 Score: 251.521 bits (641), Expect = 1.918e-65
Identity = 181/671 (26.97%), Postives = 314/671 (46.80%), Query Frame = 2
Query: 5831 VRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNE---AEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKV--------QRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQEFLRSKESSKTKIQNKSSSNMEG 7807
            +R ++ +  +RR  + V+S   G    +  LAV+ +K +I + ++S LL++                   D   ++  + ++ +  +PFTVLS+  NP  + Y+AVCGLK+  VL F+S GS+S   V+ P L   N FII ++WLPGS   L ++    V+I+DLS     P ++F    S+ +D TF F          + E K+   +++MS +G ++ + +++   A  G FY+  +L+ N E     +D  + V G GG S++Y H LQ+LF SY+ GR+F + +     E+   + + ++I++    ++    L  W  + +HPGL+  + Q T  P+ + V+P  +  Q ++                        T P +  ++D + +        QRT  ++L  DG ++I MAN+ + +    +WLQ                       P+L+   + S      KR      I    SS    P+DFFEH +Q  +V FGG+  L++Y+ + +  R+ S    V+       ++ I+N     ++ G+RI I      + P Y EI+ R + +   L+++R  D    + E L  D+ L L IG S +   + +ID VK++ + K    W +E  E   S   S     N + SN  G
Sbjct: 1883 IRQLISAHVLRRVAMCVLSSPHG---RRQHLAVSHEKGKITVLQLSALLKQ------------------ADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTFSSSGSVSDHLVLHPQLATGN-FIIKAVWLPGSQTELAIVTADFVKIYDLSIDALSPTFYFLLPSSKIRDVTFLF----------NEEGKN--IIVIMSSAGYMYTQLMEEASSAQQGPFYVTNVLEINHEDL---KDSNSQVAG-GGVSVYYSHVLQMLFFSYSQGRSFAATVSRSTLEVL--QLFPINIKSSNGGSKTSPALCQWSEVMNHPGLVCCVQQTTGVPLVVMVKPGTFLIQEIK------------------------TLPAKAKIQDMVAIRHTACNEQQRTTMILLCEDGSLRIYMANVENTS----YWLQ-----------------------PSLQPSSVISIMKPVRKRKTAT--ITARTSSQVTFPIDFFEHNQQLTDVEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEISNNSSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLN--LSRSRWFDFPFTREEALQADRKLSLFIGASVDPAGVTMIDAVKIYGKTKEQFGWPDEPPEDFPSASVSNICPPNLNQSNGTG 2458          

HSP 4 Score: 174.866 bits (442), Expect = 3.309e-42
Identity = 117/439 (26.65%), Postives = 212/439 (48.29%), Query Frame = 2
Query: 10880 QEAKLCRALTSKM----DNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHLLTKYPNWERIESFSHQLTNDIVQSSQELLSNSC-TPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEY-DCFTGSVSNSDNVKCPRCHSASIQGN--VCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITS 12160
            QE +LC AL +++    D   L +F++ +L E   S VRW    +  ++Y +   A +  LL+ +   W    ++   + Q  DL+G+   K    E+      Q   +I+++   +L+N   +  YN L  LV+  GYYL+S+PC VC  P                           +    +  +S  +        + R   T  V  L   ++I  +TVK    +R +    + LYY++ +  +  ++ ++   W K K V ++    E+K+D P+ + A  L+ E+ D +    ++++ ++CPRC SAS+  N  VC NC +N+ QC +CR+INY   D F+C  C  C+Y R DF ++AKPC   ++ +++EE R+  ++ I T  +  ++   +++  + +LE  L   K+ +AA    Q+    +  I+S
Sbjct: 3384 QEDQLCTALVNQLNRFADKETLIQFLRCFLLESNSSSVRWQAHCLTLHIYRNSNKAQQELLLDLMWSIWPELPAYGRKAAQFVDLLGYFSLKTAQTEKKLKEYSQKAVEILRTQNHILTNHPNSNIYNTLSGLVEFDGYYLESDPCLVCNNPE--------------------------VPFCYIKLSSIKV--------DTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTINLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFYENYQASTETLQCPRC-SASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAKPCCA-VDPIENEEDRKKAVSNINTLLDKADRVYHQLMGHRPQLENLL--CKVNEAAPEKPQEDSGTAGGISS 3784          

HSP 5 Score: 126.716 bits (317), Expect = 1.096e-27
Identity = 64/142 (45.07%), Postives = 86/142 (60.56%), Query Frame = 2
Query: 4778 NDFNMNQLSID--KRAIEEILFCQVKHNPNFGENDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHASQS 5197
            N    + LS+D  +RAIE         + ++ E   +  E  + +    + L ++LCTF  TQKEF +QHWYHCHTC MV+  GVCT+CAKVCH  H+++YAK GSFFCDCGAK    C AL +RT  + +S   +  A QS
Sbjct: 1613 NGQGPSHLSVDGEERAIEV--------DSDWVEELAVEEEDSQAEDSDEDSLCNKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGMSSTMKESAFQS 1746          

HSP 6 Score: 73.9442 bits (180), Expect = 8.394e-12
Identity = 87/375 (23.20%), Postives = 160/375 (42.67%), Query Frame = 2
Query: 9587 GTRVITLYKSVLDVIRYMDMRDEEARSVVQNLVELMLDLVLGIKKDDDQLTILEYDTNEKRIHCQSICVVLRTLLNFILSGSKIQTIVPPIKEDNNSTAAEGKPTPSSCFNQVFTQDSVAFITLKLAYEKKLISFCLLNLDQLLILWRNQSPDQKNSEKELDTSNKILKQNLTSNQGFDVSVTF--DWLPMSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLNKQ--FSDHNVI---NRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETI 10687
            G R I   + +L +   +D  DE+ +  + NL+  ++   LG+ K D          NE+    +   VV+R LL+  +S +K                  G  +     + + +  + A +    A     + +CL  L  LL  W++Q  D+     E   ++++LK + TS+   D+S  F   ++     D       LLTE++LRLPY + K+   + ++                     +  W   L E++ +  +  + +  R LL  + G+K  YR +RD+H +   +  IK LL +Q  F   +V+   +   L +D  + L+E + +C     +R  NW+ +C K   +L FL+  S  + E +
Sbjct: 2990 GVRAIPYMQVILMLTTDLDGEDEKDKGALDNLLAQLI-AELGMDKKDVS------KKNERSALNEVHLVVMR-LLSVFMSRTK-----------------SGSKSSICESSSLISSATAAALLSSGA-----VDYCLHVLKSLLEYWKSQQSDE-----EPVAASQLLKPHTTSSPP-DMSPFFLRQYVKGHAADVFEAYTQLLTEMVLRLPYQIKKIADTSSRIPPPVF----------------DHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVRGIKKLLEEQGIFLRASVVTASSGSALQYDTLISLMEHLKACAEIAAQRTINWQKFCIKDDSVLYFLLQVSFLVDEGV 3312          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Mouse
Match: Ubr4 (ubiquitin protein ligase E3 component n-recognin 4 [Source:MGI Symbol;Acc:MGI:1916366])

HSP 1 Score: 252.292 bits (643), Expect = 7.819e-66
Identity = 181/671 (26.97%), Postives = 314/671 (46.80%), Query Frame = 2
Query: 5831 VRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNE---AEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKV--------QRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQEFLRSKESSKTKIQNKSSSNMEG 7807
            +R ++ +  +RR  + V+S   G    +  LAV+ +K +I + ++S LL++                   D   ++  + ++ +  +PFTVLS+  NP  + Y+AVCGLK+  VL F+S GS+S   V+ P L   N FII ++WLPGS   L ++    V+I+DLS     P ++F    S+ +D TF F          + E K+   +++MS +G ++ + +++   A  G FY+  +L+ N E     +D  + V G GG S++Y H LQ+LF SY+ GR+F + +     E+   + + ++I++    ++    L  W  + +HPGL+  + Q T  P+ + V+P  +  Q ++                        T P +  ++D + +        QRT  ++L  DG ++I MAN+ + +    +WLQ                       P+L+   + S      KR      I    SS    P+DFFEH +Q  +V FGG+  L++Y+ + +  R+ S    V+       ++ I+N     ++ G+RI I      + P Y EI+ R + +   L+++R  D    + E L  D+ L L IG S +   + +ID VK++ + K    W +E  E   S   S     N + SN  G
Sbjct:  595 IRQLISAHVLRRVAMCVLSSPHG---RRQHLAVSHEKGKITVLQLSALLKQ------------------ADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTFSSSGSVSDHLVLHPQLATGN-FIIKAVWLPGSQTELAIVTADFVKIYDLSIDALSPTFYFLLPSSKIRDVTFLF----------NEEGKN--IIVIMSSAGYMYTQLMEEASSAQQGPFYVTNVLEINHEDL---KDSNSQVAG-GGVSVYYSHVLQMLFFSYSQGRSFAATVSRSTLEVL--QLFPINIKSSNGGSKTSPALCQWSEVMNHPGLVCCVQQTTGVPLVVMVKPGTFLIQEIK------------------------TLPAKAKIQDMVAIRHTACNEQQRTTMILLCEDGSLRIYMANVENTS----YWLQ-----------------------PSLQPSSVISIMKPVRKRKTAT--ITARTSSQVTFPIDFFEHNQQLTDVEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEISNNSSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQL--NLSRSRWFDFPFTREEALQADRKLSLFIGASVDPAGVTMIDAVKIYGKTKEQFGWPDEPPEDFPSASVSNICPPNLNQSNGTG 1170          

HSP 2 Score: 126.716 bits (317), Expect = 7.784e-28
Identity = 64/142 (45.07%), Postives = 86/142 (60.56%), Query Frame = 2
Query: 4778 NDFNMNQLSID--KRAIEEILFCQVKHNPNFGENDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHASQS 5197
            N    + LS+D  +RAIE         + ++ E   +  E  + +    + L ++LCTF  TQKEF +QHWYHCHTC MV+  GVCT+CAKVCH  H+++YAK GSFFCDCGAK    C AL +RT  + +S   +  A QS
Sbjct:  325 NGQGPSHLSVDGEERAIEV--------DSDWVEELAVEEEDSQAEDSDEDSLCNKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGMSSTMKESAFQS 458          

HSP 3 Score: 77.0258 bits (188), Expect = 8.846e-13
Identity = 123/558 (22.04%), Postives = 233/558 (41.76%), Query Frame = 2
Query: 9071 EAVPTMAEVMQEMID---NADDQRMLDYALRKSLE-DQGGSSNDANIEGGAASNISQIFLDSRSLRTDPISSIYTEEEQQSLNNTGTPTIDNWGMNKTNKKNSKQAENLSTPDREYSESNSESDIATYAMLKNASITSKLSP-------NNSQKVFLVCIQKFGIQFIKRIIVKWSSLMISLQGTRVITLYKSVLDVIRYMDMRDEEARSVVQNLVELMLDLVLGIKKDDDQLTILEYDTNEKRIHCQSICVVLRTLLNFILSGSKIQTIVPPIKEDNNSTAAEGKPTPSSCFNQVFTQDSVAFITLKLAYEKKLISFCLLNLDQLLILWRNQSPDQKNSEKELDTSNKILKQNLTSNQGFDVSVTF--DWLPMSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLNKQ--FSDHNVI---NRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETI 10687
            EA+   AE    M+D   +ADD+ M++ A+  SL+ DQ   ++D   EG  A+       D  +LRT P     +   +   +   +   ++    +++      AE    P    S S+S   I+T    +    +            + S ++ +V      +  ++R++     L  ++ G R I   + +L +   +D  DE+ +  + NL+  ++   LG+ K D          NE+    +   VV+R LL+  +S +K                  G  +     + + +  + A +    A     + +CL  L  LL  W++Q      S++E   ++++LK + TS+   D+S  F   ++     D       LLTE++LRLPY + K+   + ++                     +  W   L E++ +  +  + +  R LL  + G+K  YR +RD+H +   +  IK LL +Q  F   +V+   +   L +D  + L+E + +C     +R  NW+ +C K   +L FL+  S  + E +
Sbjct: 1511 EALLAGAEGFPPMLDIPPDADDETMVELAIALSLQQDQQAPASDD--EGSTAAT------DGSTLRTSPADHGGSVGSESGGSAVDSVAGEHSVSGRSSAYGDATAEG--HPAGPGSVSSSTGAISTATGHQEGDGSEGEGEGEAEGDVHTSNRLHMV-----RLMLLERLLQTLPQLR-NVGGVRAIPYMQVILMLTTDLDGEDEKDKGALDNLLAQLI-AELGMDKKDVS------KKNERSALNEVHLVVMR-LLSVFMSRTK-----------------SGSKSSICESSSLISSATAAALLSSGA-----VDYCLHVLKSLLEYWKSQ-----QSDEEPVAASQLLKPHTTSSPP-DMSPFFLRQYVKGHAADVFEAYTQLLTEMVLRLPYQIKKIADTSSRIPPPVF----------------DHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVRGIKKLLEEQGIFLRASVVTASSGSALQYDTLISLMEHLKACAEIAAQRTINWQKFCIKDDSVLYFLLQVSFLVDEGV 2000          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Mouse
Match: Ubr4 (ubiquitin protein ligase E3 component n-recognin 4 [Source:MGI Symbol;Acc:MGI:1916366])

HSP 1 Score: 174.096 bits (440), Expect = 2.426e-42
Identity = 117/439 (26.65%), Postives = 212/439 (48.29%), Query Frame = 2
Query: 10880 QEAKLCRALTSKM----DNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHLLTKYPNWERIESFSHQLTNDIVQSSQELLSNSC-TPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEY-DCFTGSVSNSDNVKCPRCHSASIQGN--VCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITS 12160
            QE +LC AL +++    D   L +F++ +L E   S VRW    +  ++Y +   A +  LL+ +   W    ++   + Q  DL+G+   K    E+      Q   +I+++   +L+N   +  YN L  LV+  GYYL+S+PC VC  P                           +    +  +S  +        + R   T  V  L   ++I  +TVK    +R +    + LYY++ +  +  ++ ++   W K K V ++    E+K+D P+ + A  L+ E+ D +    ++++ ++CPRC SAS+  N  VC NC +N+ QC +CR+INY   D F+C  C  C+Y R DF ++AKPC   ++ +++EE R+  ++ I T  +  ++   +++  + +LE  L   K+ +AA    Q+    +  I+S
Sbjct:  225 QEDQLCTALVNQLNRFADKETLIQFLRCFLLESNSSSVRWQAHCLTLHIYRNSNKAQQELLLDLMWSIWPELPAYGRKAAQFVDLLGYFSLKTAQTEKKLKEYSQKAVEILRTQNHILTNHPNSNIYNTLSGLVEFDGYYLESDPCLVCNNPE--------------------------VPFCYIKLSSIKV--------DTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTINLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFYENYQASTETLQCPRC-SASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAKPCCA-VDPIENEEDRKKAVSNINTLLDKADRVYHQLMGHRPQLENLL--CKVNEAAPEKPQEDSGTAGGISS 625          

HSP 2 Score: 92.8189 bits (229), Expect = 7.274e-35
Identity = 55/213 (25.82%), Postives = 114/213 (53.52%), Query Frame = 1
Query: 13936 EIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNM-PYVESL 14559
            E+ +I   +++ +V  +L   L +R+L++ R+K+  + +    + ++D++  +E   ++F+ + +    ++ + D ++   I E++ + I P + E   F V L+    QEDFL  RM G   SS   G  P + D+ N + ++  + +    D  ++L+ + K++  DL + ++Y+ VW    A N+  PMR+  R+ GL+ D    ++ESL
Sbjct: 1088 EVESIKRHFKSRLVGTVLNGYLCLRKLVLQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYNLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYKKVWC---ATNEGEPMRIVYRMRGLLGDATEEFIESL 1297          

HSP 3 Score: 78.5666 bits (192), Expect = 7.274e-35
Identity = 118/517 (22.82%), Postives = 217/517 (41.97%), Query Frame = 2
Query: 12392 SHSKHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYD--TRLARAKNNLVNVNESLFESNKIRQ------------NCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNLVSENEPAIEHKSSLIFPSMPVLCINQ-WLQDDSSQLFETWLQCTREENQIP-RDITLN------SDQGNVGLIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDSWRNGQARPGLSN 13876
            S S  ++  + QL  +Y  D K    E+  + ++++A++K +  YD   R A  K++  +V  + F +++ R              CY C  +  +  I L++ L+  P +RH + +   ++++        L   ++++R+E+  L+  +TRD  E   ++N LI  ++  AL+  + +    S ++  + LL  SI+  DS WELRLR A+++ L        + N    VV   I L+  C+R L   +K P    K N     +  +E  +++      +    Q WL+ D    +E W +C      +P R +  N      S+   + L +K+  RW      K+    +  +   ++       WL Q L + +  + RQA   +VE L      R + VL +L   L           D+L                      E + +Y+AL ++L    HW+ YL  +  L  + +L    + + LA  E +     + G A   L+ 
Sbjct:  625 STSASVNRYILQLAQEYCGDCKNSFDELSKIIQKVFASRKELLEYDLQQREAATKSSRTSVQPT-FTASQYRALSVLGCGHTSSTKCYGCASAVTEHCITLLRALATNPALRHILVSQGLIREL----FDYNLRRGAAAIREEVRQLMCLLTRDNPEATQQMNDLIIGKVSTALKGHWANPDLASSLQYEMLLLTDSISKEDSCWELRLRCALSLFL-------MAVNIKTPVVVENITLM--CLRILQKLIKPPAPTSKKN----KDVPVEALTTVKPYCNEIHAQAQLWLKRDPKASYEAWKKC------LPIRGVDGNGKSPSKSELHRLYLTEKYVWRW------KQFLSRRGKRTTPLDLKLGHNNWLRQVLFTPATQAARQAACTIVEALATVP-SRKQQVLDLLTSYL-----------DEL------------------SVAGECAAEYLALYQKLIASCHWKVYLAARGVLPYVGNLITKEIARLLALEEATLSTDLQQGYALKSLTG 1081          

HSP 4 Score: 57.7658 bits (138), Expect = 6.045e-7
Identity = 41/169 (24.26%), Postives = 77/169 (45.56%), Query Frame = 2
Query: 10199 LILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLNKQ--FSDHNVI---NRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETI 10687
            ++LRLPY + K+   + ++                     +  W   L E++ +  +  + +  R LL  + G+K  YR +RD+H +   +  IK LL +Q  F   +V+   +   L +D  + L+E + +C     +R  NW+ +C K   +L FL+  S  + E +
Sbjct:    1 MVLRLPYQIKKIADTSSRIPPPVF----------------DHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVRGIKKLLEEQGIFLRASVVTASSGSALQYDTLISLMEHLKACAEIAAQRTINWQKFCIKDDSVLYFLLQVSFLVDEGV 153          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Mouse
Match: Fbxo11 (F-box protein 11 [Source:MGI Symbol;Acc:MGI:2147134])

HSP 1 Score: 56.6102 bits (135), Expect = 1.056e-6
Identity = 25/60 (41.67%), Postives = 33/60 (55.00%), Query Frame = 2
Query: 4982 WYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKG-SNFCEALTRRTNRT 5158
            +Y CHTC+  +   +C  C K CH GHD+ + +   FFCDCGA   SN C      T+ T
Sbjct:  853 FYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDT 912          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. UniProt/SwissProt
Match: sp|Q5T4S7|UBR4_HUMAN (E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 5.212e-108
Identity = 264/970 (27.22%), Postives = 479/970 (49.38%), Query Frame = 1
Query: 13936 EIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESLRKEVPLEH-----YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHKN---SRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDA-LKEGI-KLDLKRPDTIXXXXXXXXXXXXXXG-QACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVL 16788
            E+ +I   +++ +V  +L   L +R+L+V R+K+  + +    + ++D++  +E   ++F+ + +    ++ + D ++   I E++ + I P + E   F V L+    QEDFL  RM G   SS   G  P + D+ N + ++  + +    D  ++L+ + K++  DL + ++Y+ VW C+   N+  PMR+  R+ GL+ D    ++ESL      E      Y+ +  + + GG+  ++ RLA + +   G  ++   ++L +Y +KV  N  +L++  ++T+ V+L  L + L    + K       +    +++++  IL    A  +++    +    +   + +LLD I+     S   + Q  +  IP  L+F    +M ++++   P+      +     + K  L C C + + I ++  G   +  +++KG+    +D++    P    L   I K  L RP     L       +   G Q  +G++          ++P     LHKLE V S + IG L+E+ L AL+E   D+NK I   R  T+   +  A+ +RQK L  + MT N+KGQV  + + L     +++EEPG  C IC +GY  +P + LG+YTF K+V + +     M+  P       Q  Y++VS++  VH+ CH  AV++     EW  A   N N KCN L+P+ GPH P++ F   L R+ T +   T   E  YQL +HD+K L LRFA  + F+ DTGGG R SNI L+P II   +  +++     ++E + +  +LEQ     + + ++ ++     Y  V  L     E W   RV+IL+ LL  +  R +     +++    ++   YS Y   L+ + ++   YN+  K  TS+  T   W  +++ Y R ND+ + + ++K ++ +++  +P E+ SEF DV  L   I   E +L  +L
Sbjct: 4250 EVESIKRHFKSRLVGTVLNGYLCLRKLVVQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYNLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYKKVW-CT--TNEGEPMRIVYRMRGLLGDATEEFIESLDSTTDEEEDEEEVYKMAGVMAQCGGLECMLNRLAGIRDFKQGRHLLTVLLKLFSYCVKVKVNRQQLVKLEMNTLNVMLGTLNLALVAEQESK--DSGGAAVAEQVLSIMEIILDESNAEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQGLLRIIP-YLSFGEVEKMQILVERFKPYCNFDKYDEDHSGDDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQNALDYMKKHIPSAKNLDADIWKKFLSRPALPFILRLLRGLAIQHPGTQVLIGTD----------SIPN----LHKLEQVSSDEGIGTLAENLLEALRE-HPDVNKKIDAARRETRAEKKRMAMAMRQKALGTLGMTTNEKGQV-VTKTALLKQMEELIEEPGLTCCICREGYKFQPTKVLGIYTFTKRVALEE-----MENKPR-----KQQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDIKLLFLRFAMEQSFSADTGGGGRESNIHLIPYIIHTVLY-VLNTTRATSREEKNLQGFLEQPK---EKWVESAFEVDGPYYFTVLALHILPPEQWRATRVEILRRLLVTSQARAVAPGGATRLTDKAVK--DYSAYRSSLLFWALVDLIYNMFKKVPTSN--TEGGWSCSLAEYIRHNDMPIYEAADKALKTFQEEFMPVETFSEFLDVAGLLSEITDPESFLKDLL 5179          

HSP 2 Score: 81.6481 bits (200), Expect = 5.212e-108
Identity = 119/517 (23.02%), Postives = 218/517 (42.17%), Query Frame = 2
Query: 12392 SHSKHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYD--TRLARAKNNLVNVNESLFESNKIRQ------------NCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNLVSENEPAIEHKSSLIFPSMPVLCINQ-WLQDDSSQLFETWLQCTREENQIP-RDITLN------SDQGNVGLIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDSWRNGQARPGLSN 13876
            S S  ++  + QL  +Y  D K    E+  + ++++A++K +  YD   R A  K++  +V  + F +++ R              CY C  +  +  I L++ L+  P +RH + +   ++++        L   +++MR+E+  L+  +TRD  E   ++N LI  ++  AL+  + +    S ++  + LL  SI+  DS WELRLR A+++ L        + N    VV   I L+  C+R L   +K P    K N     +  +E  +++      +    Q WL+ D    ++ W +C      +P R I  N      S+  ++ L +K+  RW      K+    +  +   ++       WL Q L + +  + RQA   +VE L      R + VL +L   L           D+L                      E + +Y+AL ++L    HW+ YL  +  L  + +L    + + LA  E +     + G A   L+ 
Sbjct: 3787 STSASVNRYILQLAQEYCGDCKNSFDELSKIIQKVFASRKELLEYDLQQREAATKSSRTSVQPT-FTASQYRALSVLGCGHTSSTKCYGCASAVTEHCITLLRALATNPALRHILVSQGLIREL----FDYNLRRGAAAMREEVRQLMCLLTRDNPEATQQMNDLIIGKVSTALKGHWANPDLASSLQYEMLLLTDSISKEDSCWELRLRCALSLFL-------MAVNIKTPVVVENITLM--CLRILQKLIKPPAPTSKKN----KDVPVEALTTVKPYCNEIHAQAQLWLKRDPKASYDAWKKC------LPIRGIDGNGKAPSKSELRHLYLTEKYVWRW------KQFLSRRGKRTSPLDLKLGHNNWLRQVLFTPATQAARQAACTIVEALATIP-SRKQQVLDLLTSYL-----------DEL------------------SIAGECAAEYLALYQKLITSAHWKVYLAARGVLPYVGNLITKEIARLLALEEATLSTDLQQGYALKSLTG 4243          

HSP 3 Score: 250.366 bits (638), Expect = 3.758e-64
Identity = 192/734 (26.16%), Postives = 336/734 (45.78%), Query Frame = 2
Query: 5642 TVGKNKQMKEAFKSVRTSEKISERVTTIMGSSIQLRNAEAPSDMSGIPPTSVLASEIAGANSHVRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNE---AEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKV--------QRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQEFLRSKESSKTKIQNKSSSNMEG 7807
             VG + + ++A   + T EK  E    +M  +  L + E   +       +V  +        +R ++ +  +RR  + V+S   G    +  LAV+ +K +I + ++S LL++                   D   ++  + ++ +  +PFTVLS+  NP  + Y+AVCGLK+  VL F+S GS+S   V+ P L   N FII ++WLPGS   L ++    V+I+DL      P ++F    S+ +D TF F          + E K+   +++MS +G I+ + +++   A  G FY+  +L+ N E     +D  + V G GG S++Y H LQ+LF SY  G++F + +     E+   + + ++I++    ++    L  W  + +HPGL+  + Q T  P+ + V+P+ +  Q ++                        T P +  ++D + +        QRT  ++L  DG ++I MAN+ + +    +WLQ                       P+L+   + S      KR      I    SS    P+DFFEH +Q  +V FGG+  L++Y+ + +  R+ S    V+       ++ I+N     ++ G+RI I      + P Y EI+ R + +   L+++R  D    + E L  DK L+L IG S +   + +ID VK++ + K    W +E  E   S   S     N + SN  G
Sbjct: 1831 AVGSSSRAQQALSELHTVEKAVEMTDQLMVPT--LGSQEGAFE-------NVRMNYSGDQGQTIRQLISAHVLRRVAMCVLSSPHG---RRQHLAVSHEKGKITVLQLSALLKQ------------------ADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTFSSSGSVSDHLVLHPQLATGN-FIIKAVWLPGSQTELAIVTADFVKIYDLCVDALSPTFYFLLPSSKIRDVTFLF----------NEEGKN--IIVIMSSAGYIYTQLMEEASSAQQGPFYVTNVLEINHEDL---KDSNSQVAG-GGVSVYYSHVLQMLFFSYCQGKSFAATISRTTLEVL--QLFPINIKSSNGGSKTSPALCQWSEVMNHPGLVCCVQQTTGVPLVVMVKPDTFLIQEIK------------------------TLPAKAKIQDMVAIRHTACNEQQRTTMILLCEDGSLRIYMANVENTS----YWLQ-----------------------PSLQPSSVISIMKPVRKRKTAT--ITTRTSSQVTFPIDFFEHNQQLTDVEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEISNNNSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLN--LSRSRWFDFPFTREEALQADKKLNLFIGASVDPAGVTMIDAVKIYGKTKEQFGWPDEPPEEFPSASVSNICPSNLNQSNGTG 2460          

HSP 4 Score: 176.792 bits (447), Expect = 5.352e-42
Identity = 117/439 (26.65%), Postives = 212/439 (48.29%), Query Frame = 2
Query: 10880 QEAKLCRALTSKM----DNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHLLTKYPNWERIESFSHQLTNDIVQSSQELLSNSC-TPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEY-DCFTGSVSNSDNVKCPRCHSASIQGN--VCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITS 12160
            QE +LC AL +++    D   L +F++ +L E   S VRW    +  ++Y +   + +  LL+ +   W    ++   + Q  DL+G+   K P  E+      Q   +I+++   +L+N   +  YN L  LV+  GYYL+S+PC VC  P                           +    +  +S  +        + R   T  V  L   ++I  +TVK    +R +    + LYY++ +  +  ++ ++   W K K V ++    E+K+D P+ + A  L+ E+ D +    ++++ ++CPRC SAS+  N  VC NC +N+ QC +CR+INY   D F+C  C  C+Y R DF ++AKPC   ++ +++EE R+  ++ I T  +  ++   +++  + +LE  L   K+ +AA    Q     +  I+S
Sbjct: 3387 QEDQLCTALVNQLNKFADKETLIQFLRCFLLESNSSSVRWQAHCLTLHIYRNSSKSQQELLLDLMWSIWPELPAYGRKAAQFVDLLGYFSLKTPQTEKKLKEYSQKAVEILRTQNHILTNHPNSNIYNTLSGLVEFDGYYLESDPCLVCNNPE--------------------------VPFCYIKLSSIKV--------DTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTINLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFYENYQASTETLQCPRC-SASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAKPCCA-VDPIENEEDRKKAVSNINTLLDKADRVYHQLMGHRPQLENLL--CKVNEAAPEKPQDDSGTAGGISS 3787          

HSP 5 Score: 126.716 bits (317), Expect = 7.795e-27
Identity = 64/142 (45.07%), Postives = 86/142 (60.56%), Query Frame = 2
Query: 4778 NDFNMNQLSID--KRAIEEILFCQVKHNPNFGENDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHASQS 5197
            N    + LS+D  +RAIE         + ++ E   +  E  + +    + L ++LCTF  TQKEF +QHWYHCHTC MV+  GVCT+CAKVCH  H+++YAK GSFFCDCGAK    C AL +RT  + +S   +  A QS
Sbjct: 1614 NGQGPSHLSVDGEERAIEV--------DSDWVEELAVEEEDSQAEDSDEDSLCNKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGMSSTMKESAFQS 1747          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. UniProt/SwissProt
Match: sp|A2AN08|UBR4_MOUSE (E3 ubiquitin-protein ligase UBR4 OS=Mus musculus OX=10090 GN=Ubr4 PE=1 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 1.697e-107
Identity = 261/970 (26.91%), Postives = 474/970 (48.87%), Query Frame = 1
Query: 13936 EIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESLRKEVPLEH-----YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHKN---SRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDA-LKEGI-KLDLKRPD-TIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVL 16788
            E+ +I   +++ +V  +L   L +R+L++ R+K+  + +    + ++D++  +E   ++F+ + +    ++ + D ++   I E++ + I P + E   F V L+    QEDFL  RM G   SS   G  P + D+ N + ++  + +    D  ++L+ + K++  DL + ++Y+ VW    A N+  PMR+  R+ GL+ D    ++ESL      E      Y+ +  + + GG+  ++ RLA V +   G  ++   ++L +Y +KV  N  +L++  L+T  + +    + L    +++       +    +++++  IL    A  +++    +    +   + +LLD I+     S   + Q  +  IP  L+F    +M ++++   P+      +     + K  L C C + + I ++  G   +  +++KG+    +D++    P    L   I K  L RP         + L       Q  +G++                  LHKLE V S + IG L+E+ L AL+E   D+NK I   R  T+   +  A+ +RQK L  + MT N+KGQV+T ++LLK +   + EEPG  C IC +GY  +P + LG+YTF K+V + +     M+  P       Q  Y++VS++  VH+ CH  AV++     EW  A   N N KCN L+P+ GPH P++ F   L R+ T +   T   E  YQL +HD+K L LRFA  + F+ DTGGG R SNI L+P II   +  +++     ++E + +  +LEQ     + + ++ +      Y  +  L     E W   RV+IL+ LL  +H R +     +++    ++   YS Y   L+ + ++   YN+  K  TS+  T   W  +++ Y R ND+ + + ++K ++ +++  +P E+ SEF D   L   I   E +L  +L
Sbjct: 4247 EVESIKRHFKSRLVGTVLNGYLCLRKLVLQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYNLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYKKVWC---ATNEGEPMRIVYRMRGLLGDATEEFIESLDSTTDEEEDEEEVYRMAGVMAQCGGLQCMLNRLAGVKDFKQGRHLLTVLLKLFSYCVKVKVNRQQLVK--LETNTLNVMLGTLNLALVAEQESKDSGGAAVAEQVLSIMEIILDESNAEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQGLLRIIP-YLSFGEVEKMQILVERFKPYCSFEKYDEDHSGDDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQNALDYMKKHIPSAKNLDADIWKKFLSRPALPFILRLLRGLAMQHPATQVLIGTDSITS--------------LHKLEQVSSDEGIGTLAENLLEALRE-HPDVNKKIDAARRETRAEKKRMAMAMRQKALGTLGMTTNEKGQVVTKTALLKQMEELI-EEPGLTCCICREGYKFQPTKVLGIYTFTKRVALEE-----MENKPR-----KQQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDIKLLFLRFAMEQSFSADTGGGGRESNIHLIPYIIHTVLY-VLNTTRATSREEKNLQGFLEQPK---EKWTESAFDVDGPHYFTILALHVLPPEQWKAIRVEILRRLLVASHARAVAPGGATRLTDKAVK--DYSAYRSSLLFWALVDLIYNMFKKVPTSN--TEGGWSCSLAEYIRHNDMPIYEAADKALKTFQEEFMPVETFSEFLDAAGLLSEITDPESFLKDLL 5176          

HSP 2 Score: 79.337 bits (194), Expect = 1.697e-107
Identity = 118/517 (22.82%), Postives = 217/517 (41.97%), Query Frame = 2
Query: 12392 SHSKHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYD--TRLARAKNNLVNVNESLFESNKIRQ------------NCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNLVSENEPAIEHKSSLIFPSMPVLCINQ-WLQDDSSQLFETWLQCTREENQIP-RDITLN------SDQGNVGLIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDSWRNGQARPGLSN 13876
            S S  ++  + QL  +Y  D K    E+  + ++++A++K +  YD   R A  K++  +V  + F +++ R              CY C  +  +  I L++ L+  P +RH + +   ++++        L   ++++R+E+  L+  +TRD  E   ++N LI  ++  AL+  + +    S ++  + LL  SI+  DS WELRLR A+++ L        + N    VV   I L+  C+R L   +K P    K N     +  +E  +++      +    Q WL+ D    +E W +C      +P R +  N      S+   + L +K+  RW      K+    +  +   ++       WL Q L + +  + RQA   +VE L      R + VL +L   L           D+L                      E + +Y+AL ++L    HW+ YL  +  L  + +L    + + LA  E +     + G A   L+ 
Sbjct: 3784 STSASVNRYILQLAQEYCGDCKNSFDELSKIIQKVFASRKELLEYDLQQREAATKSSRTSVQPT-FTASQYRALSVLGCGHTSSTKCYGCASAVTEHCITLLRALATNPALRHILVSQGLIREL----FDYNLRRGAAAIREEVRQLMCLLTRDNPEATQQMNDLIIGKVSTALKGHWANPDLASSLQYEMLLLTDSISKEDSCWELRLRCALSLFL-------MAVNIKTPVVVENITLM--CLRILQKLIKPPAPTSKKN----KDVPVEALTTVKPYCNEIHAQAQLWLKRDPKASYEAWKKC------LPIRGVDGNGKSPSKSELHRLYLTEKYVWRW------KQFLSRRGKRTTPLDLKLGHNNWLRQVLFTPATQAARQAACTIVEALATVP-SRKQQVLDLLTSYL-----------DEL------------------SVAGECAAEYLALYQKLIASCHWKVYLAARGVLPYVGNLITKEIARLLALEEATLSTDLQQGYALKSLTG 4240          

HSP 3 Score: 251.521 bits (641), Expect = 1.342e-64
Identity = 181/671 (26.97%), Postives = 314/671 (46.80%), Query Frame = 2
Query: 5831 VRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNE---AEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKV--------QRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQEFLRSKESSKTKIQNKSSSNMEG 7807
            +R ++ +  +RR  + V+S   G    +  LAV+ +K +I + ++S LL++                   D   ++  + ++ +  +PFTVLS+  NP  + Y+AVCGLK+  VL F+S GS+S   V+ P L   N FII ++WLPGS   L ++    V+I+DLS     P ++F    S+ +D TF F          + E K+   +++MS +G ++ + +++   A  G FY+  +L+ N E     +D  + V G GG S++Y H LQ+LF SY+ GR+F + +     E+   + + ++I++    ++    L  W  + +HPGL+  + Q T  P+ + V+P  +  Q ++                        T P +  ++D + +        QRT  ++L  DG ++I MAN+ + +    +WLQ                       P+L+   + S      KR      I    SS    P+DFFEH +Q  +V FGG+  L++Y+ + +  R+ S    V+       ++ I+N     ++ G+RI I      + P Y EI+ R + +   L+++R  D    + E L  D+ L L IG S +   + +ID VK++ + K    W +E  E   S   S     N + SN  G
Sbjct: 1883 IRQLISAHVLRRVAMCVLSSPHG---RRQHLAVSHEKGKITVLQLSALLKQ------------------ADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTFSSSGSVSDHLVLHPQLATGN-FIIKAVWLPGSQTELAIVTADFVKIYDLSIDALSPTFYFLLPSSKIRDVTFLF----------NEEGKN--IIVIMSSAGYMYTQLMEEASSAQQGPFYVTNVLEINHEDL---KDSNSQVAG-GGVSVYYSHVLQMLFFSYSQGRSFAATVSRSTLEVL--QLFPINIKSSNGGSKTSPALCQWSEVMNHPGLVCCVQQTTGVPLVVMVKPGTFLIQEIK------------------------TLPAKAKIQDMVAIRHTACNEQQRTTMILLCEDGSLRIYMANVENTS----YWLQ-----------------------PSLQPSSVISIMKPVRKRKTAT--ITARTSSQVTFPIDFFEHNQQLTDVEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEISNNSSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLN--LSRSRWFDFPFTREEALQADRKLSLFIGASVDPAGVTMIDAVKIYGKTKEQFGWPDEPPEDFPSASVSNICPPNLNQSNGTG 2458          

HSP 4 Score: 174.866 bits (442), Expect = 2.315e-41
Identity = 117/439 (26.65%), Postives = 212/439 (48.29%), Query Frame = 2
Query: 10880 QEAKLCRALTSKM----DNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHLLTKYPNWERIESFSHQLTNDIVQSSQELLSNSC-TPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEY-DCFTGSVSNSDNVKCPRCHSASIQGN--VCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITS 12160
            QE +LC AL +++    D   L +F++ +L E   S VRW    +  ++Y +   A +  LL+ +   W    ++   + Q  DL+G+   K    E+      Q   +I+++   +L+N   +  YN L  LV+  GYYL+S+PC VC  P                           +    +  +S  +        + R   T  V  L   ++I  +TVK    +R +    + LYY++ +  +  ++ ++   W K K V ++    E+K+D P+ + A  L+ E+ D +    ++++ ++CPRC SAS+  N  VC NC +N+ QC +CR+INY   D F+C  C  C+Y R DF ++AKPC   ++ +++EE R+  ++ I T  +  ++   +++  + +LE  L   K+ +AA    Q+    +  I+S
Sbjct: 3384 QEDQLCTALVNQLNRFADKETLIQFLRCFLLESNSSSVRWQAHCLTLHIYRNSNKAQQELLLDLMWSIWPELPAYGRKAAQFVDLLGYFSLKTAQTEKKLKEYSQKAVEILRTQNHILTNHPNSNIYNTLSGLVEFDGYYLESDPCLVCNNPE--------------------------VPFCYIKLSSIKV--------DTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTINLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFYENYQASTETLQCPRC-SASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAKPCCA-VDPIENEEDRKKAVSNINTLLDKADRVYHQLMGHRPQLENLL--CKVNEAAPEKPQEDSGTAGGISS 3784          

HSP 5 Score: 126.716 bits (317), Expect = 7.665e-27
Identity = 64/142 (45.07%), Postives = 86/142 (60.56%), Query Frame = 2
Query: 4778 NDFNMNQLSID--KRAIEEILFCQVKHNPNFGENDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHASQS 5197
            N    + LS+D  +RAIE         + ++ E   +  E  + +    + L ++LCTF  TQKEF +QHWYHCHTC MV+  GVCT+CAKVCH  H+++YAK GSFFCDCGAK    C AL +RT  + +S   +  A QS
Sbjct: 1613 NGQGPSHLSVDGEERAIEV--------DSDWVEELAVEEEDSQAEDSDEDSLCNKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGMSSTMKESAFQS 1746          

HSP 6 Score: 73.9442 bits (180), Expect = 5.871e-11
Identity = 87/375 (23.20%), Postives = 160/375 (42.67%), Query Frame = 2
Query: 9587 GTRVITLYKSVLDVIRYMDMRDEEARSVVQNLVELMLDLVLGIKKDDDQLTILEYDTNEKRIHCQSICVVLRTLLNFILSGSKIQTIVPPIKEDNNSTAAEGKPTPSSCFNQVFTQDSVAFITLKLAYEKKLISFCLLNLDQLLILWRNQSPDQKNSEKELDTSNKILKQNLTSNQGFDVSVTF--DWLPMSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLNKQ--FSDHNVI---NRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETI 10687
            G R I   + +L +   +D  DE+ +  + NL+  ++   LG+ K D          NE+    +   VV+R LL+  +S +K                  G  +     + + +  + A +    A     + +CL  L  LL  W++Q  D+     E   ++++LK + TS+   D+S  F   ++     D       LLTE++LRLPY + K+   + ++                     +  W   L E++ +  +  + +  R LL  + G+K  YR +RD+H +   +  IK LL +Q  F   +V+   +   L +D  + L+E + +C     +R  NW+ +C K   +L FL+  S  + E +
Sbjct: 2990 GVRAIPYMQVILMLTTDLDGEDEKDKGALDNLLAQLI-AELGMDKKDVS------KKNERSALNEVHLVVMR-LLSVFMSRTK-----------------SGSKSSICESSSLISSATAAALLSSGA-----VDYCLHVLKSLLEYWKSQQSDE-----EPVAASQLLKPHTTSSPP-DMSPFFLRQYVKGHAADVFEAYTQLLTEMVLRLPYQIKKIADTSSRIPPPVF----------------DHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVRGIKKLLEEQGIFLRASVVTASSGSALQYDTLISLMEHLKACAEIAAQRTINWQKFCIKDDSVLYFLLQVSFLVDEGV 3312          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. UniProt/SwissProt
Match: sp|Q2TL32|UBR4_RAT (E3 ubiquitin-protein ligase UBR4 OS=Rattus norvegicus OX=10116 GN=Ubr4 PE=1 SV=2)

HSP 1 Score: 336.65 bits (862), Expect = 3.299e-107
Identity = 264/970 (27.22%), Postives = 477/970 (49.18%), Query Frame = 1
Query: 13936 EIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESLRKEVPLEH-----YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHKN---SRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDA-LKEGI-KLDLKRPD-TIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVL 16788
            E+ +I   +++ +V  +L   L +R+L++ R+K+  + +    + ++D++  +E   ++F+ + +    ++ + D ++   I E++ + I P + E   F V L+    QEDFL  RM G   SS   G  P + D+ N + ++  + +    D  ++L+ + K++  DL + ++Y+ VW C+   N+  PMR+  R+ GL+ D    ++ESL      E      Y+ +  + + GG+  ++ RLA V +   G  ++   ++L +Y +KV  N  +L++  ++T+ V+L  L + L    + K       +    +++++  IL    A  +++    +    +   + +LLD I+     S   + Q  +  IP  L+F    +M ++++   P+      +     + K  L C C + + I ++  G   +  +++KG+    +D++    P    L   I K  L RP         + L       Q  +G++                  LHKLE V S + IG L+E+ L AL+E   D+NK I   R  T+   +  A+ +RQK L  + MT N+KGQV+T ++LLK +   + EEPG  C IC +GY  +P + LG+YTF K+V + +     M+  P       Q  Y++VS++  VH+ CH  AV++     EW  A   N N KCN L+P+ GPH P++ F   L R+ T +   T   E  YQL +HD+K L LRFA  + F+ DTGGG R SNI L+P II   +  +++     ++E + +  +LEQ     + + ++ +      Y  +  L     E W   RV+IL+ LL  +H R +     +++    ++   YS Y   L+ + ++   YN+  K  TS+  T   W  +++ Y R ND+ + + ++K ++ +++  +P E+ SEF D   L   I   E +L  +L
Sbjct: 4261 EVESIKRHFKSRLVGTVLNGYLCLRKLVLQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYNLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLPVAEVYKKVW-CT--TNEGEPMRIVYRMRGLLGDATEEFIESLDSTTDEEEDEEEVYRMAGVMAQCGGLQCMLNRLAGVKDFKQGRHLLTVLLKLFSYCVKVKVNRQQLVKLEMNTLNVMLGTLNLALVAEQESK--DSGGAAVAEQVLSIMEIILDESNAEPLSEDKGNLLLTGDKDQLVMLLDQINSTFVRSNPSVLQGLLRIIP-YLSFGEVEKMQILVERFKPYCSFDKYDEDHSGDDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQSALDYMKKHIPSAKNLDADIWKKFLSRPALPFILRLLRGLAMQHPATQVLIGTDSITS--------------LHKLEQVSSDEGIGTLAENLLEALRE-HPDVNKKIDAARRETRAEKKRMAMAMRQKALGTLGMTTNEKGQVVTKTALLKQMEELI-EEPGLTCCICREGYKFQPTKVLGIYTFTKRVALEE-----MENKPR-----KQQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDIKLLFLRFAMEQSFSADTGGGGRESNIHLIPYIIHTVL-YVLNTTRATSREEKNLQGFLEQPR---EKWTESAFDVDGPHYFTILALHVLPPEQWKATRVEILRRLLVASHARAVAPGGATRLTDKAVK--DYSAYRSSLLFWALVDLIYNMFKKVPTSN--TEGGWSCSLAEYIRHNDMPIYEAADKALKTFQEEFMPVETFSEFLDAAGLLSEITDPESFLKDLL 5190          

HSP 2 Score: 79.337 bits (194), Expect = 3.299e-107
Identity = 118/517 (22.82%), Postives = 217/517 (41.97%), Query Frame = 2
Query: 12392 SHSKHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYD--TRLARAKNNLVNVNESLFESNKIRQ------------NCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNLVSENEPAIEHKSSLIFPSMPVLCINQ-WLQDDSSQLFETWLQCTREENQIP-RDITLN------SDQGNVGLIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDSWRNGQARPGLSN 13876
            S S  ++  + QL  +Y  D K    E+  + ++++A++K +  YD   R A  K++  +V  + F +++ R              CY C  +  +  I L++ L+  P +RH + +   ++++        L   ++++R+E+  L+  +TRD  E   ++N LI  ++  AL+  + +    S ++  + LL  SI+  DS WELRLR A+++ L        + N    VV   I L+  C+R L   +K P    K N     +  +E  +++      +    Q WL+ D    +E W +C      +P R +  N      S+   + L +K+  RW      K+    +  +   ++       WL Q L + +  + RQA   +VE L      R + VL +L   L           D+L                      E + +Y+AL ++L    HW+ YL  +  L  + +L    + + LA  E +     + G A   L+ 
Sbjct: 3798 STSASVNRYILQLAQEYCGDCKNSFDELSKIIQKVFASRKELLEYDLQQREAATKSSRTSVQPT-FTASQYRALSVLGCGHTSSTKCYGCASAVTEHCITLLRALATNPALRHILVSQGLIREL----FDYNLRRGAAAIREEVRQLMCLLTRDNPEATQQMNDLIIGKVSTALKGHWANPDLASSLQYEMLLLTDSISKEDSCWELRLRCALSLFL-------MAVNIKTPVVVENITLM--CLRILQKLIKPPAPTSKKN----KDVPVEALTTVKPYCNEIHAQAQLWLKRDPKASYEAWKKC------LPIRGVDGNGKSPSKSELHRLYLTEKYVWRW------KQFLSRRGKRTTPLDLKLGHNNWLRQVLFTPATQAARQAACTIVEALASVP-SRKQQVLDLLTSYL-----------DEL------------------SVAGECAAEYLALYQKLIASCHWKVYLAARGVLPYVGNLITKEIARLLALEEATLSTDLQQGYALKSLTG 4254          

HSP 3 Score: 253.062 bits (645), Expect = 4.637e-65
Identity = 190/734 (25.89%), Postives = 339/734 (46.19%), Query Frame = 2
Query: 5642 TVGKNKQMKEAFKSVRTSEKISERVTTIMGSSIQLRNAEAPSDMSGIPPTSVLASEIAGANSHVRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNE---AEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKV--------QRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQEFLRSKESSKTKIQNKSSSNMEG 7807
             VG + + ++A   + T +K+ E    +M  +  L + E   +       +V  +        +R ++ +  +RR  + V+S   G    +  LAV+ +K +I + ++S LL++                   D   ++  + ++ +  +PFTVLS+  NP  + Y+AVCGLK+  VL F+S GS+S   V+ P L   N FII ++WLPGS   L ++    V+I+DLS     P ++F    S+ +D TF F          + E K+   +++MS +G ++ + +++   A  G FY+  +L+ N E     +D  + V G GG S++Y H LQ+LF SY+ G++F + +     E+   + + ++I++    ++    L  W  + +HPGL+  + Q T  P+ + V+P+ +  Q ++                        T P +  ++D + +        QRT  ++L  DG ++I MAN+ + +    +WLQ                       P+L+   + S      KR      I    SS    P+DFFEH +Q  +V FGG+  L++Y+ + +  R+ S    V+       ++ I+N     ++ G+RI I      + P Y EI+ R + +   L+++R  D    + E L  D+ L+L IG S +   + +ID VK++ + K    W +E  E   S   S     N + SN  G
Sbjct: 1831 AVGSSSRAQQALSELHTVDKVVEMTDQLMVPT--LGSQEGAFE-------NVRMNYSGDQGQTIRQLISAHVLRRVAMCVLSSPHG---RRQHLAVSHEKGKITVLQLSALLKQ------------------ADSSKRKLTLTRLASAPVPFTVLSLTGNPCKEDYLAVCGLKDCHVLTFSSSGSVSDHLVLHPQLATGN-FIIKAVWLPGSQTELAIVTADFVKIYDLSVDALSPTFYFLLPSSKIRDVTFLF----------NEEGKN--IIVIMSSAGYMYTQLMEEASSAQQGPFYVTNVLEINHEDL---KDSNSQVAG-GGVSVYYSHVLQMLFFSYSQGKSFAATVSRSTLEVL--QLFPINIKSSNGGSKTSPALCQWSEVMNHPGLVCCVQQTTGVPLVVMVKPDTFLIQEIK------------------------TLPAKAKIQDMVAIRHTACNEQQRTTMILLCEDGSLRIYMANVENTS----YWLQ-----------------------PSLQPSSVISIMKPVRKRKTAT--ITARTSSQVTFPIDFFEHNQQLTDVEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTMEISNNSSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLN--LSRSRWFDFPFTREEALQADRKLNLFIGASVDPAGVTMIDAVKIYGKTKEQFGWPDEPPEDFPSASVSSVCPPNLNQSNSTG 2460          

HSP 4 Score: 174.481 bits (441), Expect = 2.435e-41
Identity = 117/439 (26.65%), Postives = 212/439 (48.29%), Query Frame = 2
Query: 10880 QEAKLCRALTSKM----DNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHLLTKYPNWERIESFSHQLTNDIVQSSQELLSNSC-TPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEY-DCFTGSVSNSDNVKCPRCHSASIQGN--VCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITS 12160
            QE +LC AL +++    D   L +F++ +L E   S VRW    +  ++Y +   A +  LL+ +   W    ++   + Q  DL+G+   K    E+      Q   +I+++   +L+N   +  YN L  LV+  GYYL+S+PC VC  P                           +    +  +S  +        + R   T  V  L   ++I  +TVK    +R +    + LYY++ +  +  ++ ++   W K K V ++    E+K+D P+ + A  L+ E+ D +    ++++ ++CPRC SAS+  N  VC NC +N+ QC +CR+INY   D F+C  C  C+Y R DF ++AKPC   ++ +++EE R+  ++ I T  +  ++   +++  + +LE  L   K+ +AA    Q+    +  I+S
Sbjct: 3398 QEDQLCTALVNQLNRFADKETLIQFLRCFLLESNSSSVRWQAHCLTLHIYRNSNKAQQELLLDLMWSIWPELPAYGRKAAQFVDLLGYFSLKTAQTEKKLKEYSQKAVEILRTQNHILTNHPNSNIYNTLSGLVEFDGYYLESDPCLVCNNPE--------------------------VPFCYIKLSSIKV--------DTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTINLYYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFADFYENYQASTETLQCPRC-SASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAKPCCA-VDPIENEEDRKKAVSNINTLLDKADRVYHQLMGHRPQLENLL--CKVNEAAPEKPQEDSGTAGGISS 3798          

HSP 5 Score: 126.716 bits (317), Expect = 6.993e-27
Identity = 64/142 (45.07%), Postives = 86/142 (60.56%), Query Frame = 2
Query: 4778 NDFNMNQLSID--KRAIEEILFCQVKHNPNFGENDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHASQS 5197
            N    + LS+D  +RAIE         + ++ E   +  E  + +    + L ++LCTF  TQKEF +QHWYHCHTC MV+  GVCT+CAKVCH  H+++YAK GSFFCDCGAK    C AL +RT  + +S   +  A QS
Sbjct: 1615 NGQGPSHLSVDGEERAIEV--------DSDWVEELAVEEEDSQAEDSDEDSLCNKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCLALVKRTPSSGMSSTMKESAFQS 1748          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. UniProt/SwissProt
Match: sp|Q29L39|POE_DROPS (Protein purity of essence OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=poe PE=3 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 5.382e-85
Identity = 257/983 (26.14%), Postives = 478/983 (48.63%), Query Frame = 1
Query: 13936 EIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESL----RKEVPLEH-YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDY--IHKNSRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQ----ILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDALKEGIKLDLKRPDTIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPHP-DNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMS--------KWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQ--IQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVLTEL 16797
            E P I   Y+T ++  +L S L +R L+V R++   + + +  + +++++  +EE  R+F++I +  +++  + D+++   I E++ + I P +++   F + L+    QEDFL  RM+G    S   G  P + DV N +  +  + +    D  ++L+ + K++  DL ++D+Y+ VWL    +  +  MR+  R+ GL+ D    +VE+L    ++ V  E  Y+ +N L +  G+  +++R+ ++  ++    +I   ++L    +KV      L +P +  +  LL+ L +CL+   D  +    E+  ++ ++  L          S  Q +      E + A+    D   +  N  V    +H+ ++ A L +    +M L+ +    HF+  +     D+ +       L   C L + I  +  G   + +++  G++   + ++   AP       +K  L R D+    E  +   L  + +   G +   EA Q+ ++   ++  +H+LE V S + +G L+E+ L AL   +A   +V   +R  T+   +  A+  R+KQL+ + M  N+KGQV    S+L+ +     +E G  C IC +GY  +P++ LG+YTF K+  V +      + +           YT+V+++  VH  CH  A+++    +EW  A   N N +CN L+P+ GP   +  F A++ R+ + +  +T   +I+Y   +HDLK LL+RFA  R F++D GGG   SN+  VP ++  +I  L+S           ++        KWLE             ++     Y I   +  HSRELW +H+V  LK +L  A  RH++ + + +  + PA  +   YS+Y P+L+++ +I   YNIL K VT      +AW  ++  Y R+ND A+L  ++ ++    + LLPC S  EF DV  L   I   + ++  +L  L
Sbjct: 4435 ECPNIRRTYKTRLLGPVLESYLALRSLVVQRTRHIDEAQEKLLEMLEEMTSGTEEETRAFMEILIDTVDKTRMNDIKTPVFIFERLYSIIHPEEHDESEFYMTLEKDPQQEDFLQGRMLGNPYPSGEMGLGPLMRDVKNKICTDCELIALLEDDNGMELLVNNKIISLDLPVKDVYKKVWLAEGGDRDA--MRIVYRMRGLLGDATEEFVETLNNKSQEAVDTEQLYRMANVLADCNGLRVMLDRIGSLQRISRQRELIQVLLKLFLICVKVRRCQEVLCQPEIGAINTLLKVLQMCLQSENDSIQSAVTEQ--LLEIMETLLSKAASDTLDSFLQFSLTFGGPEYVSALISCTDCPNVRNNPSV---LRHLIRVLAALVYGNEVKMALLCE----HFKDTLNFKRFDNERTPEEEFKLELFCVLTNQIEHNCIGGTLKDYIVSLGIVERSLAYITEHAP------CVKPTLLRTDSDELKEFISRPSLKYILRFLTGLSNHHEATQVAIS-KDIIPIIHRLEQVSSDEHVGSLAENLLEALSTDAATAARV-QQVRDFTRAEKKRLAMATREKQLDALGMRTNEKGQVTAKGSILQKIEKLR-DETGLTCFICREGYACQPEKVLGIYTFTKRCNVEEFELKSRKTIG----------YTTVTHFNVVHVDCHTSAIRLTRGRDEWERASLQNANTRCNGLLPLWGPSVLETTFSASMTRHSSYMQESTQRCDISYTSSIHDLKLLLVRFAWERSFHDDAGGGGPQSNMHFVPYLLFYSIYMLLSSRSAARDSKTVLAYLTAPPSEKWLECG-----------FEVEGPLYMITISVTLHSRELWNKHKVAHLKRMLAVAQARHVSPSVLCKALLAPADRQVKDYSVYKPYLMMWAMIDMIYNILFKLVTMP--KEEAWPVSLFDYIRKNDEAMLKSTDGILHILTEELLPCTSFGEFCDVAGLLTLIEQPDSFIEDLLASL 5374          

HSP 2 Score: 28.8758 bits (63), Expect = 5.382e-85
Identity = 16/51 (31.37%), Postives = 25/51 (49.02%), Query Frame = 2
Query: 13676 NETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEES 13828
             E S +Y+AL + +  E  W  YLV++  L +I  L  + + K     E S
Sbjct: 4362 GEASNEYLALYRSIATESPWLQYLVLRGVLCKISSLLATEIAKVHCMEEHS 4412          

HSP 3 Score: 263.077 bits (671), Expect = 5.017e-68
Identity = 200/726 (27.55%), Postives = 344/726 (47.38%), Query Frame = 2
Query: 5831 VRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNEAEFDC------------TLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKILMANIRSPNSDGRFWLQER---FTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQEF--LRSKESSKTKIQNKSSSNM-EGLN------KCIGHI--ITNCKINL----STINPYLPKPELLSSGLQLL 7915
            ++ +L SG +RR     +S   G    +  LAV+ +K ++ I ++S LL++                   D   ++  + Q+ +  +  TVLS+ ANP N+  +AVCGLKE  VL F+S GS +   V+ P LE+ N F+  +MWLPGS   L ++ T  V+I+DLS  T  P Y++     + KD TF +     +GS          ++L  + SG I+ ++LD+  +A  G FY+   L+ +   +   +D+   V G GG SI+Y H LQLLF+SY  GR+FCS L +  +   V   Y++DI N A                +LV W  +  HPGL+ A    +N+PV + + PE+   Q + K++++++ I D+       +  ++    +TTL           ++L  DG ++I  A     +    FWL  +   F N   +  L    ++  P   +       + K    K    + +  L +      P+DFFEHC    +V FGG+  L++Y+++ L  R+ S    V+       +L + N  P+ ++VG R+ +   D  + P    I  R IP    + K R  DI L + E+  +DK L ++   S++   + ++D ++V+ + K  + W ++ ++     S  +  T  Q  +++N  EG N      + + H+  + +C ++L    +   P   K    +SGL LL
Sbjct: 2045 IKHLLTSGTIRRVAFCCLSSPHG---RRQQLAVSHEKGKVTILQLSALLKQ------------------ADASKRKLTLTQLSSAPIACTVLSLAANPCNEDCLAVCGLKECHVLTFSSSGSTNEHIVITPQLENGN-FLKKAMWLPGSQTLLAIVTTDYVKIYDLSVDTISPKYYYLVAVGKIKDCTFMYHQQDGSGSY---------FMLSFTSSGYIYTQQLDQQSLAVHGDFYVTNTLELS---HQHIKDINGQVCG-GGVSIYYSHALQLLFYSYTCGRSFCSPLTNVNEG--VKGIYHLDINNTAASTASKSSSASKVPLQSLVGWTEVAGHPGLIYASMHTSNNPVILMITPERIYMQEI-KAQSAKSRIMDVV-----GIRHSVAGTEKTTL-----------LLLCEDGSLRIFSAQPEHTS----FWLSPQVQPFGNQLYSSTLLAKNTTNNPQGKSKGGGSAAAGKLLHRKASSQQHQKQLTSGGQPIFPIDFFEHCNMLADVEFGGNDLLQIYNKQKLKTRLFSTGMFVASTKATGFTLEVVNNDPNVVMVGFRVMLGTQDIQRAPVSVTILGRTIPTT--MRKARWFDIPLTREEMFQSDKMLKVVFAKSQDPEHVTLLDSIEVYGKSKELVGWPDDSEDVPAPSSGPTPVTATQQSAAANFGEGFNCITQLDRMVNHLLEVLDCALHLLGGSAVAAPLRSKVVKTASGLLLL 2710          

HSP 4 Score: 179.874 bits (455), Expect = 6.378e-43
Identity = 111/399 (27.82%), Postives = 203/399 (50.88%), Query Frame = 2
Query: 10922 NTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHL-LTKYPNWERIESFSHQLTNDIVQSSQELL-SNSCTPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEYDCFTGSVS-NSDNVKCPRCHSA-SIQGNVCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQI 12094
            + ++  FV+++L E+  S +RW   + ++ L+ H     R  LL    + W    ++   + Q  DL+G+L LT     ER+  F  +   +++++  ELL  +   P Y  L+ ++++ GYYL+SEPC VC  P              P  N +                 +  S++ Y T       T  ++ L   ++I  + V+    +R +    + +YY++ S  +  ++ ++  LW K ++V++     E+K+DFP+ +TA  L+ E+  F  +VS +S+N++CPRC +A      VC NC +N+ QC +CRAINY   D F+C +C  C+Y + DFSM+A+ C   ++ ++S E R   +  I T  E  ++   +++  KQ LE+ + ++
Sbjct: 3591 DALIIRFVRIFLLENNISQLRWQAHSFMTGLFEHANERQREKLLTIFWNLWPLVPTYGRRTAQFVDLLGYLTLTTRSITERLPEFVSRAV-EVLRTQNELLCKHPNAPVYTTLESILQMNGYYLESEPCLVCNNPEV------------PMANIK---------------LPSVKSDSKYTT-------TTMIYKLVQCHTISKLIVRIADLKRTKMVRTINVYYNNRSVQAVVELKNRPALWHKARSVSLQSGQTELKIDFPLPITACNLMIEFADFFETVSGSSENLQCPRCSAAVPAYPGVCGNCGENVFQCHKCRAINYDEKDPFLCHSCGFCKYAKFDFSMYARVCCA-VDPIESAEDRAKTVLMIHTSLERADRIYHQLLANKQLLELLIQKV 3953          

HSP 5 Score: 129.413 bits (324), Expect = 1.124e-27
Identity = 54/97 (55.67%), Postives = 74/97 (76.29%), Query Frame = 2
Query: 4871 NDLINSESEEEKIMKLN-----PLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRR 5146
            +DL +  +EEE+   L+      L+++LCTF+ TQKEF +QHWYHCHTC+M+   GVC++CA+VCH GHD++YAK G+FFCDCGAK    C+AL+RR
Sbjct: 1789 DDLYDELAEEEQDSLLDDSDEDTLNNKLCTFSQTQKEFMNQHWYHCHTCNMINTVGVCSVCARVCHKGHDVSYAKYGNFFCDCGAKEDGSCQALSRR 1885          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. UniProt/SwissProt
Match: sp|Q9VLT5|POE_DROME (Protein purity of essence OS=Drosophila melanogaster OX=7227 GN=poe PE=1 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 9.713e-83
Identity = 264/987 (26.75%), Postives = 490/987 (49.65%), Query Frame = 1
Query: 13936 EIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESL----RKEVPLEH-YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAG---SITQQNHMINQVENMHAIPILLDY--IHKNSRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQ-----ILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDALKEGIKLDLKRPDTIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMS--------KWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQ--IQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVLTEL 16797
            E P I   Y+T ++  +L S L +R L+V R+++  D + +  + ++D++  +EE  R+F++I +  + +  + D+++   + E++ + I P +++   F + L+    QEDFL  RM+G    S   G  P + DV N +  +  + +    D  ++L+ + K++  DL ++D+Y+ VWL    +  +  MR+  R+ GL+ D    +VE+L    +++V  E  Y+ +N L +  G+  ++ER+ ++  ++    +I   ++L    +KV      L +P +  +  LL+ L +CL+   D  +    E+     L+ ++  IL+   +    S  Q +      E + A+    D   +  N  V    +H+ ++ A L +    +M L+ +    HF+  + N +  DN++       L   C L + I  +  G   + +++  G++   + ++   AP       +K  L R D+    E  +   L  + +   G +   EA Q+ ++   ++  +H+LE V S + +G L+E+ L AL   SA   +V   +R  T+   +  A+  R+KQL+ + M  N+KGQV    S+L+ +     +E G  C IC +GY  +P + LG+YTF K+  V +      + +           YT+V+++  VH  CH  A+++    +EW  A   N N +CN L+P+ GP   +  F A + R+ + +  +T   +I+Y   VHDLK LL+RFA  R F++D GGG   SN+  VP ++  ++  L+S           ++        KWLE    G +V +  L+ AT +       L  HSRELW +H++  LK ++  A  RH++ A + +  + PA  +   Y++Y PFL+++ ++   Y+ L K V S+P   + W  ++  Y R+ND ALL  ++ +++   +  LPC S  EF DV  L + I   ++++  +L  L
Sbjct: 4376 ECPNIRRTYKTRMLGPVLESYLALRSLVVQRTRLIDDAQEKLLEMLEDMTSGTEEETRAFMEILIDTVEKTRMNDIKTPVFVFERLYSIIHPEEHDESEFYMTLEKDPQQEDFLQGRMLGNPYPSSEMGLGPLMRDVKNKICTDCELIALLEDDNGMELLVNNKIISLDLPVKDVYKKVWLAEGGDRDA--MRIVYRMRGLLGDATEEFVETLNNKSQEQVDTEQLYRMANVLADCNGLRVMLERIGSLQRISRNRELIQVLLKLFLICVKVRRCQEVLCQPEIGAINTLLKVLQMCLQSENDSIQSAVTEQ-----LLEIMETILSKAASDTLDSFLQFSLTFGGPEYVSALISCTDCPNVRNNPSV---LRHLIRVLAALVYGNEVKMALLCE----HFKDTL-NFNRFDNERTPEEEFKLELFCVLTNQIEHNCIGGTLKDYIVSLGIVERSLAYITEHAP------CVKPTLLRTDSDELKEFISRPSLKYILRFLTGLSNHHEATQVAIS-KDIIPIIHRLEQVSSDEHVGSLAENLLEALSTDSATAARV-QQVRDFTRAEKKRLAMATREKQLDALGMRTNEKGQVTAKGSILQKIEKLR-DETGLTCFICREGYACQPDKVLGIYTFTKRCNVEEFELKSRKTIG----------YTTVTHFNVVHVDCHTSAIRLTRGRDEWERASLQNANTRCNGLLPLWGPAVGEAAFSACMTRHSSYMQESTQRCDISYTSSVHDLKLLLVRFAWERSFHDDAGGGGPQSNMHFVPYLLFYSVYLLLSSRSAARDSKTLLTYLQAPPSEKWLE---CGYEV-DGPLFMATIS-------LSLHSRELWNKHKLAHLKRMIAVAQGRHVSPAVLCKALLAPADRQVKDYTVYKPFLMMWALVDLIYDNLFKTV-STPKE-EDWPISLFDYLRKNDEALLKSTDSILQTLTEEFLPCTSFVEFCDVAGLLHLIEHPDNFIEEILAAL 5315          

HSP 2 Score: 255.758 bits (652), Expect = 8.326e-66
Identity = 178/642 (27.73%), Postives = 310/642 (48.29%), Query Frame = 2
Query: 5831 VRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVL---DSGQDEIY-VDKNYYVDIRNEAEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQE 7741
            ++ +L SG VRR     +S   G    +  LAV+ +K ++ I ++S LL++                   D   ++  + Q+ +  +  TV+S+ ANP N+  +AVCGLKE  +L F+S GS +   VV P LE+ N +I  ++WLPGS   L ++ +  V+I+DL+  T  P Y++     + +D TF +                +  +L  + SG I+ ++LD+  +A  G FY+   L    EL + +     G +G GG SI+Y H LQLLF+SY+ GR+F S L     G   IY +D N      ++      LV W  +  HPGL+ A  Q +N+P+ + + PE+   Q + K++++++ I D+       +  A+    +TTL           ++L  DG ++I  A     +    FWL  +    F N+    T  +      +      ++     + R  ++ +           P+DFFEHC    +V FGG+  L++Y+++ L  R+ S    V+    N  +L + N  P+ +IVG+R+ I   D  + P+   I  R IP P  + + R  DI L + E+L +DK L ++   + +   + ++D ++V+ + K  + W +E ++
Sbjct: 2014 IKHLLSSGVVRRVAFCCLSSPHG---RRQQLAVSHEKGKVTILQLSALLKQ------------------ADASKRKLTLTQLSSAPIACTVISLAANPCNEDCLAVCGLKECHILTFSSSGSTNEHIVVNPQLENGN-YIKKAVWLPGSQTLLAVVTSDYVKIYDLAVDTYSPKYYYLVAVGKIRDCTFVY-------------QDGNYNMLTFASSGYIYTQQLDQQSLAVHGDFYVTNTL----ELSHQHIKDIAGHIGGGGVSIYYSHTLQLLFYSYSCGRSFFSPLTNVSEGVKGIYHLDTNSASKSASKGPLQ-PLVQWTEVTGHPGLVYASMQTSNNPIILMITPERIYLQEI-KAQSAKSRIMDVV-----GIRHAVAGVEKTTL-----------LLLCEDGSLRIFSAQPEYTS----FWLSPQ-VQPFGNQLYSSTLMAKGGGSGSTSKSKSNTASGKMTSRKASQQQKQPTAGGQPVFPIDFFEHCNMLADVEFGGNDLLQIYNKQKLKTRLFSTGMFVASTRSNGFTLEVINNDPNVVIVGIRVLIGTQDVQRAPQSVTILGRTIPTP--VRRARWFDIPLTREEMLQSDKLLKVVFAKAPDPEHVTLLDCIEVYGKSKELVGWPDESED 2591          

HSP 3 Score: 216.853 bits (551), Expect = 4.231e-54
Identity = 255/1093 (23.33%), Postives = 465/1093 (42.54%), Query Frame = 2
Query: 9113 DNADDQRMLDYALRKSLEDQGGSSND--------ANIEG-------------------GAASN--ISQIFLDSRSLRTDPISSIYTEEEQQSLNNTGTPTIDNWGMNKTNKKNSKQAENLSTP-------DREYSESNSESDIATYAMLKNASITSKLSPNNSQKVFLVCIQKFGIQFIKRIIVKWSSLMISLQGTRVITLYKSVLDVIRYMDMRDEEARSVVQNLVELMLDLVLGIKKDDDQLTILEYDTNEKRIHCQSICVVLRTLLNFILSGSKIQ---TIVPPIKEDNNSTAAEGKPTPSSCFNQVFTQDSVAFITLKLAYEKKLISFCLLNLDQLLILWRNQSPDQKNSEKELDTSNKILKQNLTSNQGF------------DVSVTF--DWLP-MSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLN----KQFSDHNVINRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLM-VNSVSLHETIGXXXXXXXXXXXXXXXXXXXXXXTASSNPPXXXXXXXXXXXXXXXXXDKNTQR-KSAGSAPEVNKQEAKLCRALTSKMD----NTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHL-LTKYPNWERIESFSHQLTNDIVQSSQELLSNSCTPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEYDCFTGSVSNS-DNVKCPRCHSA-SIQGNVCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKV-NNSAFITSGTNI 12172
            ++ADD+ ++D A+  SL+  GG +N         AN++G                   G + +   S +  D  +LRT P      E      + +G   +++ G       N     N S P       D+E    +  +     A+L   S +     N   K  L  +    I  ++ II    +  +   G + I L + +L +   ++  +E  + V+ +L+  ++D V   K+        +   NE R+        L +L   ++  +K +   T  PP +  +NS+                    VA  T  +  +     + L  L+ LL+ W+N   D   +   L  S         S  G             D+S+    ++L    DI  ++D   LLTE+I+RLPY +L+L            + D      +  +          LCE++ +N++  + +  R LL  + G+K  +R  RD H +      +K + N    K  + +N  N   L +D  ++L E + +C    + R  NW+ +C    + L  LM +    L + +   ++ LLQ A              +  PP G+  A     TSS +    T R KS  +    +K +   C     ++     + ++  FV+++L E+  + +RW   + ++ L+ H     R  LLN   + W    ++   + Q  DL+G+L L+     ER+  F  +  + + Q ++ L  +   P Y  L+ ++++ GYYL+SEPC VC  P              P  N +                 +  S++ Y T       T  ++ L   ++I  + V+    +R +    + +YY++ S  +  ++ ++  LW K ++V++     E+K+DFP+ +TA  L+ E+  F  +VS S +N++CPRC +A      VC NC +N+ QC +CRAINY   D F+C +C  C+Y + DFSM+A+ C   ++ ++S E R   ++ I +  E  ++N ++++  KQ LE+ + ++    A   SS + V +N A + S + +
Sbjct: 2936 EDADDEAIMDIAIALSLQQHGGDANALQSLQQGLANLQGIRQATAMAAAVNAAANVSLGGSDDDEGSNVATDGSTLRTSP-----AEPAGSGGSESGGSGVESIGGTSARSSNFGDHANASPPRQGSTKDDQEQPGPSGVAGSGGVAVLSAMSSSEDNEANEDDK--LSKLHDLRIAVLESIIQHLGTFDLC-NGLQAIPLIQVILMLTTDLNGNNERDQQVLHDLLTALVDYVEIGKRGAAARMETKCPGNEVRL-------ALLSLFGVLMGKTKSKQTGTTSPPHQFKDNSSF-------------------VASTTANVLSKSGAFVYALEALNTLLVHWKNVLGDPYAAGGGL-ASQSAQASGGASGPGVQLLKPIKHGPKPDISILIPHNYLKNYPDIFESYDG--LLTEIIVRLPYQILRLS------SAHPDNYDSGFCEAMTFT----------LCEYMMLNLNTLLRRQVRKLLMYICGSKEKFRMYRDGHSLDAHFRVVKRVCNIVSSKTGAPYNA-NPPMLSYDALVELTEHLRTCQEISQMRTGNWQKFCVVHEDALAMLMEIACYQLDDGVSPIIIQLLQAA------------VCNLPPPSGSKQAQPQPSTSSASGKLRTDREKSEDTDAYYSKFDPAQCGTFVHQIFRYACDALIIRFVRIFLLENNITQLRWQAHSFMTGLFEHANERQREKLLNIFWNLWPLVPTYGRRTAQFVDLLGYLTLSTRSITERLPEFVSRAVDVLRQQNELLCKHPNAPIYTTLESILQVNGYYLESEPCLVCNNPEV------------PMANIK---------------LPSVKSDSKYTT-------TTMIYKLVQCHTISKLIVRIADLKRTKMVRTINVYYNNRSVQAVVELKNRPALWHKARSVSLQSAQTELKIDFPLPITACNLMIEFADFFETVSGSSENLQCPRCSAAVPAYPGVCGNCGENVFQCHKCRAINYDEKDPFLCHSCGFCKYAKFDFSMYARVCCA-VDPIESAEDRVKTVSLIHSSLERADRNYRQLLTNKQMLELLIQKV----AEHRSSDRMVEDNMASVHSTSQV 3923          

HSP 4 Score: 128.257 bits (321), Expect = 2.865e-27
Identity = 48/74 (64.86%), Postives = 63/74 (85.14%), Query Frame = 2
Query: 4925 LDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRR 5146
            L+++LCTF+ TQKEF +QHWYHCHTC+M+   GVC++CA+VCH GHD++YAK G+FFCDCGAK    C+AL+RR
Sbjct: 1791 LNNKLCTFSQTQKEFMNQHWYHCHTCNMINTVGVCSVCARVCHKGHDVSYAKYGNFFCDCGAKEDGSCQALSRR 1864          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. TrEMBL
Match: A0A2C9K8S7 (UBR-type domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106052774 PE=4 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 1.052e-161
Identity = 262/958 (27.35%), Postives = 474/958 (49.48%), Query Frame = 1
Query: 13957 KYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLV----EDNMPYVES-----LRKEVPLEHYQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVP-LINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHK---NSRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDALKEGIKLD-------LKRPDTIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVK-VVNENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPL--PYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIEL 16743
            +Y+  +V C+L   L++R+L+V R+K+  D + +    +++L+  +E   + F+ + V  + ++P+ D +S   I E++ + I P + +   F ++L+    QEDFL  RM+G   SS   G  P + D+ N +  +  + +    D  ++L+ +KK++  DL ++D+Y+ +WL    + +  PM +  R+ GL+    ED +  ++S     + KE   + Y+ +N L E GG+  ++ERLA++ +L  G  ++   ++L +Y + V  N   L  P L+ + ++L  L + L    +++  T  +  T+   +++++  +L         +      Q  +   + ++LD I+     S   + Q  +  IP  LAF    +M  ++ +  P+ Q    +     +++  L C C++ S+I S+  G   ++ ++E G++   + +++  APE  +K  +  D       L +P     L          +    V S   +               LHKLE V S Q +G L+E+ L+ALK  +    K I  +R  T+   +  A+ VR+KQL  + MT N+KGQV   SS+LK +     EE G  C IC +GY  +PQ+ L +YTF ++  + D  S   +++           Y++V+++  +H  CH  AV+      EW  A   N N +CN L+P+ GP   ++ F + L R+   +   T + ++NY   +HDLK LLLRFA  + F+ED+GGG   SN+ LVP I+   +   I+     ++E + ++ +LE      + + +N  +A    Y     +   +   W + R +IL+ +L   H+R L   D  Q  P   +     YS Y   L+ FG+ ++F++ +   V    G    W  A+  + R ND  +LD  ++V+R Y++ LL CESL+EF DVI +
Sbjct: 4304 QYKNRLVGCVLNGYLSLRKLVVQRTKLIDDTQEKLLHMLEELTSGTESETKEFMSVCVQTVRKYPLDDYRSPVFIFERLCSIIYPEENDVTEFFLILEKDPQQEDFLQGRMLGNPYSSSEPGMGPLMRDIKNKICTDCELVALLDDDTGMELLVNKKIISLDLAVKDVYKKIWLPD--HGEGEPMPVLYRMRGLLGDATEDMINSLDSGSEDDIDKE---DVYRMANVLKECGGLEIMLERLASIKDLVLGKQLMVVLLKLFSYAVNVKVNRQHLTTPELNCINIMLVALNLALWS--EQEGATSTKGQTITEQMLHIMEVVLLEASEQPPEKYTEFSKQCGDKEQLLMMLDRINSPFVRSNPTVLQALMRLIP-FLAFGEDDKMEALLSHFKPYLQFDKFDEEHSQDEEIHLDCFCSIASAIESNANGMRLKNLILENGIVQTAVGYILKHAPE--IKTMLATDSDVWKEFLSKPSLSYVLRMLTGLCTKHVPTQTVISESCIP-------------ILHKLEQVSSDQHVGTLAENLLDALKS-NEQAAKKIEDVRQQTKTEKKRLAMAVRKKQLGALGMTTNEKGQVTVKSSVLKQMEDLK-EETGLTCCICREGYRYQPQKVLAIYTFSRRSNMEDYESKARKSVG----------YSTVTHFNVIHVDCHTAAVRHARGREEWESAALQNANTRCNGLLPLWGPQVQESAFASCLARHNNYLQECTGIRDLNYSYNIHDLKLLLLRFAQEKSFSEDSGGGGPQSNMYLVPFIMH-NVLYAINTTRASSREEKNLTSFLEMPA---QKWVENSGEAEGVLYSTALSMHILAPTKWKEIRKKILERILITGHIRALCPLDAQQNIPPLTDRTVQAYSTYKVLLIYFGLANAFFDKVFVKVQQ--GENVLWTKALFEFIRHNDKQILDLCDQVLRVYQEELLTCESLAEFIDVIGM 5220          

HSP 2 Score: 271.166 bits (692), Expect = 1.052e-161
Identity = 315/1356 (23.23%), Postives = 574/1356 (42.33%), Query Frame = 2
Query: 9941 VAFITLKLAYEKKLISFCLLNLDQLLILWRN------QSPDQKNSEKELDTSNKILKQNLTSNQGFDVSVTF--DWLPMSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLNKQFSDHNV---INRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETIGXXXXXXXXXXXXXXXXXXXXXXTASSNPPXXXXXXXXXXXXXXXXXDKNTQRKSAGSAPEVNKQEA-------KLCRALTSKMDNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCWS----FSYISPQLADLIGHLLTKYPNW--ERIESFSHQLTNDIVQSSQELLSNSCTPFYNCLQRLVKLPGYYLDSEPCSVCLPPS---STNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEY-DCFTGSVSNSDNVKCPRCHSASIQG--NVCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITSGTNISGLGTTKLPVSGGKTYAEVTGASAMDDSGLPAKSYRRIRRAAGGENEPEKESTKPPNVNPITTAETVKEEKKDSHSKHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAV-----ANYDTRLARAKNNLVNVNESLFESNKIRQNCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDM--QSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAV-LLEVSNNGPSSENCTKVVVAPCIALIQACMR-----FLVGKLKQPVLIKKPNLVSENEPAIEHKSSLIFPSMPVLCINQWLQDDSSQLFETW----------LQCTREENQIPRDITLNSDQGNVG--LIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDS 13840
            V++ T     +   I++CL  L  LL  W++      +  D   S  +       L +   S+   D+S  F   ++     D   D   LLTE++LRLPY + K+            SDD++I   + ++     KW  +L E++    +  + +  R LL  + G+K  YR +RD + I  ++ ++    NK   D       + I LP+D  L ++E +    +    RP NW++YC    + L +L+  S+ L E +   LL LLQ AL   +       TA SN    +   V S         K  +  SAG   E  +          +L R LT+ +D  +  +FV+ YL +   S  RW+   ++  +Y +     + N+L+ L   W     F   + Q  DL+G+ L K P+   +++  + ++    + + +Q L ++     YN LQ LV   GYYL+S+PC VC  P     T ++   + DS+ T                                      T  +  L   + I  I+++ +  +R +    + +YY++ S  +  ++ ++  LW K + V ++    E+K++FP+ + A  L+ EY D +    + ++ ++CPRC SAS+     VC NC +N+ QC +CR+INY   D F+C +C  C+Y + D ++ AKPC   ++ +++EE R+  I  I +  E  ++  +++ + +  LE  L Q+     AE                      G+ + P  G K   EV GA+      +P                          VN +  +  +  +K     K   D L+++I K     + + +E     R+  AA+  V     A     L+  K    ++++   E  K   NC+ C  + ++  I L++ L    D+R  + +   +K +   +L LG +      S+R E+  L+  +TRD ++   ++N L+ + +  A++    +    S ++  I LL +S+   DS WE R R  + + L+ +    P      + +  PC+ ++Q  ++     F+ GK K+     + N  +++ PA  H           + + +WL  D    ++ W           +   E  ++P          +    L++K+ ++W          K    ++  V        WL QA+ S S+ S RQ    ++E +  Q F R + V+ +L  CL           DD+ +                  + E + +++AL KRL  +  W+ YL IK  ++ + +L +S+ +  L  +EE+ L S
Sbjct: 3107 VSYKTANALLQSGTINYCLQVLINLLPYWKDFNLEDVRVVDPGTSADDPANLPGQLLKPYPSHPPPDMSPFFLRQYVKGHASDVFQDYPQLLTEMVLRLPYQLKKI------------SDDQKIQGAVFDT-----KWKELLSEYMLTQQTPFVKRQVRKLLLFICGSKEKYRQLRDDYTIQSNLLQMTQTCNKSGLDTGADLAPHSIILPYDTLLTMIEHLKILCDIATSRPYNWQMYCKLKQDTLPYLIQASILLDEGVAPTLLQLLQCALCGVKGHGH---TAGSNSSSTSPIKVKSKKEKETVKIKTDELDSAGKKTEGEETRPFDENLCRELVRQLTATLDKNLFIKFVRTYLLDSNSSSNRWMAHGLVLQIYRNSNEEEQQNVLDLLWGLWHEVPVFGRKAAQFVDLLGYFLLKTPSLPDKKVTEYLNKAVTLLKEENQLLANHPNATIYNMLQGLVDFDGYYLESDPCLVCNNPEVPFQTLKLSAVKVDSKFTT-------------------------------------TTQIVKLVGSHIISKISLRISDLKRTKMVQTMNIYYNNRSVQAVVELRNRPGLWHKARKVRLTSGQTEVKIEFPIPIVACNLMVEYADFYDNLQATAETLQCPRC-SASVPASPGVCGNCGENVYQCHKCRSINYDEKDPFLCNSCGFCKYAKFDLTLTAKPCCA-VDPIENEEDRKKAITSINSLLEKADRIYKQLQLHRPVLESLLIQV-----AEH---------------------GSDRPPTVGAK---EVNGATG----AVP--------------------------VNNVNKSIQLLAQKYCGECKAAFDELSKIIQKVMA-CRRELVEYDQQQREAVAARGQVPIPTGAKAKIGLSETKCLKSSISKEKKECLKT-GNCFGCASAAVEHCITLLRALVTNADMRQILCSQGMIKQLIDYNLRLGSL------SVRHEVRTLLCLLTRDNRKGTEEMNNLVMTRITSAIKGHQSNPDLGSSVRHEIMLLATSLHQDDSCWEQRTRCVMRLFLMGIRMVNPV---IMESITLPCLRILQGLVKQDLVSFINGKRKE----AEKNTSADSMPAKFH-----------MDVKKWLAGDPRYSYQNWKRRLPKPAFFTELLSEPKKLPYKPETEKKHNSRAEYLMEKYVAKW----------KQNMWRVPAVTLKLTQTTWLQQAMFSPSSRSARQTACSVIEAIS-QIFSRRKEVIDMLTSCL-----------DDVGR------------------SGECATEFLALYKRLINQDKWKYYLAIKGVMLHLAEL-ISKEVDHLQYLEETTLSS 4277          

HSP 3 Score: 254.603 bits (649), Expect = 5.175e-63
Identity = 195/710 (27.46%), Postives = 342/710 (48.17%), Query Frame = 2
Query: 5831 VRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLK--TGVL-GKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRN-----EAEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQEFLRSKESSKTKIQNKSSSNMEGLNKCIGHIITNCKINLSTIN--PYLPKPELLSSGLQLLTAFF 7927
            +R ++ +  +RR  + V+S  +G    +  LAV+ +K ++ I ++S LL++                   D   K+  + ++ +  +PFTVLS+  NP N+ Y+AVCGLK+  V+ FTS G+++   V+ P L   N FII ++WLPGS   L +I +  V+I+DL      P Y+F     + KD TF F          S E+++   +++M+ +G I+ + LD++ +A  G FY+  +++        + DLK  TG L G GG S++Y H LQL+F SY +G++F + +   +D   V   + +  ++     ++     LV+W  +  H GLL  + Q TN+P+ + ++PE    Q ++             + S +K+ D +      +  D+    RT  ++L  DG ++I MAN+ + N    +W+                     P  P   L  +   K   S R          NSS    PVDFFEHC+ +N+V +GG+  L++Y+ + +  R+ +    ++    N  ++ ITN    ++ VG+RI +      + P Y E++ R+I + +   + R  DI   + E L  DK   +  G S++ N + ++D VKV+V+ K +  W  E ++F      + TK+   S +N            T+ +++ S +   P      LLSS L++L   F
Sbjct: 1879 IRQLITAHMIRRVAMCVLSSPQG---RRQHLAVSHEKGKMTILQLSALLKQ------------------ADSSKKKLTLTRLSSAPVPFTVLSITGNPCNEDYLAVCGLKDCHVVTFTSSGTVADHLVLHPSLATGN-FIIKAIWLPGSQTELAIITSDFVKIYDLGVDAISPQYYFLLPSGKVKDVTFIF----------SDESRA---MVLMASTGYIYTQTLDESSLAKHGPFYITNVMEVK------HADLKDTTGQLAGGGGVSVYYSHALQLVFFSYASGKSFAAPV--AKDLSTVTNLFPITFKSSNGGGKSSNSQPLVSWSEVPGHTGLLYCMAQTTNNPIVLMIKPEVIIVQEIK------------VLPSKAKIQDVVAIRHPASNSDQ---HRTTMILLCEDGSLRIYMANVEATN----YWMSPNLQ----------------PKSPISVLKPVKKKKIVKSGR---------SNSSIS-FPVDFFEHCQHSNDVEYGGNDILQVYNTQQVKNRLNTSGLYIASTKPNGFTMEITNTNNSTVPVGIRIFVGSQTVERAPSYVEVFRRQIQL-QLNMRARWFDIPFTREESLTADKKFDIFFGCSQDPNSVTMVDSVKVYVKTKETFGWPEEPEDFPEPSAPTPTKV-TPSCNNA-----------TSAEVDASPVAAVPLTGADRLLSSALEVLDGAF 2487          

HSP 4 Score: 135.576 bits (340), Expect = 4.575e-27
Identity = 60/108 (55.56%), Postives = 75/108 (69.44%), Query Frame = 2
Query: 4868 ENDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHAS 5191
            E +    +S+EE       L+++LCTF  TQKEF +QHWYHCHTC MV+  GVCT+CAKVCH  HDLTYAK GSFFCDCGAK    C+ALTRRT++  +   + +  S
Sbjct: 1638 EEESAGEDSDEET------LNNKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTMCAKVCHKDHDLTYAKFGSFFCDCGAKEDGSCKALTRRTSQGGLESTAPMSQS 1739          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. TrEMBL
Match: A0A553PBK6 (UBR-type domain-containing protein OS=Tigriopus californicus OX=6832 GN=TCAL_08578 PE=4 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 2.090e-146
Identity = 271/984 (27.54%), Postives = 476/984 (48.37%), Query Frame = 1
Query: 13948 IAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKS-RPMRLTVRISGLVEDNMP-YVESL----RKEVPLEH-YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVV-----PLINLLCRILTLGRAGSITQQNHM---INQVENMHAIPILLDYIHKNSRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQL-LIPNAHI--DDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDALKEGIKLDLKRPDTIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNT-NVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLI--NKEMQAM-----SKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFY-NILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVLTEL 16797
            I   Y+  ++  +L   L +RRL+V R+K+    + R  + ++D++  + E  +SF+ + V  + ++P  D  +   I E++   I P + +   F + L+    QEDFL  RM+G   SS      P + ++ N + R+  + +    D  ++L+ + K++  DL ++D+Y+ VWL  D ++ +  PMR+  R+ GL+ D    ++ESL    R++   E  Y+ +N + +  G+  I+ERL +V +  +   ++A  ++LL + IKV  N  +L++P L T+ +LL  L +CL  G      +    S+        ++ ++ ++L    A     Q ++    N VE      +L   I   S   L+Q  +  +P  LA+    +M LI+ +      L    N H   D+++ +  +  C+    I  ++ G   +  M+   +L  CI ++   AP  A        + + +   + E      L  + +A  G     E  Q+L+A    +  LH++E V S + +G L+E  L AL  C    +KV   +R  T+   +  A+ +R KQL  + +  ND GQV   SSLL+       EE G  C+IC +GY  +P + L +YTF     V +      + LP          Y++V+++  VH  CH  AV+ V + +EW  A   N N KCN L+P+ GP+  ++ F   L R+ T +   T N  +I YQ   HDLK LLLRFA +R F+E++GGG   SN+ LVP +I +A+  L +   L   +K ++A       KWLE           N + A    Y     L+  S + W   R++IL+ LL  AH+R ++      +   +     Y++Y   ++ F +I  F+ N+   +++    +   W   ++ + R+ND ALL  + +V+  ++++L+P  S+ E  DV  L  +IP    +L  +L+ +
Sbjct: 4357 IKGAYKGRLISTVLHGYLLLRRLVVQRTKLVDQTQERLLELLEDMTSGTVEETKSFMAVCVQTIRKYPKDDQLTPIFIFERLCNIIFPEETDTGEFFMTLEKDPQQEDFLQGRMVGNPYSSNDSDLGPLMREIKNKICRDCELVALLEDDNGMELLVNNKIISLDLPVKDVYQKVWLAEDVHDGAGEPMRIVYRMRGLLGDATEEFIESLESKDREDQDEEDVYKLANVMADCQGLEVILERLESVKDAQYSKQLLAVLLKLLGHCIKVKKNRSKLLDPSLKTIPILLGSLELCLASGETPSATSSVSSSSSGPSLSEQVLEIMEKLLVEAAANDDCIQAYVQFASNGVEPKTMDTLLEQAIRLKSGTNLHQSLMRVLP-FLAYGHDDKMALIVRHFADVMNLDRFDNEHTIEDESKMEAFVVMCD---GIERNKIGNTMKDQMISLDILGKCITYIKTHAPPLASV------MTKNENPLWKEFVTRPSLKFILRAMAGLAVEHEPSQMLIA-DNSIPVLHQMEQVSSDEHVGSLAEAVLEALGGCDQAQDKV-KAVRQQTKAEKKKLAMAMRAKQLKAIGLKTNDMGQVKADSSLLQQFGLA--EESGLSCNICREGYKYQPNKVLAIYTFTVPCPVEEF-----EYLPRKT-----MGYSTVTHFNLVHVECHTAAVRQVRSRDEWESALLQNANTKCNGLLPLWGPNVAESAFATWLARHNTYLSEATHNQRDIGYQSTTHDLKLLLLRFAEDRSFSEESGGGGPQSNMHLVPYLIHMALYVLNTTRSLPREDKNLKAFLDLPKEKWLE-----------NAYVAEGPLYYATLCLVMVSPKRWSSIRIKILQRLLLTAHVRSIHPRPPKTMTAEERSIKDYAVYKKIILFFALIDQFFSNVFSGSISRRTSSESDWPTQLAEWIRKNDDALLKATTRVLSTFQNDLMPACSVDEIVDVCGLLEDIPSPASFLLEILSNM 5305          

HSP 2 Score: 252.292 bits (643), Expect = 2.090e-146
Identity = 295/1265 (23.32%), Postives = 533/1265 (42.13%), Query Frame = 2
Query: 10187 LLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLNK----QFSDHNVINRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETIGXXXXXXXXXXXXXXXXXXXXXXTASSNPPXXXXXXXXXXXXXXXXXDKN---------TQRKSAGSAPEVNKQEAKLCRALTSK--------MDNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCWSFS----YISPQLADLIGHLLTKYPNWE-RIESFSHQLTNDIVQSSQELLSNSCTPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEYDCFTGSV-SNSDNVKCPRCHSASIQGN--VCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITSGTNISGLGTTKLPVSGGKTYAEVTGASAMDDSGLPAKSYRRIRRAAGGENEPEKESTKPPNVNPITTAETVKEEKKDSHSKHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYD-TRLARAKNNLVNVNESLFESNKIRQNCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNLVSENEPAIEHKSSLIFPSMPVLCINQWLQDDSSQLFETWLQ-CTREENQIPRDITLNSDQGN---VGLIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDSWRNGQARPGLSN 13876
            LLTE+ LRLPY + K         IE +  ++  ++        +S+WH +LCE++    +  + +  R LL  + G K  YR +RD+H +   +  I+ ++++    + S  +V + +   +D  L+L+E   +C++    R  NW+ +C + P +L FL   S  L + +   +L LLQ AL   +         + +PP+  +    +     + A +           + K+    P+    E K  RAL  +        +   +LA+FV+ +L E   S VRW   A++  L  +     +  +++     W+ S    + + Q  DL+G+   K    E ++ ++  +  + +   +Q L ++  +  YN L RLV   GYYL+S+PC VC  P     M                          L  +S  + +  Y T       T H+  L +  SI  I ++    +RQ+    + +YY++ S  +  ++ ++  +W + K V+++    ++K++FP+ + A  L+ EY  F  ++ ++S+ ++CPRC SAS+  N  VC NC +N+ QC +CR+INY   D F+C  C  C+Y + ++++  +PC   ++ +++EE R+  I+ I T  +  +K  +++I  K  LE  L               KV+   F               P+ GG + A V G S                   GG +          NVNP                      + QL  KYS + K    ++    +++ A +K +  YD  R    K      N  L  S+     CY C  + ++  + L++ L+  P IRH +     ++++    L   L   S  ++ E+  L+  +T+D       LN L+ +++   L            ++  +SLL  +I   D  WE RLR  + + L  +    SS    + V  PC+ ++Q+ +R +V K ++    K+  L   +   +E   S+       + +++W+  D  Q F+ W + C + +   P  +   +++ N   + L QK+  RW  +  +K            V    +  +WL + L + ++ S R+    LV+   +   ER R +L +L   L           DDL +                    E    + AL +RL     W+ YL I+  L +I DL M  + K   Q E +       G A    SN
Sbjct: 3277 LLTEMALRLPYQIKK---------IEDSQSEKSALV-------FDSQWHHILCEYMMTQQTPFVRRQVRKLLLYICGTKEKYRELRDVHSLESHMKAIQKIISQDVAEKTSHKHVRSVMNFSYDILLQLIEHFKACVDISATRTQNWQRFCLQNPSVLKFLFQISFILDDGVNPIVLQLLQNALCLPK--------VNPSPPIPVNIPNAAQRRLIRGAPRFRITRDPVPVAEDKARSEEPDEVVVENKADRALAVELVAQVNQVLQRNLLAKFVEKFLLECNASSVRWQAHALIVTLQGNSSLNEQQEVVDIFWQLWNQSPEHGHKAAQFVDLLGYFSMKTLTDETKVRAYIDEAVHILKTQNQILANHPNSNIYNSLSRLVDFSGYYLESDPCLVCNSPDVPYAM--------------------------LKLSSLKV-DTKYTT-------TTHIVKLSSSLSISKIALRIGDLKRQKMVRTINIYYNNRSVQAVVELKNKPTIWNRAKKVSLTAGQTDIKIEFPLPIVACNLMVEYADFYENIQASSETLQCPRC-SASVPANPGVCSNCGENVFQCHKCRSINYDEKDPFLCNACGFCKYAKFEYTLTCRPCCA-VDPIENEEDRKKAISGINTQLDKADKTYKQLIANKPNLETLL--------------LKVSECCFDD-------------PM-GGSSMATVGGLS-------------------GGSS----------NVNPY---------------------IQQLAQKYSGECKTLFEDLSKTIQKVMATRKELLAYDGGRRHGNKAKETTCNRDLLVSSG---KCYGCAAASVEHCLTLLRALAHQPKIRHVLYEKGLIEEL----LEYNLRRGSVPLQTEVRKLITYLTKDNFAATEHLNLLLFNKVKLILAGTRTYTDLVESLRHEMSLLAYTIQKEDQCWEERLRCVMRIFLLTTEYEKSSPIVMECVTFPCLKILQSLVRPVV-KFRRG---KENKLNDPSSCPLEGYDSV------AIDVHKWMDKDPEQSFQVWEKTCVKPKFAGPLPVPNKNNEDNSNELYLRQKYFRRWHERTFRKNA----------VPLQILPSSWLKRVLFNPTSGSAREVACHLVDNFCH-VHERKRDILDLLTTYL-----------DDLGQA------------------GEFGADFAALYQRLITTDQWKYYLAIRGTLSKIADLMMKEIEKLNRQEETTLSTDLAQGFALKTFSN 4346          

HSP 3 Score: 247.284 bits (630), Expect = 9.016e-61
Identity = 179/644 (27.80%), Postives = 308/644 (47.83%), Query Frame = 2
Query: 5831 VRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWN-PELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVL----DSGQDEIY-VDKNYYVDIRNEAEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQE 7741
            +R ++    +RR V++ +S   G+   + +L V+ +K +I+I +++ LL++                   D   K+  + ++ +  +PFTVL+  +NP+N+ Y+AV GLK+  VL     GS++   V+ P L D+N FII  +W+PGS   L L+    V+I++L +    P Y F     + +DAT AF+   T             Y+L+MS  G I+ + L    +A +G FY+  +L+ N PEL +      + +L  GG SI++ H L+ LF SY  G++F + L    D   D ++ + ++     +N +     L  W  + +HPGL+ A  Q TN+PV I V P+    Q             +I  ++ SK+ D +      +        RT  ++L  DG +K+ MAN             E FTN ++++                 +H + +   S   R     +I    +S    PVDFFE+C Q N+V FGG   L++Y+   L  R+ +    ++    N  +L +TN  P+ +IVGVR+ I   D  K P +FE++ R++     L++ R  D  L + E L  DK + +  G   + + + ++D V+V+ + K +  W  ++ E
Sbjct: 1938 IRQLMTGHMIRRVVMSCMS--SGLHERRQYLVVSHEKGKIVILQLAALLKQ------------------SDSSQKKLTLTRLSSAPIPFTVLATVSNPINEDYLAVTGLKDCHVLTLNLSGSVTDHLVLHPQL-DANNFIIKPIWMPGSQTELALVTADFVKIYNLGKDALSPEYFFLMPCGKIRDATLAFMDDGTR------------YILIMSSVGYIYYQALSDESLAQNGSFYVTSILEMNHPELAD-----SSPILLGGGVSIYFSHTLRSLFFSYVQGKSFMAPLRNIGDRAVDNVFKLSESKSGSGKNMSS--QVLCQWGEVPNHPGLVTAFYQSTNNPVLIMVRPDVISVQ-------------EIKASTKSKIVDMVVVRHFASTHQP----RTTMILLCEDGSLKLYMAN-------------EEFTNFWMDQ----------------RIHPMSALSLSKPPRKKKLPKIHRSANSLS-FPVDFFENCAQINDVEFGGVDVLQVYNVAQLKHRLNTSGLYIANTKPNGFNLEVTNNDPNQVIVGVRVMIGSQDLNKTPSFFEVFGRRMKTTP-LSQQRWFDFPLSREESLQADKKITIFFGSLLDVSGVTIVDSVQVYGKTKEAFGWPEDQDE 2493          

HSP 4 Score: 130.954 bits (328), Expect = 1.249e-25
Identity = 71/172 (41.28%), Postives = 96/172 (55.81%), Query Frame = 2
Query: 4871 NDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHASQSTSIDAIKKDKPSMKSQFFEKSKYNFQTRF-SKFSSNEKLLRKSYKADTKSRLTAHKMTAAADS 5383
            +DL + E   E+      L ++LCTF  TQK+F  QHWYHCHTC MV+  GVC+ICAKVCH  HD+TY+K GSFFCDCGAK    C AL+RR  +T   ++S    ++++ I+      PS+ S    +      +RF S  SSN    R       + R  A K+    +S
Sbjct: 1684 DDLPDDEDSGEEDSDDESLCNKLCTFTDTQKQFVQQHWYHCHTCKMVDGIGVCSICAKVCHADHDVTYSKCGSFFCDCGAKEDESCTALSRRDLQTQTRRRSD-DRNKTSMIEV----PPSLTSALRRREGDTSTSRFDSDISSNSSKKRDDDPTLKERRALAEKLAPWKES 1850          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. TrEMBL
Match: A0A0K2UE41 (Protein purity of essencelike [Megachile rotundata] OS=Lepeophtheirus salmonis OX=72036 PE=4 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 2.290e-127
Identity = 247/977 (25.28%), Postives = 472/977 (48.31%), Query Frame = 1
Query: 13939 IPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESLRKEVPLEH-----YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAG-SITQQNHMINQVENMHAIPILLDY-IHKNSRVELYQKHITKIPALLAFQFSHEMVLIIDY---VVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDALKEGIKLDLKRPDTIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPHP-DNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQAT----NTP--YRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVLTEL 16797
            +  I  K++  ++  +L   L++RRL+V R+K+    + +  + ++ ++  ++    +F+ + V  + ++PV D  +   I E++   I P + E   F + LD    QEDFL  RM+G   SS      P + +V N +  +  + +    D  ++L+   K++  DLL++D+Y+ +W  +   N+  PM++  R+ GL+ D    ++E+L  +   +      Y+ +  + E GG+  ++ERLA++ ++ +   ++   ++L ++ I++  N  +L+ P   T+ +LL CL            +++   S    ++  + R+L    AG SI+      +   +   I  LL + ++  S   L+ + +  +P  L +    +M L++ +   V+   +  I +   +D++ +  +  C+    I  ++ G   +  M++ G++N CI+++   AP        K  L + D   +        L  + +A  G        Q+ ++    +  LH++E V S + +G L+E  L A+K       KV+  +R  T+   +  A+ +R KQL  + +  ND+GQV   +S+L+       EE G  C+IC +GY  +P + L +YT+ K   + +  S   +          Q  Y++V+++  VH  CH  AV+   + +EW  A   N N KCN L+P+ GP   ++ + ++L R+   +   T   +I Y   VHDLK LLLRFA ++ F+ ++GGG   SN+ LVP ++ +A+  L +      +EM  ++ +L+Q         +N W  T    + P  Y ++  L+F S   W   R+++L+ LL  AH R  +            E   Y++Y   ++ F +I   Y+++  NV   P    +W  A+S + R ND  L   + K++  ++++L+P  S+ E  DV  L  +IP    +LS VL  +
Sbjct: 4149 VDQIKNKFKGRLISTVLQGYLSLRRLVVQRTKLVDQTQDKLLELLEIMTTGTKAESEAFMAVCVETIKRYPVHDQLTPVFIFERLCNLIYPEETEMGEFFMTLDKDPQQEDFLQGRMLGNPYSSNDPDLGPLMRNVKNKICADCELVALLEDDNGMELLVHNKIVSLDLLVKDVYQKIW--APEANEGDPMKVIYRMRGLLGDATEEFIETLDNKEGEDKDEEEVYKMAGIMAECGGLEVMLERLASIHDVQYSKPLLLVLLKLFSHSIRLKVNREKLLNPTYKTIPLLLNCLK---------LSLSDSNSSINEMILEAMERLLVEAAAGNSISNYCQFASNCVSTEDIQALLKHAVNLRSGTALHSRLMRVLP-FLTYGNDDKMELLLSHFSEVLEFDKFDIEHGADEDSKMETFVAMCD---GIERNKIGNTMKDLMVKSGIMNQCIEYIKVNAPAS------KTVLLKADDPFWKAFVTKPSLKYILRAMAGLAAKHPTTQLAVSSE-CISILHQMEQVSSDEHVGSLAESVLEAIKSHPDAFTKVVE-VRQRTKAEKKKLAMAMRAKQLKAIGLKANDRGQVKAENSILQQFVEIA-EESGLSCNICREGYKFQPYKVLAIYTYTKDCHLEEFESASRK----------QMGYSTVTHFNLVHVDCHLAAVRQARSRDEWDSALLQNANTKCNGLLPLWGPQVVESAYASSLARHNNYLAEATQHRDIGYHSTVHDLKLLLLRFAEDKSFSNESGGGGPQSNMHLVPYLMHMALYVLNTTRAASREEMN-LNSFLDQP--------KNQWVDTGYIPDGPIYYTVIALLVF-SPSSWKSVRIKLLQRLLLTAHTRSADPNHTGGNSLVDKEVKEYNVYKKMVLFFALIDQLYSVVFCNV---PTDKDSWPVALSEWIRHNDDTLTKSTLKLLNVFQEDLVPASSVVEIADVCRLLEDIPTPASFLSDVLNSI 5078          

HSP 2 Score: 202.601 bits (514), Expect = 2.290e-127
Identity = 215/993 (21.65%), Postives = 420/993 (42.30%), Query Frame = 2
Query: 10931 LAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCWS----FSYISPQLADLIGHL----LTKYPNWERIESFSHQLTNDIVQSSQELLSNSCTP-FYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEYDCFTGSV-SNSDNVKCPRCHSASIQGN--VCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITSGTNISGLGTTKLPVSGGKTYAEVTGASAMDDSGLPAKSYRRIRRAAGGENEPEKESTKPPNVNPITTAETVKEEKKDSHSKHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYD-TRLARAKNNLVNVNESLFESNKIRQNCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACP-DSLWELRLRPAIAV-LLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNLVSENEPAIEHKSSLIFPSMPVLCINQWLQDDSSQLFETW--------LQCTREENQIPRDITLNSDQGNVGLIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDS 13840
            L +F++ +L E   + VRW   ++L  ++ +   + + ++LN +   WS    F   + Q  DL+G+     LTK    +     S  +   I++S  E+LSN      Y+ L +LV   GYYL+S+PC VC  P   N                   ++  ++ + + T  T  S                +  L   +SI  I ++    +RQ+    + +YY++ S  +  ++ +++ +W K K VT+S    ++K++FP+ + A  L  EY  F  ++ ++++ ++CPRC S S+  N  VC NC +N+ QC +CR+INY   D F+C  C  C+Y + ++++  +PC   ++ +++E+  +  +  I +  E  +K  + +I  K  LE  L +I      E  + K   + A  +  T  S                 V  A+   + G                                T++  V      S S H++  +  L  KY ++ K    ++  + +++ A +K + +++  R A+      + + S    +     CY C  + ++  + L++ L+     R+ +     +K +        L   +S++R E+  L+  ITRD       LN+LI S++  A++   +S P           L ++     DS WE+RLR  + + +L +   G +S    + +  PC+ +IQ  +R   G  K    +                      S   + ++ WL++     FE W         + T++++   +++T + D  N  LI+K+  +W +      + +        +E   ++ +WL   L +SS+   RQ    +VE  G+ S +R   ++ +L   L  +                              T  E++ +YV L ++L  ++  + YL +K  L ++ DL +S+ +  L  +E++ L+S
Sbjct: 3292 LLKFIETFLLECNSTSVRWQAHSILVTIHRNSDQSGKEDILNIMWKLWSKLPYFGRKASQFVDLLGYFSMKTLTKEDKLQDHVYVSKAIA--ILKSQNEILSNHPNANIYSSLSQLVDFNGYYLESDPCLVCNNPEVPN-------------------RALKLSALKIDTKYTTSS---------------QIVKLSCSHSIGKINLRIGDLKRQKMVRVINIYYNNKSVQAVVELKNRSTIWHKAKKVTLSPGQTDIKVEFPLPIIACNLRIEYTDFYENIQASAETLQCPRC-STSVPANPGVCTNCGENVFQCHKCRSINYDEKDPFLCNACGFCKYAKFEYTLNTRPCCA-VDPIENEDDYKKAVTSINSLLEKADKVYRNLISNKPSLENLLAKI-----TESVNDKHPGDGAIDSFSTTAS---------------TSVANAANTGNIG-------------------------------TTSSNAVSSSTGSSSSNHVNQYIQTLASKYCSECKGSFEDLSKIIQKVMATRKELVSFENARKAKYVPGGTSKSPSTVGRSVSSGKCYGCAAATVEHCLTLLRALASKVRYRNELYQQGLIKQLMEYN----LRRGTSNIRLEVRKLICLITRDNLIATNHLNKLIFSKIGLAVKG-RISCPEIVESVRHEMSLLAATVSKEDSCWEVRLRCVLRIFILAIKQGGKTSPTVMECITLPCLKIIQGLVR-PKGTFKSKSSVMD--------------------SSSYIQVDDWLKNKPGYHFEDWENKLSIVDEKATKDDS---KNVTSSRDAKNTYLIEKYFKKWVS------IVRENKNHPKKLESTLLNASWLKSVLFNSSSQMARQVGCNMVE--GFCSGKRRLNIIDLLTSFLEEL-----------------------------GTAGESASEYVQLYQKLIGDEQVKYYLAVKGVLKKLADL-ISKEIDNLDHMEQTTLNS 4128          

HSP 3 Score: 254.603 bits (649), Expect = 4.916e-63
Identity = 183/666 (27.48%), Postives = 320/666 (48.05%), Query Frame = 2
Query: 5831 VRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWN-PELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYV-----------------DKNYYVDIRNEAEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAI-------TFPWRTTLEDKIKVQRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCG---KVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQE 7741
            +R ++    +RR V+  +S   G++G +  LAV+ +K +I I ++S LL++                   D   K+  + ++ +T +PF+VLS+ +NP N+ ++AV GLK+  VL F   G++S   V+ P LE SN +II ++W+PGS   L L+ +  V+I+DLS     P ++F     + +D T +F+   T             YVL+MS  G I+ + L +   A +G FY+  ++D + PE+ + + +     +G GG SI+Y H LQ LF SY  G++F + L S  +E+ +                   N   + ++       L  W  I  HPGL+ A  Q +N+PV + V+PE    Q             ++ V S SK+ D +       + P+     +    Q+T  ++L  DG +KI MAN  + +    +WL     N  +N             MP L  + I   +     +   ++   +  SS G     P+DFFE C   +EV F G+  L++Y+   +  R+ +    ++       S+ +TN   + ++VG+R+ +   D +++P Y EI+ R IP+   L  NR  D+   + E L  DK + ++ GPS +++ + +ID ++V+ + K +  W  + +E
Sbjct: 1756 IRHLMTGHMIRRVVMCCIS--TGVSGKKQHLAVSHEKGKITILQLSALLKQ------------------ADSSQKKLTLTRLASTPVPFSVLSIVSNPRNEDFLAVSGLKDCHVLTFNPSGTVSDHLVLHPQLEASN-YIIKAIWVPGSQTELALVTSDFVKIYDLSVDVLSPQHYFLVPSGKVRDCTLSFMEDGTR------------YVLIMSSGGHIYVQSLTEESSALNGPFYVTNIMDVDHPEIKHSSSER----IGDGGVSIYYCHTLQCLFFSYVQGKSFMAPLKSIVEELSIVFPINIKSNSNNNNNNNGGNASGNNKSSGSNQQPLCQWGEIMGHPGLITAFLQTSNNPVILLVKPESIHVQ-------------ELKVGSKSKIIDMVAIRHSVLSMPYSGASMN----QKTTLILLCEDGSLKIYMANPETTD----YWL-----NPVMNP------------MPCL--NQIKPPRKLKKNQQNKRNGAAVGTSSQGSSLAFPIDFFESCSTISEVEFNGNDVLQVYNVNQIKYRLTTSGLYIANMMPTGFSMEVTNNDSNQVMVGIRVMLGAQDISRVPSYIEIFGRCIPVS--LTLNRWFDLPFTREESLLADKKMTIVFGPSLDTSGVSIIDSIQVYGKTKEAFGWPEDVEE 2342          

HSP 4 Score: 127.102 bits (318), Expect = 1.542e-24
Identity = 54/94 (57.45%), Postives = 67/94 (71.28%), Query Frame = 2
Query: 4874 DLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNR 5155
            D IN E    +    + L ++LCT++ TQKEF  QHWY+CHTC MV+  GVCTICAKVCH  HD+TY+K GSFFCDCGAK    C A+T+R+ R
Sbjct: 1499 DEINDEDSAGEDSDDDSLCNKLCTYSQTQKEFVFQHWYNCHTCRMVDGSGVCTICAKVCHADHDVTYSKHGSFFCDCGAKEDGSCRAMTKRSPR 1592          

HSP 5 Score: 77.0258 bits (188), Expect = 2.256e-9
Identity = 62/247 (25.10%), Postives = 112/247 (45.34%), Query Frame = 2
Query: 9980 LISFCLLNLDQLLILWRNQSPDQKNSEKELDTSNKILKQNLTSNQGF---DVSVTF--DWLPMSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAK-HYRTVRDIHLIGGSINKIKSLLNKQFSDH----NVINRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYC-SKCPEILNFLMVNSVSLHETI 10687
            ++++CL  L  LL  W+  + D+         +NK+    L     F   D+S  F   ++     D       LLTE+ LR+PY   K+  N    G     ++ E             +WH  LCE++ ++ + +  +  R LL  + G K  YR +RD+H +   +  ++ ++  + + +    + +  +  P+D  LKL+E + +C++      +NW+ +C SK P  L FL   S SL E +
Sbjct: 3011 IVNYCLKLLKSLLTYWKESTVDE--------NTNKVGSSLLKVQPSFFPPDMSPFFLKQYVKGHAHDVFESYPRLLTEMALRIPYHATKIFENG---GSSNAKENWE-------------EWHYSLCEYMMLHQTLYARRQVRRLLLYICGTKDRYRELRDLHTLESHMTSVREIIRLEITTNSKSLDSVPHLSFPYDTLLKLIEHLRACVDIATSHTNNWQKFCLSKDPNALAFLFQISFSLDEGV 3233          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. TrEMBL
Match: A0A5K3EWD4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 4.044e-121
Identity = 330/1012 (32.61%), Postives = 532/1012 (52.57%), Query Frame = 1
Query: 13933 QEIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSA-GHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTSDIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMPYVESL-RKEVPLEHYQRSNELIEG--GMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHKNSRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEY-GTLFRHHMM-EKGLLNICIDFLVAVAPED--ALKEGIKLDLKRPDTIXXXXXXXXXXXXXXGQACVGSNGF----VEAGQILLAVPG-----LLGFLHKLETVKSVQAIGVLSED----WLNALKECSAD----------MNKVISGLRS----STQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXX-XXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMS-----------GKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVVNENEWVVAQRHNQNAKCNSLMPILGPHPDNN-------------FKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANL-------ISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEE 16767
            Q +  +  +Y+  +V+ LL  ++N+R L+  RS  T+  ES +   +D LS  +    R ++K+ +  L Q+PV    +A   ++E++ A +CP + E P F V L +++ QE++L  R I   + S + G  PT++DVIN++  EN +T+D+RL+++C+ ++LM  LLL D+Y H+WL ++ NN +  M L  RI GL EDN+PYVE++    +P E Y     L E   G+  I+ RLA V++      ++  SV LL Y +KVP    RL++P    + +LL+ L  CL            +    V   + L R+LT    G+ +     +        +P LL+ I   S + +    + ++P LLA   +  M  I+D++  H    +  AH   N   ++ CCC L++ IP++   G   R  ++ + GLL++C+++L  + P    AL E   LD K PD   FL   AL F+L L + CV + G             A  G     LL FLHKLET KS   +G+L+ED    W+  +KE  A+          +  V+S +R     + Q+N R  A +VRQ+QL  + M +N+KGQV  S+S    ++++QV+EE G  C IC  G  + PQE L +Y F+++  + + +S           GK  A P++    +   +T+VS++V VHF CH +A++  N++EW VA RHN++A+CN L+PIL      N             F   ++ Y  +I +  ++P I+ +L+ HD+K LLLRFAH R F+ +TGGGAR SN+ LVP ++QIAI  L         Q++L++  ++  + W    G          W      Y IV  L   + + W +HR  +L+ L+  A+ R     +   ++        +SIY P+L+ FG+I SFY  L K+V +  G   AW  A+S Y R +D  L+  + K++ F+E +L P ES++EF +V+E+   +  +E
Sbjct: 4297 QPLNDLGPEYQNQLVRFLLHITVNLRPLVYQRSAYTSKAESVYKAMLDQLSGLAGSRTRDYLKVVLDFLAQYPVDANHNAIVFLLEQLCAPVCPIETEIPPFPVRLSVWRDQEEYLFVRRIREVVMSNTRGFGPTISDVINYICTENNLTTDMRLEMVCENQILMPQLLLRDVYTHIWL-ANPNNANAVMELVYRIPGLEEDNLPYVETIPHPPIPPEQYSHLVVLAEHPHGLAGILNRLATVNDALKCCDLLHVSVHLLEYCLKVPQCQARLVDPQYRAIPILLEVLSACLHVIRLPAGHCHAQFHDQV--TSRLVRVLTALLRGATS-----LGSDAGPLLLPRLLNCIASQSDLAVVHSGVARLPGLLALGEASRMNAIVDFLRQHAVRRL-EAHEVGN-ADLMQCCCALVTGIPNETLDGRRLRAKLVTDLGLLSLCVNYLWELIPAKVLALSEEAALDTKDPDLECFLSDNALPFVLQLMRGCVWTVGHGTDDPIPPAFPAAPSGCTTRQLLAFLHKLETSKSAGRVGLLAEDLLDEWVGTVKEGEAEGGGTDVDPQSLAGVVSTVRELRRLTVQRNRRI-AREVRQRQLLSLNMKINEKGQVAMSASDKLAEMTAQVVEETGLQCAICHGGPRSAPQEELAIYVFIRRCPLEEGLSTTPSTSSRSTPGKSGAPPSTT---DSEGFTTVSSFVVVHFECHVKAIRASNQSEWTVASRHNRDARCNCLIPILMGGTQANQGEDDLRTNLDELFAKRMSSYAMNIMSLVSLP-ISTKLVFHDIKLLLLRFAHQRPFHSETGGGARESNMNLVPHLMQIAIFELNKEQTVVAEQSNLMHLIVRPETYWSTDPGA--------CWDPLGPLYSIVAALHLLTPKEWRKHRANLLRHLMGLAYARATTTDNSVSVE--------FSIYKPYLLFFGLIQSFYEHLFKDVVADSGEPNAWPKALSDYIRCSDEQLISSTPKLLSFFEGSLSPIESVAEFLNVVEMTGEVNADE 5277          

HSP 2 Score: 166.007 bits (419), Expect = 2.645e-36
Identity = 158/623 (25.36%), Postives = 260/623 (41.73%), Query Frame = 2
Query: 6095 FTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAK---------SDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPE-------LYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYV---------------------DIRNEAE---FDCTLVNWFSIHDHPGLLMAICQQTNSP-------VYISVEPEKYCFQILE-KSENSENDITDISVASL-------------SKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKIL------------------------MANIR--SPNSDGRFWLQE--RFTNTFLNECLQGTPSSATPDMP-TLE----------LHGIDSNKSSSSK---------------RHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVA---------CKNPVSLV---------------ITNKKP-DSIIVGVRIGINVTDPTKIPKYFEIYNR 7540
            F    +  +P N+   A     E SV+  +S+G    +  + P+LE+  + +I  +WLP S  +L L+ T+SVQIFD+  ++ + +++FK VE +F DATF + P K   S  ++E           SD Y+ VM+  G I  ++L      S G FYLA+ LDW+PE          + R+ +TG LG GG S+ Y + L LL HSY++G T  S +D G D + V+ ++ +                     +I++ A    +   L  W  + +HPGLL A   +++         + ++VEP+    Q L   +E     I +++  S              S V  ++T  W  T E      R+ S+ +   G I++L                         A++    P   G+FWLQ   R ++  +    Q   +S TP  P  LE          L     N+   SK               RH+  +      ++ G +  DF E    ++ VIF     L +Y+QE L  R+   +  V+ A          +N  S V               IT+ KP + +IVG+R+ +  +     P++  ++ R
Sbjct: 1031 FEPSKLSVHPGNEAIFAASNSAECSVVGLSSLGQACGRVTIAPLLEEKEEVLIKPVWLPNSCRFLCLLTTKSVQIFDIFASSPRLLFYFKPVEGKFCDATFVYAPKKKLDSSKASETHELSEDNDDFSDVYLFVMATFGSIMPQRLLPETRISCGQFYLADCLDWDPESLSSTGSSGTLQRNPRTGTLGGGGVSVFYSNTLNLLLHSYHSGHTVASSIDFGSDNVKVNHSFLLTDGSSSKGGNTLLETNDSTETEIQSSASTATWSGPLNQWSEVREHPGLLTATAVESSGGNRFQRRHLIVAVEPDTVLLQPLPVDTEPPLKRIDEVASRSPKNGPENDEKASKSSSVAISLTQYWAGTSE---LAARSFSLQISQAGTIQVLATPPACRAIGSRQAASAIDDSAETFASLHKLPPTLPGQFWLQPALRTSDATVKPTDQHL-ASETPSSPVALEDVLLWDMSSGLSAPYLNRPDYSKAWEFAAHAVAVLPILRHL-LETTRPGTANGGDLAYDFHEWSTPSDNVIFYSRDLLSIYNQETLCQRLSQSNTPVTFAGRSLAYTLEARNADSRVHSALDKSDVVTFVVDITSSKPTEEVIVGLRVELADSPEAYYPRFLSVFGR 1648          

HSP 3 Score: 95.1301 bits (235), Expect = 6.896e-15
Identity = 37/82 (45.12%), Postives = 53/82 (64.63%), Query Frame = 2
Query: 4931 DQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNF--CEALTRRTNRTTISK 5170
            +++CTFA+TQ +F +Q WY C+TC M    GVC +CA++CH GHDL +   G FFCDC A+      C ++TRR  R  + +
Sbjct:  453 EEVCTFASTQYQFIEQPWYGCYTCGMTSGRGVCHLCAQLCHAGHDLVFNTTGDFFCDCAAEFGVLGKCCSVTRRLGRHGVGQ 534          

HSP 4 Score: 93.2041 bits (230), Expect = 2.675e-14
Identity = 124/517 (23.98%), Postives = 201/517 (38.88%), Query Frame = 2
Query: 10115 GFDVSVTFDWLPMSDIDSTF---------DMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHS-------VLCEFIEVNISEHITKASRTLLNSVV---GAKHYRTVRDIHLIGGSINKIKSLL----NKQFSDHN----------VINRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETIGXXXXXXXXXXXXXXXXXXXXXXTASSNPPXXXXXXXXXXXXXXXXXDKNTQRKSAGSAPEVNKQEAKLCRALT-----SKMDNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCWS----FSYISPQLADLIGHLLTKYPNWERIESFSHQLTNDIVQSSQELLSNSCTPFYNCLQRLV--------------------------------------------KLPGYYLDSEPCSVCLPPSSTN-EMHVYRWDSEPTDNRRNQAKSATITGMG 11404
            G+   +T  W P+ D  S+          D    LTE  +RL    + LC            D+   +    NS +  SKW S       VL +  E  ++ + ++ S  L + +V   G KHYR ++DIHL+G  I++++ +         SD N              ++LP+ D   +L  V +C+N     PS W+  C + P  L F+M  S+ + + +   LL L+ +A+  S+    K+    S PP  ++              K + +  A S+   +K  A L + LT      K    + AEF++  +C   DS +R +   +   LY HG  AFRL LL  L   W+    F+    +LA L  +L+   P W    +F +QL   +      +  +     Y  L R++                                            +LP + L+ EPC +C   +  N    + +W S     RR    S+T TG G
Sbjct: 2855 GYGAGLT-SWAPIIDSHSSLSNFDTCHRIDFSTQLTEATVRL---TIALCGGM-------KGDEEAALTTSCNSEELNSKWCSLAYNLLEVLTDLPEGKVTPYTSRLSALLRSLLVLLVGPKHYRQLKDIHLLGQMISRLRGMCIADQRTSVSDENGGVSSEALLVPPANLRLPYRDECSMLTCVHTCLNIALANPSIWQRLCIRMPANLLFMMSTSLCVRDPLARGLLNLVFIAVTSSDRRSEKQI---SVPPSAST--------------KQSTKGGAASSSNYSKLAAALTQLLTPEEGEGKEQAKLFAEFLRDMVCCRADSRIRHIALGIALALYRHGHGAFRLALLQQLPQLWAELPNFAVYGDELAQLTCYLVVDQPLWAGRVNFLNQLVTLLTSQLTAISDHPKRDAYTALMRVIELGNLNLSVLPTSGSKTLRVKVEDLALADDSHASRQLSRHLTCDQLPSFPLELEPCLICHRGAFNNLPYALLQWGSSSPSRRRTNTSSSTQTGQG 3343          

HSP 5 Score: 88.5817 bits (218), Expect = 6.760e-13
Identity = 72/291 (24.74%), Postives = 118/291 (40.55%), Query Frame = 2
Query: 11444 LTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQ-RPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTV-------------------------SKDMA---EMKLDFPVLLTAVYLIFEYDCFTGSVSNSD----------------------NVK----CPRCHSASIQGNVCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAF 12151
            + P    +P VH+F L   + I  I V+F       R    + +Y S+      ++++   +LW +V  V +                         S D A   E++L   + LTA  LIFEY  F G   + D                      NV+    C RC+   +QG+ C NC+ N NQC RC  IN +  + F+C  C S  +  + F++ A+P Y  +  L+ +E RE  ++ I T +E +    Q +  ++  L + +           SSQ   + + F
Sbjct: 3448 IEPQTWVSPNVHIFALPLVHDIAQIGVRFLPPNNALRFVRTLNVYSSNAFECPPSRLMRARHLWSRVAQVHIPATKYNVVIHLASEEDYVFPPQLESSPDAAATVEVRLSPGLTLTANSLIFEYAAFHGMGEDEDYENANGGALGGGLLGPGATSLRNVRKKRVCWRCNLPILQGSTCQNCKQNGNQCSRCLFINLSDEEMFLCTKCGSSNFNFMSFTIVARPNYTAVANLRDDEDRETALSCIVTLTEDLNTTSQALSRVQNNLALNIISTDATTVGGPSSQPNSSLAHF 3738          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. TrEMBL
Match: A0A0X3PBK2 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR117337 PE=4 SV=1)

HSP 1 Score: 444.891 bits (1143), Expect = 1.215e-120
Identity = 321/1031 (31.13%), Postives = 524/1031 (50.82%), Query Frame = 1
Query: 13933 QEIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTSDIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMPYVESLRK-EVPLEHYQRSNELIEG--GMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHKNSRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQK---QILLCCCNLMSSIPSD-EYGTLFRHHMM-EKGLLNICIDFLVAVAPEDALK--EGIKLDLKRPDTIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPG-------LLGFLHKLETVKSVQAIGVLSEDWLN-----ALKECSADMNKVISG--------------------LRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXX-XXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMS----GK-MQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVVNENEWVVAQRHNQNAKCNSLMPILGPHP-----------------------------------DNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFY-----NILLKNVTSSPGT--GKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNI 16755
            Q +  + + Y+  +V+ LL   L +R L+   +  T   E  +   +D L+  +   IR F+  A+  L Q+P  DL SA  +++++ A +CP   + P F V L ++  QED+L  R I   +SS + G  P + DVIN++  EN +T+D+RL+++C+ ++LM +L L+D+Y  +WL + +N  S  M L  RI GL EDN+PYVE L    VP+E Y     L E   G+  I+ RLA V +   G  ++  S+ +L Y +K+P    RL++P L  + +LL  LL CL+         +  E     L+ +L  +L L    S                +  LL  I +   + + +  + ++P LLAF     M  I+D++ PH   L+  +  D  Q     I+ CCC+L+ S+P++   G   R  ++ + GLL  C+DFL    PE  L+  E   LD K P  + FL + AL  +L L + CV S    +                 LL FLHKLET KSV  +G+L+ED L+     A  + S+  +  +S                     LR  T +  R  A +VRQ+QL  + M VN+KGQ+   +   +  ++++V+EE G  C IC +G    P+E LG+Y FV++ L+ + ++    GK    LP+S    +   YT+VS++V VHFSCH  A+K  N  EW VA RHN++A+CN LMP++G  P                                   D+ F   + ++ + I +  +   ++ +L++HD+K LLLRFAH R F+ +TGGGAR SN+ L+P ++QIA+  +    + +  E+ ++   +++        + + W      Y IV  L   S   W + RV++L+ L+  AH R   L + ++   + L P  + +  P+L+ FG+++S Y     +I+L +VT +  +   ++W  A+S Y R +D  LL+ + K++ F+E +L P ES+SEF D+I +  ++
Sbjct: 2423 QPMKELGHAYQNQLVRYLLHICLQLRPLVFQLTASTRRAEKVYKAMLDQLAGVTGPRIREFLWAALDFLAQYPDDDLASAAFLLDRMCAPVCPISTDLPPFPVSLSVWGNQEDYLFVRRIREVVSSDTRGFGPRILDVINYICTENNLTTDMRLEIVCENQILMPELRLQDVYSQIWLANPSNANSI-MELIYRIPGLEEDNLPYVEQLTTPPVPVEQYSHLEILAEHPFGLRGILSRLATVRDALKGRELLVVSMHILEYCLKIPECQKRLLDPELHAISILLGVLLTCLRVIRLPPEHADLHEKVTGRLVRVLTNLLQL---ASSDPAAVASAASAASGLVSRLLTCITEQPDLPVVRTGVARLPGLLAFGDEAAMAAIVDFLRPHVLTLLSPSSPDGRQPAADAIMDCCCSLVVSVPNETPSGRRLRSRLVTDLGLLKSCVDFLWNTMPESVLEQSEESALDTKEPTMVVFLNEVALPPVLKLMRGCVWSCQPGDPTPPPFPSAPQPRTSRQLLAFLHKLETSKSVGQVGLLAEDLLDEWVGTATAKTSSTPSAAVSAEELDKMPSLSIASVIQEIKDLRQQTVQRNRRLAKEVRQRQLRSLNMKVNEKGQLAMLAPTHVAKMTAEVVEETGLLCAICHEGPRAAPKEPLGIYVFVRRCLLEEGLARPDIGKPAPTLPSSA--YSPEGYTTVSSFVLVHFSCHLNAIKGSNVGEWTVAARHNRDARCNCLMPVMGRVPKATPPTTPAAPESASEKIVSVTKSPKSLADLRRTLDSTFATYMAKFSSHITHMVSF-TLSTRLVLHDIKLLLLRFAHGRSFHGETGGGARESNLNLLPYMMQIALYQMNRDQNAM-LELDSLLSLIDRPETDWCSSSASCWDPVGPLYSIVAALHLLSPRQWRERRVRLLRHLMALAHARATMLPESAET--SSLPPPSFIVIKPYLLFFGLVNSLYEYFFKDIILPSVTDAQTSDESESWRSALSEYIRASDEELLNATPKLLSFFESDLSPAESISEFLDIIGMTGDV 3443          

HSP 2 Score: 92.4337 bits (228), Expect = 4.953e-14
Identity = 74/289 (25.61%), Postives = 125/289 (43.25%), Query Frame = 2
Query: 11450 PNVRSNPTVHVFNLRAPYSIQSITVKFTG-TRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTV----------------------SKDMAEM------------KLDFPVLLTAVYLIFEY-----DCFTGSVSNSDNVK--CPRCHSASIQGNVCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQ-ELEVFLDQIKMMDA-AEMSSQKKVNNSAFITSGTNISGLG 12184
            P+   +P  H+F+L + ++I  I+V+FT  ++  R    + +Y          ++L   ++W +V  V +                       +D+A +            +   P+L  A  LIFEY           +  +D+ K  C RC + ++QG  C  C+ + NQC RC  IN +  D+F+C NC       + FS+ A+PCY  +E L  +E R+  + R+ + SE +    Q +  + Q EL + L  +   DA A   S+   + S     G    GLG
Sbjct: 1330 PHTWVSPNTHLFDLSSVHAISQISVEFTAASKSARFVRTLNIYSCTNFGRPPARLLQDRSVWNRVAQVHLLRTQRKVIVNLAPLGPQPLPEGEQDLASLTTSNAYAVVVGNRQGLPLL--ASCLIFEYADLHQSQQQQHLHGADSKKRFCTRCRAETVQGFTCQVCKQSGNQCARCHFINLSDEDNFLCTNCGYSNSLNMTFSIIARPCYSAVEPLHDDEDRDAALARVVSLSEDLSTTSQNLTRISQMELSMALHDLTSTDARATPPSRPPADGSHPNVIGRVHPGLG 1616          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Cavefish
Match: ubr4 (ubiquitin protein ligase E3 component n-recognin 4 [Source:ZFIN;Acc:ZDB-GENE-090313-341])

HSP 1 Score: 348.591 bits (893), Expect = 4.563e-111
Identity = 268/972 (27.57%), Postives = 481/972 (49.49%), Query Frame = 1
Query: 13936 EIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESLRKEVPLEH-----YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHKN---SRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPE----DALKEGIKLDLKRPD-TIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVL 16788
            E+ +I   +++ +V  +L   L +R+L+V R+K+  + +    + ++D++  +E   ++F+ + +    ++ + D ++   I E++ + I P + E   F V L+    QEDFL  RM G   SS   G  P + D+ N + ++  + +    D  ++L+ + K++  DL + ++Y+ VW      N+  PMR+  R+ GL+ D    ++ESL      E      Y+ +  + + GG+  ++ RL+ + +   G  ++   ++L +Y +KV  N  +L+ P ++T+ V+L  L + L    + K       S    +++++  IL    A ++++    +    +   + +LLD I+     S   + Q  +  IP  L+F    +M ++++   P       +   + + K  L C C + + I ++  G   +  +++KG+    +D++    P     DA  +  K  L RP         + L       Q  +G++               +  LHKLE V S + IG L+E+ L AL+E  AD+N  I   R  T+   +  A+ +RQK L  + MT N+KGQV+T +SLLK +   + EEPG  C IC +GY  +P + LG+YTF K+V + +  +   +          Q  Y++VS++  VH+ CH  AV++     EW  A   N N KCN L+P+ GPH P++ F   L R+ T +   T   E  YQL +HD K L LRFA  + F+ DTGGG R SNI L+P II   +  +++     ++E + +  +LEQ    C  + ++ ++     Y  V  +     E W   R+  L+ LL  AH R ++    +++    ++   Y +Y   L+ +G++   Y++  K  TS+  T   W  +++ Y R ND+ + + S +V+R ++D L+P ES SEF DV+ L   IP  + +L  +L
Sbjct: 4183 EVESIKRHFKSRLVGTVLNGYLCLRKLVVQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYNLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLSVAEVYKKVWC---PTNEGEPMRIIYRMRGLLGDATEEFIESLDSTTDEEEDDEEVYKMAGVMAQCGGLECMLNRLSGIKDFKQGRHLLTVLLKLFSYCVKVKINRQQLVRPEMNTLNVMLGTLNLALVAEQESK--DSGGASIAEQVLSIMEIILDEANAETVSEDKGNLLLTGDKDQLVMLLDQINTTFVRSNPSVLQGLLRIIP-YLSFGELEKMHILVERFKPCCSFDKYDEEHNADDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQSALDYMKKHIPSAKNLDA--DVWKKFLARPALPFILRLLRGLATQHPPTQMLIGTDS--------------ISNLHKLEQVSSDEGIGTLAENLLEALRE-HADVNLKIDAARRETRAEKKRMAMAMRQKALGTLGMTTNEKGQVVTKTSLLKQMEELI-EEPGLTCCICREGYKFQPTKVLGIYTFTKRVALEEFENKSRK----------QQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDTKLLFLRFAMEQSFSVDTGGGGRESNIHLIPYIIHTVLY-VLNTTRATSREEKNLQSFLEQP---CDKWVESSYEVDGPHYFTVLAMHILPPERWRATRIDFLRRLLVTAHARKVSPGGANKLTDKAVK--EYMVYRSPLLFWGLVDLIYDMFRKVPTSN--TEGGWSFSLAEYVRHNDMPIYEASERVLRTFQDELMPAESFSEFLDVVGLLSEIPDPDGFLQDLL 5112          

HSP 2 Score: 77.411 bits (189), Expect = 4.563e-111
Identity = 116/503 (23.06%), Postives = 207/503 (41.15%), Query Frame = 2
Query: 12419 LNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYD--TRLARAKNNLVNVNESLFESNKIRQ------------NCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNLVSENEPAIEHKSSLIFPSMPVLCINQ-WLQDDSSQLFETWLQC-TREENQIPRDITLN-SDQGNVGLIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDSWRNGQARPGLSN 13876
            + QL  +YS D K    E+  + +++ A++K +  YD   R A  K++  +   + F +++ R              CY C  +     I L++ L+    IR  +     ++++        L   + +MR+E+  L+  +TRD  E   ++N LI +++  AL+  + +    S ++  + LL  SIA     WELRLR A+++ L        + N    VV   I L+  C+R L   +K P    K N     + A+E  +++   S  +    Q WL+ D    +E W +C      Q P    LN ++     L++K+  +W   ++ +       +  +   +      WL Q L + +  + RQA   +VE L      R + VL +L   L           D+L                      E + +Y+AL ++L +  HW+ YL  +  L  I +L    +   LA  E +     + G A   L+ 
Sbjct: 3728 IQQLAQEYSGDCKTSFDELSKIIQKVLASRKELLEYDLQQREAATKSSRTSTQPT-FTASQYRALSVLGCGHTSSTKCYGCASAVTGHCITLLRALATNTAIRQILVLQGLIREL----FEYNLRRGTGAMREEVRQLICLLTRDHPEATQQMNDLIIAKVSAALKGHWANPDLVSSLQYEMLLLTDSIAKEGGCWELRLRCALSLFL-------MAVNIKTPVVVENITLM--CLRILQKLIKPPAPTSKKN----KDAAVESLTTVKPYSNEIHAQAQLWLKKDPKASYEAWKKCLPARSGQEPASKPLNKAEIRRQYLMEKYVWKWKQFMRSRSEGLFPRLLKLGHNN------WLRQVLFTPATQAARQAACTIVEALTTIP-SRKQQVLDLLTSYL-----------DEL------------------SIAGECAAEYLALYQKLIKPAHWKVYLAARGVLPYIGNLITKEIAHLLALEEATLSTDLQQGYALKSLTG 4176          

HSP 3 Score: 346.28 bits (887), Expect = 3.943e-94
Identity = 277/1031 (26.87%), Postives = 463/1031 (44.91%), Query Frame = 2
Query: 4925 LDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHASQSTSIDAIKKDKPS--MKSQFFEKSKYNFQTRFSKFSSNEKLLRKSYKADTKSRLTAHKMTAAADSGS---CPEVTNDDESTSTNMISNAISTVFSVNQSKQVAYRNWITAVLRERIXXXXXXXXXXXXXXXXXDDCFTALQIIHESFKVQYSDWTVGKNKQMKEAFKSVRTSEKISERVTTIMGSSIQLRNAEAPSDMSGIPPTSVLASEIAGANSHVRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLK--TGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNE---AEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQ-------EFLRSKESSKTKIQNKSSSNMEGLNKC--IGHIITNCK-----INLSTINPYLPKPELLSSGLQLLTAFFHFKNT 7942
            L ++LCTF  TQKEF +QHWYHCHTC MV+  GVCT+CAKVCH  H+++YAK GSFFCDCGAK    C+                          A+ K  PS  M S   E S +  + R       E  +R             H+  + AD G    C   ++DDE    + +   I       +   +A  +  TA L                   +LD     +  I  +F+ Q S   VG + + + A   + T +K  E    +M  +  L + E   +       +V  +        +R ++ +  +RR  + V+S   G    +  LAV+ +K +I + ++S LL++                   D   ++  + ++ +  +PFTVLS+  NP N+ Y+AVCGLK+  VL F+S GS+S   V+ P L   N FII ++WLPGS   L +I    V+++DLS     P+Y+F    S+ +DATF F          + E K+   +++MS +G ++ + +D++  A  G FY+  +L+ N E      DLK   G +  GG S++Y H LQLLF SY+ G++F + ++    E    + + ++++     ++    L  W  + +HPGL+  + Q T  P+ I V+P+ +  Q ++            ++ + +K+ D +      + E     QRT  ++L  DG ++I MAN+ + +    +WLQ               PSS    M       +   K++++    +    F         PVDFFEH +Q  EV FGG+  L++Y+ + +  R+ S    V+       ++ + N     ++ G+R+ +      + P Y EI+ R + +   L ++R  D+   + E L  DK L + IG S +   + ++D +K++ + K      N  Q       +      +S T ++    S++E L  C  IG      K     + L+T+   +P P  +    + L A  H   T
Sbjct: 1632 LCNKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCQ--------------------------ALVKRSPSSGMSSNMKESSAFQSELRMP-----ESAIR-------------HQSASPADKGKVTICDGKSSDDEKPKKSSVCKNIEGC----REDLLAQSSSSTATL-------------------VLDLLIFLMDAIQSNFQ-QAS--AVGSSSRAQHALNELHTQDKTVEMTDQLMVPT--LGSQEGAFE-------NVRMNYSGDQGQTIRQLISAHVLRRVAMCVLSSPHG---RRQHLAVSHEKGKITVLQLSALLKQ------------------ADSSKRKLTLTRLASAPVPFTVLSLTGNPCNEDYLAVCGLKDCHVLTFSSTGSVSDHLVLHPQLATGN-FIIKAIWLPGSQTELAIITADFVKVYDLSVDALSPMYYFLLPSSKIRDATFLF----------NEEGKN--IIVIMSSAGYMYTQVMDESSSAQHGPFYVTNVLEINHE------DLKDSNGQVAGGGVSVYYSHVLQLLFFSYSQGKSFAATVNRSNME--TQRLFTINVKGSNGGSKTSPALCQWSEVMNHPGLVCCVQQTTGIPLVIMVKPDTFLIQEIK------------TLPAKAKIQDMVAIRHTASNEQ----QRTTMILLCEDGSLRIYMANVENTS----YWLQPSL-----------QPSSVISIMKP-----VRKRKAAAATTRTSSQVTF---------PVDFFEHNQQLTEVEFGGNDLLQVYNGQQIKHRLNSSGMYVANTKPGGFTVEVVNNNNSMVMTGMRVQVGTQAIERAPSYIEIFGRTMQMN--LTRSRWFDLPFTREEALQADKKLSIFIGASVDPAGVTMLDSIKIYGKTKEQFGCPNLNQGNGTGDSDITTPTSTSGTVLERLVVSSLEALESCYAIGTASEKEKSKGPALELATLLLSMPTPAGVQQQTKGLLASLHTSRT 2494          

HSP 4 Score: 221.476 bits (563), Expect = 1.987e-56
Identity = 186/724 (25.69%), Postives = 327/724 (45.17%), Query Frame = 2
Query: 9983 ISFCLLNLDQLLILWRNQSPDQKNSEKELDTSNKILKQNLTSNQGFDVSVTF--DWLPMSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLNKQ--FSDHNVINRIK---LPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETIGXXXXXXXXXXXXXXXXXXXXXXTASSNPPXXXXXXXXXXXXXXXXXDKNTQRKSAGSAPEVNKQEAKLCRALTSKM----DNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHLLTKYPNWERIESFSHQLTNDIVQSSQELLSNSC-TPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEY-DCFTGSVSNSDNVKCPRCHSASIQGN--VCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQI 12094
            I +CL  L  LL  W+ Q       E+E   ++++LK + TS+   D+S  F   ++     D       LLTE++LRLPY + K+     ++          I          +  W   L E++ +  +  + +  R LL  + G+K  YR +RD+H +   +  IK LL +Q  F    ++       L +D  + L+E + +C     +R  NW+ +C K   +L FL+  S  + E +   LL LL  AL  S+         S++         +         + N   KS         QE +LC AL  ++    D   L +F++ +L E   S VRW    +  ++Y +   + +  LL+     W    ++   + Q  DL+G+   K P  E+      Q   +I+++   +L+N   +  YN L  LV+  G+YL+S+PC VC  P              P  N              +  +S  +        + R   T  V  L   ++I  +TVK    +R +    + LYY++ +  +  ++ ++   W K K V ++    E+K+D P+ + A  L+ E+ D +    ++++ ++CPRC SAS+  N  VC NC +N+ QC +CR+INY   D F+C  C  C+Y R DF ++AKPC   ++ +++EE R+  +  I T  +  ++   +++  + +LE  L ++
Sbjct: 3045 IDYCLHVLKSLLEFWKTQ-----QGEEEPAAASQLLKPH-TSSSPPDMSPFFLRQYVKGHAADVFEAYSQLLTEMVLRLPYQIKKIADTNPRI-------PPPIF---------DHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVRSIKKLLEEQGIFLRGGIVTATSGSALQYDTLISLMEHLKACAEIATQRTVNWQKFCMKDDSVLYFLLQVSFLVDEGVSPVLLQLLSCALCGSKVLAASSSGGSAS-----GTGASQSSQKQMCCECNKCEKSLCQGEGAASQEDQLCTALVGQLNKFADKETLIQFLRCFLLESNSSSVRWQAHCLALHIYRNSNKSQQELLLDLTWAIWPELPAYGRKAAQFVDLLGYFSLKTPQTEKKLKEYSQKAVEILRAQNHILTNHPNSNIYNTLSGLVEFDGFYLESDPCLVCNNPEV------------PFSN--------------IKLSSIKV--------DTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRTINLYYNNRTVQAIVELKNKPARWHKAKRVPLTPGQTEVKIDLPLPIVASNLMIEFSDFYENYQASTETLQCPRC-SASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAKPCCA-VDPIENEEDRKKAVTNINTLLDKADRVYHQLMGHRPQLESLLSKV 3705          

HSP 5 Score: 57.3806 bits (137), Expect = 7.405e-7
Identity = 100/420 (23.81%), Postives = 183/420 (43.57%), Query Frame = 2
Query: 2120 MWKNIFHSIKQSTINNNYKCV-DIRQELIQLYLLIFHGLTSISGKTEIVFDLLNCITD-CSGFKTGVQ--PRLISRLLIILTYLVHHFYEQSSSLAFQIQYNLLTKYISDSINSDASN--------YQYDEVQIFDQKTNVIFYDISIPWIASKKFWPGLNP----------DSLILKNMVNHP-QYESFFNGVLD----GIQMCLDHRQVYDESQKFSLLSFTGSFYNILLSWRLMEVLPLPDKY------------QQDIPNIELSCYTRL-ICSFLKLRND--AKANLLSGKNNLTEELLLIDCQSETKYDL---DQHIIHLIANLCERICLDIKNEPP--HLP--QQIYQIDMIIVSLNFILQCIKDDIDHPSTAEKPSVNTKCYLNSETSENSALSKNLIPIIL---NIYETLIR 3223
            +W+    ++KQ T+        D+  E +QL LLIFH L S  G+  ++      I +  S  ++  Q  P  ++R+L++  YL+H + +    L  Q+QYNLLT   S + ++            Y + EV+  +  T     D ++      KF+  L+P          DS + + + N   +Y++ ++ ++     G Q     RQ   E++  S  + +  +Y ++L WR++ VLP    Y            + DI +  L   +RL + +++   ND   K  + S +     E++   C S  KYD+   +++I   I++ C   C+D  +  P   +P  Q IY +D +I  +           +H S         K    ++T ++  ++KNL+P  L   +IY    R
Sbjct:  762 VWERFIGTLKQHTLQGALPSEEDLNVEHLQLLLLIFHNL-SEKGRRHVITLCTQAIAEVASQVESQYQAVPLNLARILLVFDYLLHQYSKVPMYLFEQVQYNLLTAPTSGASSTQEGGKRGTLPIYYGFKEVE--ENWTKHCSADSTV----QPKFYCVLSPEASEDDRSRLDSKVFQVLFNGAVKYDTLYSSLISLLAAGSQFDTARRQ---ENKPISPEACSLQYYFLIL-WRILGVLPPSKAYIEQLKTGNSDPSESDILHT-LRWSSRLGVSAYVNWINDHLVKQGMKSDQATYLIEVVSSKC-SAVKYDVELAEEYIARQISSFC---CVDPNSILPLHQIPSLQTIYTLDAVISKVQVSRN------EHFS---------KVAAETDTHKSFEITKNLLPATLQLIDIYTAFTR 1150          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Cavefish
Match: FBXO11 (F-box only protein 11-like [Source:NCBI gene;Acc:103027057])

HSP 1 Score: 56.9954 bits (136), Expect = 6.930e-7
Identity = 25/60 (41.67%), Postives = 33/60 (55.00%), Query Frame = 2
Query: 4982 WYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKG-SNFCEALTRRTNRT 5158
            +Y CHTC+  +   +C  C K CH GHD+ + +   FFCDCGA   SN C      T+ T
Sbjct:  802 FYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDT 861          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Cavefish
Match: fbxo11a (F-box protein 11 [Source:NCBI gene;Acc:103042797])

HSP 1 Score: 56.9954 bits (136), Expect = 7.287e-7
Identity = 25/60 (41.67%), Postives = 33/60 (55.00%), Query Frame = 2
Query: 4982 WYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKG-SNFCEALTRRTNRT 5158
            +Y CHTC+  +   +C  C K CH GHD+ + +   FFCDCGA   SN C      T+ T
Sbjct:  801 FYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDT 860          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Cavefish
Match: fbxo11a (F-box protein 11 [Source:NCBI gene;Acc:103042797])

HSP 1 Score: 56.6102 bits (135), Expect = 8.501e-7
Identity = 25/60 (41.67%), Postives = 33/60 (55.00%), Query Frame = 2
Query: 4982 WYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKG-SNFCEALTRRTNRT 5158
            +Y CHTC+  +   +C  C K CH GHD+ + +   FFCDCGA   SN C      T+ T
Sbjct:  766 FYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDT 825          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Cavefish
Match: ubr5 (ubiquitin protein ligase E3 component n-recognin 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6559])

HSP 1 Score: 56.6102 bits (135), Expect = 1.010e-6
Identity = 34/99 (34.34%), Postives = 46/99 (46.46%), Query Frame = 2
Query: 4847 KHNPNFGENDLINSESEEEKI-MKLNPLDDQL--------CTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRG-SFFCDCGAK 5113
            K  P  GE + +NS   E       NP D  L        C+F  T  E  +Q  + C TC ++E+   CT CA+VCH GHD    +   + +CDC  K
Sbjct:  887 KGEPGIGEKEDVNSVFMEMICPAGTNPDDSPLYVLCCNDTCSFTWTGAEHINQDIFECRTCGLLESLCCCTECARVCHKGHDCKLKRTSPTAYCDCWEK 985          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006884.1 (pep scaffold:Pmarinus_7.0:GL479707:44391:56944:-1 gene:ENSPMAG00000006180.1 transcript:ENSPMAT00000006884.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 6.055e-8
Identity = 26/60 (43.33%), Postives = 33/60 (55.00%), Query Frame = 2
Query: 4982 WYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKG-SNFCEALTRRTNRT 5158
            +Y CHTC+  E   +C  C K CH GHD+ + +   FFCDCGA   SN C      T+ T
Sbjct:  769 FYRCHTCNTTERNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDT 828          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002570.1 (pep scaffold:Pmarinus_7.0:GL481077:241:22857:1 gene:ENSPMAG00000002321.1 transcript:ENSPMAT00000002570.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.188e-6
Identity = 23/59 (38.98%), Postives = 33/59 (55.93%), Query Frame = 2
Query: 4940 CTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRG-SFFCDCGAK 5113
            C+F  T  E  +Q  + C TC ++E+   CT CA+VCH GHD    +   + +CDC  K
Sbjct:  695 CSFTWTGAEHINQDIFECRTCGLLESLCCCTECARVCHKGHDCKLKRTSPTAYCDCWEK 753          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002561.1 (pep scaffold:Pmarinus_7.0:GL481077:241:24166:1 gene:ENSPMAG00000002321.1 transcript:ENSPMAT00000002561.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 1.735e-6
Identity = 23/59 (38.98%), Postives = 33/59 (55.93%), Query Frame = 2
Query: 4940 CTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRG-SFFCDCGAK 5113
            C+F  T  E  +Q  + C TC ++E+   CT CA+VCH GHD    +   + +CDC  K
Sbjct:  661 CSFTWTGAEHINQDIFECRTCGLLESLCCCTECARVCHKGHDCKLKRTSPTAYCDCWEK 719          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Nematostella
Match: EDO43429 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYW5])

HSP 1 Score: 326.635 bits (836), Expect = 4.381e-151
Identity = 259/978 (26.48%), Postives = 470/978 (48.06%), Query Frame = 1
Query: 13945 AIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESL----RKEVPLEHYQRSNELIE--GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLI--NLLCRIL-TLGRAGSITQQNHMINQVENMHAIPILLDYIHK---NSRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDALK-------EGIKLDLKRPD-TIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVLTEL 16797
            +I  K++  +V  +L   L++RRLIV R+K+  + +    + +++++  +E   R+F+ I V  LN++ + DL++   I E++   I P + +   F + L+    QEDFL  RM G   SS   G  P + DV N +  +  + +    D  ++L+ + K++  D  ++D+Y+ +W C +   +  PMR+  R+ GL+ D    +VESL     ++V  E   +   ++   GG+  ++ RL+ + +L+ G  ++   ++LL+Y +K+  N   L  P L+ + VLL  L        ++    E E S V   I    + RI+ T+ +  + + +       ++   +  LLD I      S   + Q  +  IP  L F     M  +I + +P+      +     ++   + C CN+   I ++  G   +  ++   ++   I +L    P+  +        +  K  L RP           L       Q+ VG            ++P     +H+LE V S + +G L+E+ L AL+E S  + K ++ +R  T+   +  A+ +R+KQL  + M     G+++   S L      + EE G  C IC +GY   PQ+ LG+YTF K+ ++ D  + + +             Y++VS++  VH+ CH  AV++    +EW  A   N N KCN LMPI GP   ++ F + L R+ + I   T   E  Y + VHDL+ L  RFA  R F++DTGGG R SN+  +P  + + I  +++     ++E + +  +LE +    + F ++ ++  +  Y  +  L  +S + W +HR+   + LL   H+RH   A  S++    +  LPY++Y P ++ F  +    +I  KN+  S GT  +W  A++   R ND  +L   +K++  Y+++LLP ES  E  DV  +   +   + +LS +++ L
Sbjct: 1267 SIKQKFKGKLVGTVLNGYLSLRRLIVQRTKLIDETQELLLELLEEMTTGTEVETRAFMAICVETLNRYGLDDLRTPVFIFERLCNLIYPEENDIGEFFMSLEKDPQQEDFLQGRMQGNPYSSNEPGLGPLMRDVKNKICTDCELVALLEDDSGMELLVNNKIISLDHPVKDVYKKIW-CPEGEGE--PMRIVYRMRGLLGDATEEFVESLDDNNEEDVDNEEVYKMASVMSVCGGLEAMLTRLSGIRDLSRGKQLVQVILKLLSYCVKLKVNLKYLCNPSLNALNVLLGTL--------NQALQMEQESSGVGGAIIAEEVLRIMETILQEATSSAEPTRTQTQQDSSQLDTLLDRITSPFVRSNTNVLQAMMRIIP-FLTFGDEKNMKTLIVHFLPYLDFNKFDVERSTDETLFIDCFCNIAGGIENNHSGLRLKEMIITNSIVEKAIKYLHTYTPQKPISKANLSEVDAWKEFLARPSLPYVLRLLSGLCRGDPHTQSIVGET----------SIP----VIHRLEQVSSEEMVGSLAENLLEALRE-SPQVGKKVNEVRRQTRTEKKRLAMAMREKQLGALGMQTMSGGKIVAKPSSLMREMEDLSEETGLVCCICREGYKYHPQKVLGIYTFTKRCILEDFENKQRKT----------QGYSTVSHFNVVHYDCHMAAVRLARGRDEWESAALQNANTKCNGLMPIWGPLVSESAFASCLARHNSYIQECTGHMEPTYYMAVHDLRLLFTRFAFERSFSDDTGGGGRQSNVHFIPYAVHM-ILYVLNTTRQRSREEKTLKAFLEASP---EKFVESCYEVDSPFYHTLLSLFVYSYDQWQEHRMAFYRRLLATVHIRHSTPAGSSKVSDTSV--LPYTVYRPAVIYFFFLDQLQSIFKKNLVISSGT--SWPQAMAENIRNNDETILKSCDKILTSYQEDLLPAESFMELCDVAGVLDQLDNVDTFLSDIISGL 2199          

HSP 2 Score: 230.72 bits (587), Expect = 4.381e-151
Identity = 271/1258 (21.54%), Postives = 520/1258 (41.34%), Query Frame = 2
Query: 10187 LLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAK-HYRTVRDIHLIGGSINKIKSLLNKQFSDHNVINRIK--LPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETIGXXXXXXXXXXXXXXXXXXXXXXTASSNP--PXXXXXXXXXXXXXXXXXDKNTQRKSAGSAPEVNKQEAKLCRALTSKMDNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHLLTK-YPNWERIESFSHQLTNDIVQSSQELLSNSCTPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEY-DCFTGSVSNSDNVKCPRCHSASIQGN--VCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITSGTNISGLGTTKLPVSGGKTYAEVTGASAMDDSGLPAKSYRRIRRAAGGENEPEKESTKPPNVNPITTAETVKEEKKDSHSKHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYDTRLARAK------------------NNLVNVNESLFESNKI-RQNCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAV-LLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNLVS--ENEPAIEHKSSLIFPSMPVLCINQWLQDDSSQLFETWLQCTREENQIPRDITLNSDQG-----NVGLIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDS 13840
            LLTE+ILRLPY V K         +  + DD         + Q   +W   LCE++ V  +  + +  R LL  + G+K +YR +RD+H +   +  +++L      D +  N +   L +D  + L+E + +C      R SNW+ YC +    L+FL+  S    E +   +L LL  A+  +++       A S+P  P           T      K   +K+  S   +N   +KL + L   +D  ++ +FV+ +L E   + +RW    +L  ++ H   + +  L + +   W     +   + Q  DL+G+   K     ++  S+  +    +   +  L ++  +  Y  L   V+  GYYL+S+PC VC  P                           +    L  +S        +  + R   T  +  L   ++I  IT++    +RQ+    + LYY++ +  S  ++ ++  LW K K   ++    E+K+DFP+ + A  L+ EY D +    ++S+ ++CPRC SAS+  N  VC NC +N+ QC +CR+INY   D F+C  C  C+Y + D+++ A+PC   ++ + +E+ R+  +  I +  E  ++  ++++  +Q L++ L   ++M+                                     + +  G+S    +G+PA +Y                       + + T  T         S  ++ ++  L  +Y  + K    ++  + +++ A++K +  YD R+                      N+ +  + S+ +S K+    CY C  +  +  + L++ L+ IP  R  +     ++++    L    +  ++ MR ++  L+  +T++      KL+ ++   +  AL     +    S I   + LL ++I   D  WE RLR  + V ++ V  + P        +V   I L   C++ L+  +K P    K N V   ++   I+    +   +       +WL +     ++ W Q   +  Q P    +   +         L++KF  +W          K +  +    E     + WL QAL + S+ + RQ    +VE L  Q   R + +L +L   L  + S                               E + +Y  L +RL Q  +W+ YL ++  L++I  L +++ ++ L+ +E++ L S
Sbjct:  180 LLTEMILRLPYQVKK---------VADSIDD-------FVAPQFTDEWMENLCEYMMVQQTPFVKRQVRKLLMFLCGSKDNYRQLRDLHALDYHMRGVRNLSCDGGFDPDQANNLPVVLSYDALITLIEHLKACSEVASSRISNWQAYCIQEKSGLSFLLRASYLFEEGVAPLILQLLSYAICGAKAV-----VAGSSPTKPRKDKDKDKDKETEKDKGMKPPPKKNDKS---INVITSKLVQQLQEFVDMGIMCQFVRSFLLESNSTAMRWQAHELLCKIHKHSTPSQQDKLSDMMWKIWPELPGYGRRAAQFVDLLGYFTIKSAAKTDKFNSYCEKAVQLLKTQNTILGNHPNSNVYRMLSGFVEFDGYYLESDPCLVCNNPE--------------------------VAFQSLKLSS--------IKADSRFTTTSQLVKLTGNHTISRITLRVADLKRQKMVHTINLYYNNRTVQSVVELKNKRPLWHKAKKCHLTPGQTELKVDFPLPIIACNLMIEYADFYENFQASSETLQCPRC-SASVPANPGVCSNCGENVYQCHKCRSINYDERDPFLCNACGFCKYAKFDYTLTARPCCA-VDPIDNEDDRKKAVASINSLLERADRVYRQLVAHRQPLDLLL--TRIME-------------------------------------HGDAEGSSV---AGVPAATY----------------------ASAVQTGTT--------SSSTVNKSIQALAHRYCVECKTNFDDLSKITQKVLASRKELLEYDCRIREGTIDSSQGSTRDRTSHPSMLNHALPRSLSMLQSGKVVPGTCYGCAAAATEHCVTLLRALAMIPATRERLVEEGLIQELVDFNL----HQGTAQMRGDVRHLLCLLTKNNVGATEKLDHILEQRVTDALAGQRSNPAMVSGIGREMLLLSNTIEMEDQCWEQRLRCVMRVFMMSVEAHSP--------LVMESITL--PCLKILLRLVKPPAPTSKKNKVMYWDSLGTIKGIGEIRTQA------KRWLSEVPGHSYKDWKQQALQRPQRPMGPQVVGKESRDEARKRYLMEKFVRKW----------KKRTKRQSPSEADIPEEGWLRQALFTPSSRAARQIACTIVESLC-QGPNRRKHMLDLLTSFLDEVGSA-----------------------------GENASEYFQLYQRLIQPSYWKFYLSLQGALLQIGQL-ITQEIERLSYLEQNTLSS 1244          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Nematostella
Match: EDO43430 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYW6])

HSP 1 Score: 222.246 bits (565), Expect = 2.024e-57
Identity = 161/606 (26.57%), Postives = 280/606 (46.20%), Query Frame = 2
Query: 5831 VRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDW-NPELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEI--YVDKNYYVDIRNEAEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHL 7636
            +R ++ +  +RR  +  ++  KG    +  LAV+ +K +I + ++S LL++                   D   ++  + ++ T  +PFTVLS+  N  N+ ++AVCGLK+  VL F+S GS+     + P LE +  FII ++WLPGS   L ++    V+I+DL+     P Y+F     + +DA+F F                +  +++MS SG I+ + +D+   A+ G FYL   +   +PEL     D   G +  GG S++Y H LQLLF SY  G+T+ +    GQ EI       +   I +       L  W  +  HPGL+ ++     +PV + ++P +   Q + K+ +S+    D+ VA    V+++             + QRT  ++L  DG ++I MA+         +W+                  S  P  P   L  +   K + ++            SS  + P+DFFEHC+  N++  GG   L +Y+ +    R+ +    ++    N  ++ ITN  P  +IVG+R+ +      K P + E+++ ++ I   L +NR  DI   + E +  DK + L
Sbjct: 1234 IRQLIGAHVLRRVAMCCLASPKG---RRQHLAVSHEKGKITVLQLSALLKQ------------------ADSSKRKLTLTRLATAQVPFTVLSITGNQCNEDFLAVCGLKDCHVLTFSSSGSVVDHLALHPQLE-TGSFIIKAVWLPGSQTELAVVTADFVKIYDLATDALSPQYYFVLPSGKVRDASFVF-------------HDDERSMVLMSSSGHIYLQPMDQASAATGGPFYLTNTVPVSHPEL----EDASGGPVAGGGVSVYYSHTLQLLFFSYAQGKTYMATWLKGQKEITQVFPITFKSTIGSNKNSQAALCQWNEVPLHPGLVCSMTHNNGTPVVLMIKPGQVLIQEI-KAASSKAKTQDM-VAIRHAVSNS-------------EQQRTTMILLCEDGSLRIYMASAEHSG----YWMS----------------PSLRPIRPLATLRPVKKKKVTKTRT----------KSSSVRFPIDFFEHCQPLNDIELGGADLLHVYNAQQAKHRLATAGMYIASTKPNGFTIEITNTNPGMVIVGLRVLVGCQSSEKAPSFLELFDHRV-IQLSLTRNRWFDIPFTREESIAADKKIPL 1754          

HSP 2 Score: 127.487 bits (319), Expect = 1.292e-28
Identity = 55/93 (59.14%), Postives = 66/93 (70.97%), Query Frame = 2
Query: 4868 ENDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRR 5146
            E+D    ES+E+       L ++LCTF  TQKEF +QHWYHCHTC M +  GVCT+CAKVCH  HD+TYAK GSFFCDCGAK    C+AL +R
Sbjct:  979 EDDSGGEESDEDS------LSNKLCTFTVTQKEFMNQHWYHCHTCKMNDGVGVCTVCAKVCHKDHDVTYAKYGSFFCDCGAKEDGSCQALVKR 1065          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Medaka
Match: ubr4 (ubiquitin protein ligase E3 component n-recognin 4 [Source:NCBI gene;Acc:101174264])

HSP 1 Score: 341.658 bits (875), Expect = 7.316e-108
Identity = 262/973 (26.93%), Postives = 482/973 (49.54%), Query Frame = 1
Query: 13936 EIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTS----DIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMP-YVESLRKEVPLEH-----YQRSNELIE-GGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHK---NSRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAP--EDALKEGIKLDLKRPD-TIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVV-NENEWVVAQRHNQNAKCNSLMPILGPH-PDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVLTEL 16797
            E+ +I   +++ +V  +L   L +R+L+V R+K+  + +    + ++D++  +E   ++F+ + +    ++ + D ++   I E++ + I P + E   F V L+    QEDFL  RM G   SS   G  P + D+ N + ++  + +    D  ++L+ + K++  DL + ++Y+ VW      N+  PMR+  R+ GL+ D    ++ESL      E      Y+ +  + + GG+  ++ RL+ +++   G  ++   ++L +Y +KV  N  +L++P ++T+ V+L  L + L    + K   +   +++   +  +  I+       I++    +    +   + +LLD I+     S   + Q  +  IP  L+F    +M ++++   P+ +    +     + K  L C C + + I ++  G   +  +++KG+    +D++    P  ++   +  K  L RP         + L       Q  +G++                  LHKLE V S + IG L+E+ L AL+E S D+N  I   R  T+   +  A+ +RQK L  + MT N+KGQV+T +SLLK +   + EEPG  C IC +GY  +P + LG+YTF K+V + +  +   +          Q  Y++VS++  VH+ CH  AV++     EW  A   N N KCN L+P+ GPH P++ F   L R+ T +   T   E  YQL +HD K L LRFA  + F+ DTGGG R SNI L+P +I   +  +++     ++E + +  + EQ    C+ + ++ +    + Y  +  +     E W   R+  L+ LL  +H R ++    +++      P  Y++Y   L+ +G++   Y++  K  TS+  T   W  +++ Y R ND+ + + S +V+R ++D L+  ESLSEF DV+ L   IP  + +L  +L  L
Sbjct: 4211 EVESIKRHFKSRLVGTVLNGYLCLRKLVVQRTKLIDETQDMLLEMLEDMTTGTESETKAFMAVCIETAKRYNLDDYRTPVFIFERLCSIIYPEENEVTEFFVTLEKDPQQEDFLQGRMPGNPYSSNEPGIGPLMRDIKNKICQDCDLVALLEDDSGMELLVNNKIISLDLSVAEVYKKVWC---PTNEGEPMRIIYRMRGLLGDATEEFIESLDSTTDEEEDDEEVYKMAGVMAQCGGLECMLNRLSGINDFKQGRHLLTVLLKLFSYCVKVKINRQQLVKPEMNTLNVMLGTLNLALVAEQESK---DSGGASIAEQVLSIMEIILDEANAEISEDKGNLLLTGDKDQLVMLLDQINTPFVRSNPSVLQGLLRIIP-YLSFGEVEKMKILVERFKPYCKFDNYDEEHSADDKVFLDCFCKIAAGIKNNSNGHQLKDLILQKGITQSALDYMKKHIPNAKNLDADVWKKFLSRPALPFILRLLRGLATQHPPTQVLIGTDSITN--------------LHKLEQVSSDEGIGTLAENLLEALREHS-DVNLKIDAARRETRAEKKRMAMAMRQKALGTLGMTTNEKGQVVTKTSLLKQMEELI-EEPGLTCCICREGYKFQPTKVLGIYTFTKRVALEEFENKPRK----------QQGYSTVSHFNIVHYDCHLAAVRLARGREEWDSAALQNANTKCNGLLPVWGPHVPESAFATCLARHNTYLQECTGQREPTYQLNIHDTKLLFLRFATEQSFSVDTGGGGRESNIHLIPYVIHTVLY-VLNTTRATSREEKNLQSFQEQP---CEKWVESSYDVEGSHYYTILAMHILPPERWRSSRLYFLRRLLATSHARSVSPVFTNKL--TDKAPKEYAVYRSPLLFWGLVDLVYDMFRKVPTSN--TEGGWSFSLAEYIRHNDMPIYEASERVLRAFQDELMTAESLSEFCDVVGLLSEIPNPDVFLQDLLNSL 5142          

HSP 2 Score: 73.559 bits (179), Expect = 7.316e-108
Identity = 111/524 (21.18%), Postives = 206/524 (39.31%), Query Frame = 2
Query: 12398 SKHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYDTRLARAKNN---LVNVNESLFESNKIR------------QNCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALR----TPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNLVSENEPAIEHKSSLIFPSMPVLC-INQWLQDDSSQLFETWLQCTREENQIPRDITLNSDQGNVG-----LIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMF------VSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDSWRNGQARPGLSN 13876
            S +++  + QL  +YS D K    ++  + +++ A++K +  YD +   A        + N+    +++ R              CY C  +     I L++ L+  P +R  +     ++++        L   +++MR E+  L+  +TRD  E   ++N LI +++  AL+     P L +  +  + ++   +     C    WELRLR A+++ L        S N    VV   I L+  C+R L   +K P    K N     + A+E  +++   S  +   +  WL+ D    ++ W +C    +      T++  QG        L++K+  +W             F++    E +F          WL Q L + +  + RQA   +VE L      R + VL +L   L           D+L                      E +V+Y+ L ++L +  HW+ YL  +  L  I +L    +   L   E +     + G A   L+ 
Sbjct: 3747 SANVNRYIQQLAQEYSGDCKTSFDDLSKIIQKVLASRKELLEYDLQQREAATKSSRSSSSNQPTITASQYRALSVLGCGHTSSNKCYGCASAVTGHCITLLRALATNPALRQILVLHGLIREL----FEYNLRRGTAAMRDEVRQLICHLTRDHPEATQQMNDLIIAKVSAALKGHWANPDLVSNLQYEMLLLTDSISKEGGC----WELRLRCALSLFL-------MSVNIKTPVVVENITLM--CLRILQKLIKPPAPTSKKN----KDAAVESLTTVRPYSNEIHAQVQLWLKKDPKASYDAWKKCLLARSH----ETVSKPQGKAELRKQYLLEKYVWKW-----------KLFMRSRKGEGLFPRLLKLSHNNWLRQVLFTPATQAARQAACTIVEALTTIP-SRKQQVLDLLTSYL-----------DEL------------------SVAGECAVEYLGLYQKLIKPTHWKVYLAARGVLPYIGNLITKEIANLLTLEEATLSTDLQQGYALKSLTG 4204          

HSP 3 Score: 254.988 bits (650), Expect = 1.519e-66
Identity = 172/644 (26.71%), Postives = 307/644 (47.67%), Query Frame = 2
Query: 5831 VRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSG-FYLAEMLDWNPELYNMNRDLK--TGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIR----NEAEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQE 7741
            +R ++ +  +RR  + V+S   G    +  LAV+ +K +I + ++S LL++                   D   ++  + ++ +  +PFTVLS+  NP N+ Y+AVCGLK+  VL F+S GS+S   V+ P L   N FII ++WLPGS   L +I    V+I+DLS     P+Y+F    S+ +DATF F          + E K+   +++MS +G ++ + +D++  A  G FY+  +L+   E      DLK   G +  GG S++Y H LQ+LF SY+ G++F + ++    +  V K + + ++      ++    L  W  + +HPGL+  + Q T  P+ I V+P+ +  Q ++            ++ + +K+ D +      + E     QRT  ++L  DG ++I MAN+     +  +WLQ                 S  P      +  +   K++++    +    F         PVDFFEH +Q  EV FGG+  L++Y+ + +  R+ S    V+       ++ + N     ++ G+R+ +      + P Y E++ R + I   L + R  D    + E L  DK L + IG S +   + ++D +K++ + K    W  +  E
Sbjct: 1855 IRQLISAHVLRRVAMCVLSSPHG---RRQHLAVSHEKGKITVLQLSTLLKQ------------------ADSSKRKLTLTRLASAPVPFTVLSLTGNPCNEDYLAVCGLKDCHVLTFSSTGSVSDHLVLHPQLATGN-FIIKAVWLPGSQTELAIITADFVKIYDLSVDALSPMYYFLLPSSKIRDATFLF----------NEEGKN--IIVIMSSAGYMYTQIMDESSSAQHGPFYVTNVLEITHE------DLKDSNGQVAGGGVSVYYSHVLQMLFFSYSQGKSFAATVNRSTTD--VQKLFPITVKCSNGGSSKMSPALCQWSEVMNHPGLVCCVQQTTGIPLVIMVKPDTFLIQEIK------------TLPAKAKIQDMVAIRHTASNEQ----QRTTMILLCEDGSLRIYMANV----DNTSYWLQ----------------PSLQPSCGISVMKPVRKRKTAAATTRTSSQVTF---------PVDFFEHNQQLTEVEFGGNDLLQVYNGQQIKHRLNSTGMYVANTKPGGFTVEVVNNNSSMVMTGMRVQVGTQAIERAPSYVEVFGRTMQIN--LTRARWFDFPFTREEALQADKKLSIFIGASVDPAGVTMLDSIKIYGKTKEQFGWPEDPPE 2409          

HSP 4 Score: 171.4 bits (433), Expect = 2.620e-41
Identity = 110/420 (26.19%), Postives = 203/420 (48.33%), Query Frame = 2
Query: 10871 VNKQEAKLCRALTSKM----DNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCW----SFSYISPQLADLIGHLLTKYPNWERIESFSHQLTNDIVQSSQELLSNSC-TPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEY-DCFTGSVSNSDNVKCPRCHSASIQGN--VCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQI 12094
             + QE +LC AL +++    D   L +F++ +L E   S VRW    +  ++Y +   + +  LL      W    ++   + Q  DL+G+   K P  E+      Q   +I+++   +L+N   +  YN L  LV+  G++L+S+PC VC  P              P  N              +  +S  +        + R   T  V  L   ++I  +TVK    +R +    + L+Y++ +  +  ++ ++   W K K V ++    E+K+D P+ + A  L+ E+ D +    ++++ ++CPRC SAS+  N  VC NC +N+ QC +CR+INY   D F+C  C  C+Y R DF ++AKPC   ++ +++EE R+  +  I T  +  ++   +++  + +LE  L ++
Sbjct: 3342 ASSQEDQLCMALVNQLNKFADKETLIQFLRCFLLESNSSAVRWQAHCLTLHIYRNSSKSQQELLLELTWAIWPELPAYGRKAAQFVDLLGYFSLKTPQTEKKLKEYSQKAVEILRTQNHILTNHPNSNIYNTLSGLVEFDGFFLESDPCLVCNNPEV------------PFSN--------------IKLSSIKV--------DTRYTTTQQVVKLIGSHTISKVTVKIGDLKRTKMVRNINLFYNNRTVQAIVELKNKPARWHKAKKVQLTPGQTEVKIDLPLPIVASNLMIEFSDFYENYQASTETLQCPRC-SASVPANPGVCGNCGENVYQCHKCRSINYDEKDPFLCNACGFCKYARFDFMLYAKPCCA-VDPIENEEDRKKAVTNINTLLDKADRVYHQLMGHRPQLESLLSKV 3725          

HSP 5 Score: 127.487 bits (319), Expect = 4.523e-28
Identity = 51/81 (62.96%), Postives = 63/81 (77.78%), Query Frame = 2
Query: 4925 LDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTIS 5167
            L ++LCTF  TQKEF +QHWYHCHTC MV+  GVCT+CAKVCH  H+++YAK GSFFCDCGAK    C+AL +R+  + IS
Sbjct: 1626 LCNKLCTFTITQKEFMNQHWYHCHTCKMVDGVGVCTVCAKVCHKDHEISYAKYGSFFCDCGAKEDGSCQALVKRSPSSGIS 1706          

HSP 6 Score: 75.485 bits (184), Expect = 2.244e-12
Identity = 62/243 (25.51%), Postives = 110/243 (45.27%), Query Frame = 2
Query: 9983 ISFCLLNLDQLLILWRNQSPDQKNSEKELDTSNKILKQNLTSNQGFDVSVTF--DWLPMSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKH-YRTVRDIHLIGGSINKIKSLLNKQ--FSDHNVINRIK---LPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETI 10687
            I +CL  L  LL  W+ Q       E+E  T++++L+ + T++   D+S  F   ++     D       LLTE++LRLPY + K+  +  ++                     +  W   L E++ +  +  + +  R LL  + G+K  YR +RD+H +   +  IK LL +Q  F    V+       L +D  + L+E + +C     +R  NW+ +C K   +L FL+  S  + E +
Sbjct: 3054 IDYCLHVLKSLLEFWKGQ-----QGEEEPVTTSQLLRTH-TASSPPDMSPFFLRQYVKGHAADVFEAYSQLLTEMVLRLPYQIKKIADSNPRIPTPIF----------------DHSWFYFLSEYLMIQQTPFVRRQVRKLLLFICGSKEKYRQLRDLHTLDSHVRSIKKLLEEQGIFLRAGVVTATSGSALQYDTLINLMEHLKACAEIATQRTINWQKFCMKDDSVLYFLLQVSFLVDEGV 3274          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Medaka
Match: ENSORLT00000013865.2 (F-box only protein 11 [Source:NCBI gene;Acc:101160686])

HSP 1 Score: 56.6102 bits (135), Expect = 8.164e-7
Identity = 25/60 (41.67%), Postives = 33/60 (55.00%), Query Frame = 2
Query: 4982 WYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKG-SNFCEALTRRTNRT 5158
            +Y CHTC+  +   +C  C K CH GHD+ + +   FFCDCGA   SN C      T+ T
Sbjct:  765 FYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDT 824          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Medaka
Match: ENSORLT00000012820.2 (F-box only protein 11 [Source:NCBI gene;Acc:101167743])

HSP 1 Score: 56.6102 bits (135), Expect = 8.193e-7
Identity = 25/60 (41.67%), Postives = 33/60 (55.00%), Query Frame = 2
Query: 4982 WYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKG-SNFCEALTRRTNRT 5158
            +Y CHTC+  +   +C  C K CH GHD+ + +   FFCDCGA   SN C      T+ T
Sbjct:  814 FYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDT 873          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Medaka
Match: ENSORLT00000038994.1 (F-box only protein 11 [Source:NCBI gene;Acc:101160686])

HSP 1 Score: 56.6102 bits (135), Expect = 8.246e-7
Identity = 25/60 (41.67%), Postives = 33/60 (55.00%), Query Frame = 2
Query: 4982 WYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKG-SNFCEALTRRTNRT 5158
            +Y CHTC+  +   +C  C K CH GHD+ + +   FFCDCGA   SN C      T+ T
Sbjct:  788 FYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDT 847          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Medaka
Match: ubr5 (ubiquitin protein ligase E3 component n-recognin 5 [Source:NCBI gene;Acc:101165756])

HSP 1 Score: 54.299 bits (129), Expect = 6.251e-6
Identity = 23/59 (38.98%), Postives = 33/59 (55.93%), Query Frame = 2
Query: 4940 CTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRG-SFFCDCGAK 5113
            C+F  T  E  +Q  + C TC ++E+   CT CA+VCH GHD    +   + +CDC  K
Sbjct: 1213 CSFTWTGAEHINQDIFECRTCGLLESLCCCTECARVCHKGHDCKLKRTSPTAYCDCWEK 1271          
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Planmine SMEST
Match: SMESG000020271.1 (SMESG000020271.1)

HSP 1 Score: 8872.67 bits (23022), Expect = 0.000e+0
Identity = 4471/4499 (99.38%), Postives = 4482/4499 (99.62%), Query Frame = 2
Query:  407 FLDEENQFDVKDLIKSLRESVLNKELILCIEPHXXXXXXXXXXXXXXXXXXXQEGLLNFQNRAYNSILKMSKSDNSRPYSKLSNGLFIKMITKLYKDSDGGKIISNCLENDFKLSLAIAECTTNNYLMEIIETIKTDDDTKHNFERIDSCLAEIPDILSMIQLIKYCSFDINNLENIMSILGSVIAASYKSLLNNLAKSKHQDTNDELAGNSPLEFLNKLIIETSATFDYLHMHKPLLVFGALNILGFHKFINEATRTCKSEFENLVHNNQDFLFLSRAVLQKLNNLIIFSNKESELNWQGDNDIDITSNLTVLLKSSSRNWLCLILNDKNLQIMLFWLEILHHNAAQTITNLLEQNTLSSPPHVSTTDNILYVDDEDGPGEEYGLNHLFTDYQEKVKPSISNTSSIIRYESRNDNQKLSAQFVNEILKSMSLVVMNDDPVIHKLILQQFDEKALQSVFTLATLIDQEIINMKDSQAPSDLNELTKLFVNFINLLFSSNVINQARSVYFLSLISVQLPKDCHIKECEMPMNLELGPMTILIIMNISIHFTNPGAFQDNSIGWLKSDIYIKLMWKNIFHSIKQSTINNNYKCVDIRQELIQLYLLIFHGLTSISGKTEIVFDLLNCITDCSGFKTGVQPRLISRLLIILTYLVHHFYEQSSSLAFQIQYNLLTKYISDSINSDASNYQYDEVQIFDQKTNVIFYDISIPWIASKKFWPGLNPDSLILKNMVNHPQYESFFNGVLDGIQMCLDHRQVYDESQKFSLLSFTGSFYNILLSWRLMEVLPLPDKYQQDIPNIELSCYTRLICSFLKLRNDAKANLLSGKNNLTEELLLIDCQSETKYDLDQHIIHLIANLCERICLDIKNEPPHLPQQIYQIDMIIVSLNFILQCIKDDIDHPSTAEKPSVNTKCYLNSETSENSALSKNLIPIILNIYETLIRQIQLFISRHNCQTGLASLDLLSLTKMSSMELKFDYVNLDLLKSLNVDLEKAIDKANWKDIGKESNEITFSHIKQFLASKSFDRKFCIEHDNIIDMIRAESYRRFVFIADHCKFDSSPIGDSVKLILSTTMLAIEDLRETLNLLDNFQMEIPNIPIDSFGKYVDLIVINNINTFVPTTNLPAKSLKSIPNSIYSQVIARKLFSIFFDFHGNTSEANNAGYYDIMNQTIECLINMLDKTIDLSCLSEIVSVFLENASNESHSNIYLIFTLIFNVDRSVPIALKCSLLKLINLIFYRYKNCGXXXXXXXXXXXXNYGIHHVTNEQSNTDMIAKIKNWVQELLMNVEVPDENCKSDYLANVLLFSELLALTSYDDEDDRNLCIVICKSILQMDENVRSWLIENRNAFSTSDYSENCQLINLHIIIEMMCVISNGNCSLSVYVNVIQTLLDWNKEINKSLSKYTEHKQSYGPKMELICASLTKIYNHIGAVICALNTNYQSESMKSNLNDILYNMKPSSELYLNDFNMNQLSIDKRAIEEILFCQVKHNPNFGENDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTTISKKSQLHASQSTSIDAIKKDKPSMKSQFFEKSKYNFQTRFSKFSSNEKLLRKSYKADTKSRLTAHKMTAAADSGSCPEVTNDDESTSTNMISNAISTVFSVNQSKQVAYRNWITAVLRERIXXXXXXXXXXXXXXXXXDDCFTALQIIHESFKVQYSDWTVGKNKQMKEAFKSVRTSEKISERVTTIMGSSIQLRNAEAPSDMSGIPPTSVLASEIAGANSHVRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSGFYLAEMLDWNPELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNEAEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQEFLRSKESSKTKIQNKSSSNMEGLNKCIGHIITNCKINLSTINPYLPKPELLSSGLQLLTAFFHFKNTLNLEGRPTFXXXXXXXXXXIQTFANDVLSSFYPSTIILNAITLLACVGSIKQIESDLNPSFKKCLVSNVGHKLFSSCSDLIKKLKHEEIDPVNVLLVEATITRLAHLINLHKYWMSIEEENWPQLSYLEIFDLMTTCIELITKYHAVCSSVQPDMGTDSEIVILANFINPVYCQKLDCLPSLIPFIIKGLLNFNFMNTENTSTSSDANHSATVSVQIKLTDLLINMLIDSNLTISHNTRRSLNYFMKLSDKKFIDNNSPEKKIDDVNQTSELKQLKKEPIENSDQNVQEFGQILQSIDTAAINTDDMQTLSILLXXXXXXXXXXXXXXXXXXXXREYFCRAADDEWMVAVSNSESNSLGGSTLANDATNFFQQIDTEAVPTMAEVMQEMIDNADDQRMLDYALRKSLEDQGGSSNDANIEGGAASNISQIFLDSRSLRTDPISSIYTEEEQQSLNNTGTPTIDNWGMNKTNKKNSKQAENLSTPDREYSESNSESDIATYAMLKNASITSKLSPNNSQKVFLVCIQKFGIQFIKRIIVKWSSLMISLQGTRVITLYKSVLDVIRYMDMRDEEARSVVQNLVELMLDLVLGIKKDDDQLTILEYDTNEKRIHCQSICVVLRTLLNFILSGSKIQTIVPPIKEDNNSTAAEGKPTPSSCFNQVFTQDSVAFITLKLAYEKKLISFCLLNLDQLLILWRNQSPDQKNSEKELDTSNKILKQNLTSNQGFDVSVTFDWLPMSDIDSTFDMHLLLTELILRLPYAVLKLCRNTL---KVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKHYRTVRDIHLIGGSINKIKSLLNKQFSDHNVINRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETIGXXXXXXXXXXXXXXXXXXXXXXTASSNPPXXXXXXXXXXXXXXXXXDKNTQRKSAGSAPEVNKQEAKLCRALTSKMDNTVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCWSFSYISPQLADLIGHLLTKYPNWERIESFSHQLTNDIVQSSQELLSNSCTPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEYDCFTGSVSNSDNVKCPRCHSASIQGNVCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITSGTNISGLGTTKLPVSGGKTYAEVTGASAMDDSGLPAKSYRRIRRAAGGENEPEKESTKPPNVNPITTAETVKEEKKDSHSKHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYDTRLARAKNNLVNVNESLFESNKIRQNCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPREXXXXXXXXXXXXXXACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNLVSENEPAIEHKSSLIFPSMPVLCINQWLQDDSSQLFETWLQCTREENQIPRDITLNSDQGNVGLIQKFASRWFNXXXXXXXXXXXXXXXXNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDSWRNGQARPGLSNGGWVAI 13894
            FLDEENQFDVKDLIKSLRESVLNKELILCIEPHSNIDNKIITNNISISSNMIQEGLLNFQNRAYNSILKMSKSDNSRPYSKLSNGLFIKMITKLYKDSDGGKIISNCLENDFKLSLAIAECTTNNYLMEIIETIKTDDDTKHNFERIDSCLAEIPDILSMIQLIKYCSFDINNLENIMSILGSVIAASYKSLLNNLAKSKHQDTNDELAGNSPLEFLNK IIETSATFDYLHMHKPLLVFGALNILGFHKFINEATRTCK EFENLVHNNQDFLFLSRAVLQKLNNLIIFSNKESELNWQGDNDIDITSNLTVLLKSSSRNWLCLILNDKNLQIMLFWLEILHHNAAQTITNLLEQNTLSSPPHVSTTDNILYVDDEDGPGEEYGLNHLFTDYQEKVKPSISNTSSIIRYESRNDNQKLSAQFVNEILKSMSLVVMN+DPVIHKLILQQFDEKALQSVFTLATLIDQEIINMKDSQAPSDLNELTKLFVNFINLLFSSNVINQARSVYFLSLISVQLPKDC IKECEMPMNLELGPMTILIIMNISIHFTNPGAFQDNSIGWLKSDIYIKLMWKNIFHSIKQSTINNNYKCVDIRQELIQLYLLIFHGLTSISGKTEIVFDLLNCIT CSGFKTGVQPRLISRLLIILTYLVHHFYEQSSSLAFQIQYNLLTKYISDSINSDASNYQYDEVQIFDQKTNVIFYDISIPWIASKKFWPGLNPDSLILKNMVNHPQYESF+NGVLDGIQMCLDHRQVYDESQKFSLLSFTGSFYNILLSWRLMEVLPLPDKYQQDIPNIELSCYTRLICSFLKLRNDAKANLLSGKNNLTEELLLIDCQSETKYDLDQHIIHLIANLCERICLDIKNEP HLPQQIYQIDMIIVSLNFILQCIKDDIDHPSTAEKPSVNTKCYLNSETSENSALSKNLIPIILNIYETLIRQIQLFISRHNCQTGLASLDLLSLTKMSSMELKFDYVNLDLLKSLNV+LEKAIDKANWKDIGKESNEITFSHIKQFLASKSFDRKFCIEHDNIIDMIRAESYRRFVFIADHCKFDSSPIGDSVKLILSTTMLAIEDLRETLNLLDNFQMEIPNIPIDSFGKYVDLIVINNINTFVPTTNLPAKSLKSIPNSIYSQVIARKLFSIFFDFHGNTSEANNAGYYDIMNQTIECLINMLDKTIDLSCLSEIVSVFLENASNESHSNIYLIFTLIFNVDRSVPIALKCSLLKLINLIFYRYKNCGKDKQLQDILKKLNYGIHHVTNEQSNTDMIAKIKNWVQELLMNVEVPDENCKSDYLANVLLFSELLALTSYDDEDDRNLCIVICKSILQMDENVRSWLIENRNAFSTSDYSENCQLINLHIIIEMMCVISNGNCSLSVYVNVIQTLLDWNKEINKSLSKYTEHK+SYGPKMELICASLTKIYNHIGAVICALNTNYQSESMKSNLNDILYNMKPSSELYLNDFNMNQLSIDKRAIEEILFCQVKHNPNFGENDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRT ISKKSQLHASQSTSIDAIKKDKPSMKSQFFEKSKYNFQTRFSKFSSNEKLLRKSYKADTKSRLTAHKMTAAADSGSCPEVTNDDESTSTNMISNAISTVFSVNQSKQVAYRNWITAVLRERILKENETLTILLETSTLLDDCFTALQIIHESFKVQYSDWTVGKNKQMKEAFKSVRTSEKISERVTTIMGSSIQLRNAEAPSDMSGIPPTSVLASEIAGANSHVRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMD+ESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSGFYLAEMLDWNPELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNEAEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDS+IVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQEFLRSKESSKTKIQNKSSSNMEGLNKCIGHIITNCKINLSTINPYLPKPELLSSGLQLLTAFFHFKNTLN+EGRPTFSSSEVVTSSVIQTFANDVLSSFYPSTIILNAITLLACVGSIKQIESDL+PSFKKCL+SNVGHKLFSSCSDLIKKLKHEEIDPVNVLLVEATITRLAHLINLHKYWM IEEENWPQLSYLEIFDLMTTCIELITKYHAVCSSVQPDMGTDSEIVILANFINPVYCQKLDCLPSLIPFIIKGLLNFNFMNTENTSTSSDANHSATVSVQIKLTDLLINMLIDSNLTISHNTRRSLNYFMKLSDKKFIDNNSPEKKIDD NQTSELKQLKKEPIENSDQNVQEFGQILQSIDTAAINTDDMQTLSILLPDNPEGPSNDNEPDEEEMDDREYFCRAADDEWMVAVSNSESNSLGGSTLANDATNFFQQIDTEAVPTMAEVMQEMIDNADDQRMLDYALRKSLEDQGGSSNDANIEGGAASNISQIFLDSRSLRTDPISSIYTEEEQQSLNN GTPTIDNWGMNKTNKKNSKQAENLSTPDREYSESNSESDIATYAMLKNASITSKLSPNNSQKVFLVCIQKFGIQFIKRIIVKWSSLMISLQGTRVITLYKS+LDVIRYMDMRDEEARSVVQNLVELMLDLVLGIKKDDDQLTILEYDTNEKRIHCQSICVVLRTLLNFILSGSKIQTIVPPIKEDNNSTAAEGKPTP SCFNQVFTQDSVAFITLKLAYEKKLISFCLLNLDQLLILWRNQSPDQKN EKELDTSNKILKQNLTSNQGFDVSVTFDWLPMSDIDSTFDMHLLLTELILRLPYAVLKLCRNTL   KVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKHYRTVRDIHLIGGSINKIKSLLNKQFSDHNVINRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETIGLKLLYLLQLALLESESSKLKKETASSNPP GTSAAVTSVITSSKTADKNTQRKSAGSAPEVNKQEAKLCRALTSKMDN VLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCWSFSYISPQLADLIGHLLTKYPNWERIESFSHQLTNDIVQSSQELLSNSCTPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEYDCFTGSVSNSDNVKCPRCHSASIQGNVCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITSGTNISGLGTTKLPVSGGKTYAEVTGASAMDDSGLPAKSYRRIRRAAGGENEPEKESTKPPNVNPITTAETVKEEKKDSHSKHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYDTRLARAKNNLVNVNESLFESNKIRQNCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPRESRIKVIISLLKSSIACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNL SENEPAIEHKSSLIFPSMPVLCINQWLQDDSSQLFETWLQCTREENQIPRDITLNS+QGNVGLIQKFASRWFNKVQKKKLSKVKFIKLVNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDSWRNGQARPGLSNGGWVAI
Sbjct:    4 FLDEENQFDVKDLIKSLRESVLNKELILCIEPHSNIDNKIITNNISISSNMIQEGLLNFQNRAYNSILKMSKSDNSRPYSKLSNGLFIKMITKLYKDSDGGKIISNCLENDFKLSLAIAECTTNNYLMEIIETIKTDDDTKHNFERIDSCLAEIPDILSMIQLIKYCSFDINNLENIMSILGSVIAASYKSLLNNLAKSKHQDTNDELAGNSPLEFLNKFIIETSATFDYLHMHKPLLVFGALNILGFHKFINEATRTCKLEFENLVHNNQDFLFLSRAVLQKLNNLIIFSNKESELNWQGDNDIDITSNLTVLLKSSSRNWLCLILNDKNLQIMLFWLEILHHNAAQTITNLLEQNTLSSPPHVSTTDNILYVDDEDGPGEEYGLNHLFTDYQEKVKPSISNTSSIIRYESRNDNQKLSAQFVNEILKSMSLVVMNEDPVIHKLILQQFDEKALQSVFTLATLIDQEIINMKDSQAPSDLNELTKLFVNFINLLFSSNVINQARSVYFLSLISVQLPKDCQIKECEMPMNLELGPMTILIIMNISIHFTNPGAFQDNSIGWLKSDIYIKLMWKNIFHSIKQSTINNNYKCVDIRQELIQLYLLIFHGLTSISGKTEIVFDLLNCITACSGFKTGVQPRLISRLLIILTYLVHHFYEQSSSLAFQIQYNLLTKYISDSINSDASNYQYDEVQIFDQKTNVIFYDISIPWIASKKFWPGLNPDSLILKNMVNHPQYESFYNGVLDGIQMCLDHRQVYDESQKFSLLSFTGSFYNILLSWRLMEVLPLPDKYQQDIPNIELSCYTRLICSFLKLRNDAKANLLSGKNNLTEELLLIDCQSETKYDLDQHIIHLIANLCERICLDIKNEPAHLPQQIYQIDMIIVSLNFILQCIKDDIDHPSTAEKPSVNTKCYLNSETSENSALSKNLIPIILNIYETLIRQIQLFISRHNCQTGLASLDLLSLTKMSSMELKFDYVNLDLLKSLNVELEKAIDKANWKDIGKESNEITFSHIKQFLASKSFDRKFCIEHDNIIDMIRAESYRRFVFIADHCKFDSSPIGDSVKLILSTTMLAIEDLRETLNLLDNFQMEIPNIPIDSFGKYVDLIVINNINTFVPTTNLPAKSLKSIPNSIYSQVIARKLFSIFFDFHGNTSEANNAGYYDIMNQTIECLINMLDKTIDLSCLSEIVSVFLENASNESHSNIYLIFTLIFNVDRSVPIALKCSLLKLINLIFYRYKNCGKDKQLQDILKKLNYGIHHVTNEQSNTDMIAKIKNWVQELLMNVEVPDENCKSDYLANVLLFSELLALTSYDDEDDRNLCIVICKSILQMDENVRSWLIENRNAFSTSDYSENCQLINLHIIIEMMCVISNGNCSLSVYVNVIQTLLDWNKEINKSLSKYTEHKKSYGPKMELICASLTKIYNHIGAVICALNTNYQSESMKSNLNDILYNMKPSSELYLNDFNMNQLSIDKRAIEEILFCQVKHNPNFGENDLINSESEEEKIMKLNPLDDQLCTFAATQKEFTDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGSNFCEALTRRTNRTAISKKSQLHASQSTSIDAIKKDKPSMKSQFFEKSKYNFQTRFSKFSSNEKLLRKSYKADTKSRLTAHKMTAAADSGSCPEVTNDDESTSTNMISNAISTVFSVNQSKQVAYRNWITAVLRERILKENETLTILLETSTLLDDCFTALQIIHESFKVQYSDWTVGKNKQMKEAFKSVRTSEKISERVTTIMGSSIQLRNAEAPSDMSGIPPTSVLASEIAGANSHVRGMLQSGYVRRNVLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNGNMDEESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVSVLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQIFDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLVMSESGCIHCKKLDKTCMASSGFYLAEMLDWNPELYNMNRDLKTGVLGKGGASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNEAEFDCTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSENDITDISVASLSKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKILMANIRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSSSSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEVLNLRMLSQDHSVSVACKNPVSLVITNKKPDSVIVGVRIGINVTDPTKIPKYFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDIIVIDYVKVFVRLKSSLLWLNEKQEFLRSKESSKTKIQNKSSSNMEGLNKCIGHIITNCKINLSTINPYLPKPELLSSGLQLLTAFFHFKNTLNIEGRPTFSSSEVVTSSVIQTFANDVLSSFYPSTIILNAITLLACVGSIKQIESDLDPSFKKCLLSNVGHKLFSSCSDLIKKLKHEEIDPVNVLLVEATITRLAHLINLHKYWMCIEEENWPQLSYLEIFDLMTTCIELITKYHAVCSSVQPDMGTDSEIVILANFINPVYCQKLDCLPSLIPFIIKGLLNFNFMNTENTSTSSDANHSATVSVQIKLTDLLINMLIDSNLTISHNTRRSLNYFMKLSDKKFIDNNSPEKKIDDANQTSELKQLKKEPIENSDQNVQEFGQILQSIDTAAINTDDMQTLSILLPDNPEGPSNDNEPDEEEMDDREYFCRAADDEWMVAVSNSESNSLGGSTLANDATNFFQQIDTEAVPTMAEVMQEMIDNADDQRMLDYALRKSLEDQGGSSNDANIEGGAASNISQIFLDSRSLRTDPISSIYTEEEQQSLNNIGTPTIDNWGMNKTNKKNSKQAENLSTPDREYSESNSESDIATYAMLKNASITSKLSPNNSQKVFLVCIQKFGIQFIKRIIVKWSSLMISLQGTRVITLYKSILDVIRYMDMRDEEARSVVQNLVELMLDLVLGIKKDDDQLTILEYDTNEKRIHCQSICVVLRTLLNFILSGSKIQTIVPPIKEDNNSTAAEGKPTPLSCFNQVFTQDSVAFITLKLAYEKKLISFCLLNLDQLLILWRNQSPDQKNPEKELDTSNKILKQNLTSNQGFDVSVTFDWLPMSDIDSTFDMHLLLTELILRLPYAVLKLCRNTLKEIKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNISEHITKASRTLLNSVVGAKHYRTVRDIHLIGGSINKIKSLLNKQFSDHNVINRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSVSLHETIGLKLLYLLQLALLESESSKLKKETASSNPPAGTSAAVTSVITSSKTADKNTQRKSAGSAPEVNKQEAKLCRALTSKMDNIVLAEFVKVYLCEHEDSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCWSFSYISPQLADLIGHLLTKYPNWERIESFSHQLTNDIVQSSQELLSNSCTPFYNCLQRLVKLPGYYLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTASTAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVTLYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLIFEYDCFTGSVSNSDNVKCPRCHSASIQGNVCLNCRDNINQCFRCRAINYAGIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTWSETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITSGTNISGLGTTKLPVSGGKTYAEVTGASAMDDSGLPAKSYRRIRRAAGGENEPEKESTKPPNVNPITTAETVKEEKKDSHSKHIHDALNQLILKYSTDAKEQQLEIGCLWRQLWAAKKAVANYDTRLARAKNNLVNVNESLFESNKIRQNCYACLLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSMRQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPRESRIKVIISLLKSSIACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIALIQACMRFLVGKLKQPVLIKKPNLASENEPAIEHKSSLIFPSMPVLCINQWLQDDSSQLFETWLQCTREENQIPRDITLNSEQGNVGLIQKFASRWFNKVQKKKLSKVKFIKLVNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGYQSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQMTNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQVEESCLDSWRNGQARPGLSNGGWVAI 4502          

HSP 2 Score: 1890.16 bits (4895), Expect = 0.000e+0
Identity = 956/960 (99.58%), Postives = 957/960 (99.69%), Query Frame = 1
Query: 13933 QEIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTSDIRLDLICDKKVLMYDLLLEDIYEHVWLCSDANNKSRPMRLTVRISGLVEDNMPYVESLRKEVPLEHYQRSNELIEGGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVXXXXXXXXXXXXXXXDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHKNSRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDALKEGIKLDLKRPDTIXXXXXXXXXXXXXXGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVXXXXXXXXXXXXXXXEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVVNENEWVVAQRHNQNAKCNSLMPILGPHPDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVLTELKDVKQ 16812
            QEIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTSDIRLDLICDKKVLMYDLLLEDIYEHVWLCSD+NNKSRPMRLTVRISGLVEDNMPYVESLRKEVPLEHYQRSNELIEGGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVKVLLQCLLVCLKGGLDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHKNSRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDALKEGIKLDLKRPDTIAFLEQQALQFLLVLGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVLTSSSLLKDLSSQVLEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVVNENEWVVAQRHNQNAKCNSLMPILGPHPDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQ G GCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAV TELKDVKQ
Sbjct: 4516 QEIPAIAYKYRTTIVKCLLTSSLNMRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPVTDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSLSSQSFGHNPTVNDVINFLVRENGVTSDIRLDLICDKKVLMYDLLLEDIYEHVWLCSDSNNKSRPMRLTVRISGLVEDNMPYVESLRKEVPLEHYQRSNELIEGGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGLDTVKVLLQCLLVCLKGGLDEKRMTEYEESTVVPLINLLCRILTLGRAGSITQQNHMINQVENMHAIPILLDYIHKNSRVELYQKHITKIPALLAFQFSHEMVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRHHMMEKGLLNICIDFLVAVAPEDALKEGIKLDLKRPDTIAFLEQQALQFLLVLGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLNALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVLTSSSLLKDLSSQVLEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDLMSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVVNENEWVVAQRHNQNAKCNSLMPILGPHPDNNFKANLNRYQTSIWNNTNVPEINYQLMVHDLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLINKEMQAMSKWLEQVGSGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHRVQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSFYNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLPCESLSEFWDVIELGYNIPFEEDYLSAVFTELKDVKQ 5475          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UBR41.175e-10827.22ubiquitin protein ligase E3 component n-recognin 4... [more]
UBR41.116e-9027.46ubiquitin protein ligase E3 component n-recognin 4... [more]
UBR41.548e-6526.97ubiquitin protein ligase E3 component n-recognin 4... [more]
UBR45.331e-2831.41ubiquitin protein ligase E3 component n-recognin 4... [more]
UBR41.109e-1222.76ubiquitin protein ligase E3 component n-recognin 4... [more]
back to top
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ubr-42.036e-2425.00UBR E3 ubiquitin ligase homolog [Source:UniProtKB... [more]
ubr-42.036e-2425.00UBR E3 ubiquitin ligase homolog [Source:UniProtKB... [more]
ubr-41.456e-2324.77UBR E3 ubiquitin ligase homolog [Source:UniProtKB... [more]
ubr-41.505e-2324.77UBR E3 ubiquitin ligase homolog [Source:UniProtKB... [more]
dre-11.332e-638.98F-box protein dre-1 [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
poe3.938e-9026.75gene:FBgn0011230 transcript:FBtr0079545[more]
poe3.938e-9026.75gene:FBgn0011230 transcript:FBtr0333088[more]
FBXO117.857e-827.20gene:FBgn0037760 transcript:FBtr0334684[more]
FBXO117.857e-827.20gene:FBgn0037760 transcript:FBtr0082155[more]
back to top
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ubr41.115e-11127.53ubiquitin protein ligase E3 component n-recognin 4... [more]
ubr41.542e-11127.53ubiquitin protein ligase E3 component n-recognin 4... [more]
CT027552.12.714e-11027.53ubiquitin protein ligase E3 component n-recognin 4... [more]
fbxo11a1.327e-729.89F-box protein 11a [Source:ZFIN;Acc:ZDB-GENE-061103... [more]
fbxo11a8.247e-741.67F-box protein 11a [Source:ZFIN;Acc:ZDB-GENE-061103... [more]
back to top
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UBR41.283e-10827.51ubiquitin protein ligase E3 component n-recognin 4... [more]
UBR41.208e-9027.57ubiquitin protein ligase E3 component n-recognin 4... [more]
smad21.205e-641.67SMAD family member 2 [Source:Xenbase;Acc:XB-GENE-4... [more]
smad21.279e-641.67SMAD family member 2 [Source:Xenbase;Acc:XB-GENE-4... [more]
smad21.307e-641.67SMAD family member 2 [Source:Xenbase;Acc:XB-GENE-4... [more]
back to top
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ubr42.720e-10826.91ubiquitin protein ligase E3 component n-recognin 4... [more]
Ubr42.789e-10826.91ubiquitin protein ligase E3 component n-recognin 4... [more]
Ubr47.819e-6626.97ubiquitin protein ligase E3 component n-recognin 4... [more]
Ubr42.426e-4226.65ubiquitin protein ligase E3 component n-recognin 4... [more]
Fbxo111.056e-641.67F-box protein 11 [Source:MGI Symbol;Acc:MGI:214713... [more]
back to top
BLAST of E3 ubiquitin-protein ligase UBR4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5T4S7|UBR4_HUMAN5.212e-10827.22E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens O... [more]
sp|A2AN08|UBR4_MOUSE1.697e-10726.91E3 ubiquitin-protein ligase UBR4 OS=Mus musculus O... [more]
sp|Q2TL32|UBR4_RAT3.299e-10727.22E3 ubiquitin-protein ligase UBR4 OS=Rattus norvegi... [more]
sp|Q29L39|POE_DROPS5.382e-8526.14Protein purity of essence OS=Drosophila pseudoobsc... [more]
sp|Q9VLT5|POE_DROME9.713e-8326.75Protein purity of essence OS=Drosophila melanogast... [more]
back to top
BLAST of E3 ubiquitin-protein ligase UBR4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9K8S71.052e-16127.35UBR-type domain-containing protein OS=Biomphalaria... [more]
A0A553PBK62.090e-14627.54UBR-type domain-containing protein OS=Tigriopus ca... [more]
A0A0K2UE412.290e-12725.28Protein purity of essencelike [Megachile rotundata... [more]
A0A5K3EWD44.044e-12132.61Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3PBK21.215e-12031.13Uncharacterized protein (Fragment) OS=Schistocepha... [more]
back to top
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ubr44.563e-11127.57ubiquitin protein ligase E3 component n-recognin 4... [more]
FBXO116.930e-741.67F-box only protein 11-like [Source:NCBI gene;Acc:1... [more]
fbxo11a7.287e-741.67F-box protein 11 [Source:NCBI gene;Acc:103042797][more]
fbxo11a8.501e-741.67F-box protein 11 [Source:NCBI gene;Acc:103042797][more]
ubr51.010e-634.34ubiquitin protein ligase E3 component n-recognin 5... [more]
back to top
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000006884.16.055e-843.33pep scaffold:Pmarinus_7.0:GL479707:44391:56944:-1 ... [more]
ENSPMAT00000002570.11.188e-638.98pep scaffold:Pmarinus_7.0:GL481077:241:22857:1 gen... [more]
ENSPMAT00000002561.11.735e-638.98pep scaffold:Pmarinus_7.0:GL481077:241:24166:1 gen... [more]
back to top
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO434294.381e-15126.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434302.024e-5726.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ubr47.316e-10826.93ubiquitin protein ligase E3 component n-recognin 4... [more]
ENSORLT00000013865.28.164e-741.67F-box only protein 11 [Source:NCBI gene;Acc:101160... [more]
ENSORLT00000012820.28.193e-741.67F-box only protein 11 [Source:NCBI gene;Acc:101167... [more]
ENSORLT00000038994.18.246e-741.67F-box only protein 11 [Source:NCBI gene;Acc:101160... [more]
ubr56.251e-638.98ubiquitin protein ligase E3 component n-recognin 5... [more]
back to top
BLAST of E3 ubiquitin-protein ligase UBR4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000020271.10.000e+099.38SMESG000020271.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017151 ID=SMED30017151|Name=E3 ubiquitin-protein ligase UBR4|organism=Schmidtea mediterranea sexual|type=transcript|length=17018bp
CGCTATTTATCAAATTTAAATGAATGATATCAATTTACAAACCAAAAATG
TTGTCCAGTTATTTATTATTAATCCTAGAGAGTTTTCAAAGCTTAGCTCT
CTAGATTTTGATTTTTTAAAAGATTTATTAATAAAAATTAATACAGAGAA
AGACAATGCAGTTAATGATAAAATTAATACAATAACTATATCACTTGAAC
TCATAAAAGCTATAGTTATAAATAATTTTCCATGCAATGTTGAAGGCTTA
TTTAAATTTTTAATCGGAAAGTCTTTAGATCTTATTCATTTTAAATCATC
CAGATATACTGTTACCTCGTTACTTCTTAAAATAATTGAAGAAGAATTTA
GTTCAAACGAAAAATATGTGGATAATAATAAAAATATCATCAAAAAAATG
AATATTTTTTTGGATGAAGAAAACCAATTTGATGTTAAAGATTTGATCAA
ATCCCTACGGGAAAGTGTATTAAACAAGGAATTAATTCTTTGTATTGAAC
CTCATTCCAATATTGATAATAAAATAATAACAAATAATATCAGTATTTCG
TCTAATATGATTCAAGAAGGCTTATTGAATTTTCAAAATAGAGCATATAA
TTCAATTTTGAAGATGTCAAAATCGGATAATTCAAGACCATATTCAAAAC
TGTCTAACGGCTTATTCATTAAAATGATAACAAAATTATATAAAGATTCT
GATGGAGGGAAAATAATTTCAAATTGCTTGGAAAACGATTTCAAACTGTC
GCTGGCTATTGCCGAGTGTACAACGAATAATTATCTAATGGAAATCATTG
AAACCATTAAAACGGATGATGATACGAAACACAACTTTGAAAGAATCGAT
AGTTGTCTAGCAGAAATTCCAGATATTTTGTCAATGATCCAATTAATTAA
ATATTGTTCATTTGACATAAATAACCTTGAAAATATTATGTCGATTCTCG
GTTCAGTAATTGCGGCTAGCTATAAATCTTTGTTGAATAATCTTGCAAAA
TCCAAGCACCAAGATACAAATGATGAATTGGCAGGCAATTCCCCGTTAGA
ATTCTTGAATAAACTTATAATCGAGACAAGCGCCACGTTTGACTATTTAC
ACATGCACAAGCCATTGTTGGTTTTTGGAGCCTTAAACATTCTCGGATTT
CACAAGTTTATCAATGAAGCTACCAGAACATGCAAATCGGAATTCGAAAA
TTTAGTGCACAATAATCAGGATTTCCTTTTTCTATCAAGAGCCGTGCTGC
AAAAATTAAATAATCTTATTATTTTTTCTAATAAAGAATCCGAATTAAAT
TGGCAAGGAGACAATGACATTGACATAACTTCAAACCTCACTGTACTGTT
GAAAAGTTCCTCAAGAAATTGGTTATGTTTGATTTTAAATGATAAAAATC
TTCAAATTATGTTATTTTGGCTTGAAATTCTTCATCACAACGCAGCGCAA
ACGATAACAAATTTGCTGGAACAAAATACATTATCTTCTCCTCCTCACGT
ATCCACGACAGATAATATTCTGTATGTTGATGATGAGGATGGCCCAGGAG
AAGAGTACGGATTAAACCATCTGTTTACTGATTATCAAGAAAAGGTGAAA
CCCTCAATATCAAATACCTCATCTATAATTCGATACGAATCAAGAAATGA
CAATCAAAAATTATCTGCACAATTTGTCAATGAAATTCTAAAATCAATGT
CTTTAGTAGTTATGAATGATGATCCAGTTATCCATAAATTAATTCTTCAG
CAATTCGATGAAAAAGCACTACAATCGGTGTTTACTTTGGCTACATTAAT
TGACCAAGAAATCATAAATATGAAAGATTCCCAAGCTCCAAGCGATCTAA
ACGAATTAACGAAATTATTTGTAAATTTCATCAATCTGTTGTTTTCTTCA
AATGTTATCAACCAAGCTCGAAGTGTTTATTTTCTTTCACTGATATCCGT
GCAATTGCCGAAAGATTGTCATATCAAAGAATGTGAAATGCCAATGAATC
TGGAATTGGGACCGATGACAATATTAATCATAATGAATATCAGCATTCAC
TTTACTAATCCAGGAGCATTTCAGGATAATTCAATTGGCTGGCTAAAATC
TGATATTTACATTAAATTAATGTGGAAAAATATTTTCCATTCAATTAAAC
AATCGACAATAAATAACAATTACAAATGCGTCGATATTCGCCAGGAATTA
ATTCAGCTCTACCTTCTTATTTTCCACGGCCTCACTTCAATTAGTGGTAA
AACGGAAATCGTTTTCGATTTGCTCAATTGCATAACTGACTGCTCCGGTT
TCAAAACCGGAGTACAACCAAGACTAATTTCTCGTCTATTGATTATTCTA
ACCTACTTAGTCCATCATTTCTATGAGCAATCTTCGAGTTTAGCTTTCCA
AATCCAATATAATCTATTAACGAAATACATATCTGACTCGATCAATTCCG
ATGCAAGCAATTACCAGTATGATGAGGTGCAGATTTTCGATCAGAAAACA
AATGTCATCTTTTACGATATTTCGATTCCGTGGATTGCTAGCAAAAAATT
TTGGCCCGGATTGAATCCCGACAGTTTGATATTGAAAAACATGGTCAACC
ATCCACAATATGAATCGTTTTTCAACGGAGTACTAGATGGGATTCAGATG
TGCTTGGATCATCGCCAAGTCTATGATGAGTCACAGAAATTTTCCCTGCT
ATCTTTCACTGGCTCTTTTTATAATATCCTCTTGAGCTGGCGGCTAATGG
AAGTGCTGCCCTTACCAGATAAATATCAGCAGGATATCCCAAATATTGAA
CTTAGTTGCTATACAAGGCTAATCTGTAGCTTTCTGAAATTGCGAAACGA
TGCCAAAGCAAATTTGTTATCAGGAAAGAATAATTTGACGGAAGAATTGT
TGCTAATCGATTGTCAAAGTGAAACCAAATATGATCTTGATCAACATATT
ATTCATCTGATCGCTAATTTATGTGAAAGAATTTGCCTCGATATAAAAAA
TGAACCACCACATCTACCTCAACAAATATATCAAATCGATATGATAATTG
TCTCTCTAAATTTCATTTTACAATGCATAAAAGACGATATTGATCACCCG
AGTACAGCGGAAAAACCCTCGGTTAATACGAAATGCTATCTGAATTCCGA
AACCAGTGAAAATTCGGCATTATCTAAAAATTTGATTCCAATAATATTGA
ATATATACGAAACATTAATCCGACAAATTCAATTGTTTATTTCCAGGCAT
AATTGTCAAACGGGACTGGCCAGTCTCGATTTATTATCGTTAACCAAAAT
GTCTTCAATGGAATTAAAATTCGATTATGTTAATTTAGATCTCTTGAAGT
CATTGAATGTAGATCTGGAAAAGGCTATAGATAAAGCAAATTGGAAAGAT
ATTGGAAAAGAATCAAACGAGATAACATTTAGCCATATAAAACAATTCTT
AGCATCGAAATCTTTCGATAGGAAATTTTGCATAGAACATGATAACATTA
TTGACATGATTCGAGCAGAAAGCTATCGACGATTTGTTTTCATAGCTGAT
CATTGTAAATTTGACAGCAGTCCTATTGGTGATTCGGTTAAACTGATATT
ATCAACGACAATGCTCGCAATCGAAGATCTGAGAGAAACACTGAATTTAC
TCGACAATTTCCAGATGGAAATACCGAATATTCCGATCGATTCCTTTGGG
AAATATGTGGATCTCATTGTGATCAATAACATAAACACATTTGTTCCAAC
GACCAATTTGCCGGCGAAATCTCTGAAATCAATTCCAAATTCAATATACA
GCCAAGTGATTGCGAGGAAATTGTTCAGCATATTCTTTGATTTTCATGGC
AACACTTCTGAGGCAAATAACGCCGGCTATTATGACATCATGAATCAAAC
TATTGAATGCTTAATAAACATGCTGGACAAAACCATCGATCTTTCTTGTC
TCAGTGAAATTGTATCGGTTTTCCTGGAAAACGCCTCAAATGAATCGCAT
TCCAATATCTATCTGATATTCACGTTGATTTTCAACGTGGATAGGTCGGT
TCCAATCGCCCTCAAGTGCTCACTTTTGAAATTAATCAATCTTATATTCT
ATCGATACAAAAATTGCGGAAAGGATAAACAGCTGCAAGACATATTAAAG
AAACTCAATTATGGCATTCACCATGTGACCAATGAACAGTCTAACACTGA
CATGATTGCTAAAATTAAGAACTGGGTTCAAGAACTCCTAATGAATGTTG
AAGTGCCCGATGAAAATTGTAAATCAGATTATTTAGCAAATGTACTGCTG
TTTTCGGAATTATTAGCGCTAACCAGTTATGACGATGAAGATGATAGAAA
TTTATGCATTGTCATTTGCAAATCTATTCTTCAAATGGATGAAAATGTTC
GATCCTGGCTGATAGAGAACAGAAATGCTTTTTCTACATCAGATTACAGT
GAAAATTGCCAGCTAATCAATTTGCATATAATAATCGAAATGATGTGTGT
TATTAGTAATGGGAATTGCTCCCTTTCCGTGTACGTTAATGTTATTCAAA
CATTACTCGACTGGAATAAAGAAATCAACAAATCCCTGTCTAAATATACA
GAACATAAACAAAGTTATGGCCCAAAAATGGAATTAATATGTGCTTCATT
AACAAAGATTTATAACCATATCGGTGCAGTTATATGCGCTCTTAATACAA
ATTATCAATCAGAAAGTATGAAATCAAATTTAAATGACATACTTTATAAC
ATGAAACCGAGCTCGGAATTGTATTTAAACGATTTCAATATGAATCAGTT
ATCCATTGATAAAAGAGCAATTGAAGAAATTTTGTTTTGTCAAGTTAAGC
ATAATCCAAATTTTGGTGAAAATGATCTTATAAATTCTGAATCAGAGGAA
GAAAAAATAATGAAATTAAATCCATTAGATGATCAATTATGCACTTTTGC
AGCTACTCAAAAAGAGTTCACTGATCAGCATTGGTATCATTGTCATACTT
GTTCAATGGTTGAAAATGAAGGTGTTTGCACTATCTGTGCTAAAGTTTGT
CATTTAGGACATGATCTAACATATGCTAAAAGAGGGAGTTTTTTCTGTGA
TTGTGGTGCTAAAGGGTCTAATTTTTGTGAAGCCTTAACAAGAAGAACAA
ACAGAACCACCATTTCGAAAAAATCTCAATTGCATGCATCTCAATCGACA
TCAATTGATGCCATTAAAAAAGATAAACCTTCAATGAAAAGCCAATTTTT
CGAAAAATCAAAATATAATTTCCAAACTAGATTCTCGAAATTTTCATCAA
ATGAAAAGCTGCTTCGCAAAAGTTACAAAGCTGATACGAAAAGTCGATTA
ACAGCTCATAAAATGACCGCAGCAGCCGATTCTGGCTCATGCCCGGAAGT
AACAAATGATGATGAAAGTACTTCGACCAATATGATATCTAATGCCATAT
CTACGGTATTTTCTGTCAACCAATCAAAACAAGTTGCCTATCGAAATTGG
ATAACAGCGGTATTGAGAGAACGAATTTTAAAAGAAAACGAAACTTTAAC
AATTCTTCTTGAAACATCAACCCTATTGGATGATTGCTTTACAGCGCTGC
AAATAATTCACGAATCATTTAAAGTTCAATATTCCGATTGGACTGTCGGG
AAAAATAAACAAATGAAAGAAGCGTTTAAAAGTGTGCGAACTAGTGAGAA
AATCAGTGAAAGGGTTACTACTATTATGGGATCAAGTATTCAATTGAGAA
ATGCTGAAGCACCATCAGACATGTCTGGAATTCCACCGACAAGTGTATTA
GCCAGTGAAATTGCTGGAGCGAACAGTCACGTCCGTGGAATGTTGCAATC
TGGTTATGTGAGACGAAATGTTTTGGCAGTTGTTTCACCAAATAAGGGCA
TTGCTGGCGATCAATACTTCCTAGCCGTTGCCCAGGATAAATCAAGGATC
ATGATATATAAAATTTCCAATTTATTAGAAGAGTTACATGATGGAACTTT
AATAAAGGAAAACAACGGAAATATGGACAAGGAATCAGTTGATTTGGAAT
CTAAACAAGGAATAATAGAACAAGTTTGTACGACCACATTACCATTTACC
GTTCTATCAATGTGCGCTAATCCTGTTAATCAACAATACATGGCAGTTTG
TGGCCTAAAGGAAGTCTCAGTTTTAATATTTACATCAATGGGCAGTATCA
GTAGTAAAACAGTTGTCCAGCCAATACTTGAAGATTCAAATCAATTCATC
ATATATTCAATGTGGTTACCCGGCTCATTGAACTATTTAGTTTTAATATT
AACTCAATCTGTACAAATCTTTGATCTCAGTCAAACTACTTCACAACCGA
TATACCATTTTAAATCCGTTGAATCGAGATTTAAAGATGCTACTTTCGCT
TTTATTCCTGCTAAAACAACCGGATCTAAAATTTCAACTGAAGCAAAATC
TGATTGCTATGTTTTAGTCATGTCTGAATCCGGGTGCATTCACTGCAAAA
AACTTGACAAAACCTGTATGGCTAGTTCTGGATTTTATTTAGCAGAAATG
TTGGATTGGAATCCAGAATTGTATAACATGAATCGAGATCTCAAAACTGG
GGTTTTAGGAAAAGGAGGCGCTTCAATTCACTATGATCATAATCTGCAAT
TATTGTTTCATTCTTACAATAATGGACGGACTTTTTGCTCGGTTTTGGAT
TCAGGGCAAGACGAAATCTATGTCGACAAAAATTATTATGTCGATATCAG
AAATGAAGCAGAATTCGATTGCACCTTGGTCAACTGGTTTTCTATACACG
ATCATCCAGGGTTACTTATGGCAATTTGTCAACAAACCAATTCTCCTGTT
TATATTTCCGTTGAACCGGAGAAATATTGCTTTCAAATACTTGAAAAATC
TGAAAACTCCGAAAACGATATTACGGACATTTCAGTTGCCAGTCTCAGCA
AAGTTACTGACGCAATAACATTTCCATGGAGAACAACCCTAGAAGATAAA
ATTAAAGTTCAACGCACACTTTCTATGATCCTATTCAATGATGGACGAAT
CAAAATTCTCATGGCAAATATTAGATCTCCAAACTCCGACGGTAGATTTT
GGTTACAAGAAAGGTTTACGAACACATTTCTCAACGAATGTTTACAAGGA
ACCCCCTCATCTGCTACACCCGACATGCCAACATTGGAATTGCACGGTAT
CGATTCAAACAAAAGCAGCAGCTCTAAACGTCATATTAATAAAGATGAAA
TATTTCTCGATAATTCGAGCTGTGGAAAAGTGCCGGTAGATTTCTTTGAA
CATTGCGAACAAACCAATGAAGTGATTTTCGGTGGTGATCGATTTTTGGA
ACTCTATTCTCAAGAAGTTCTCAATTTACGAATGCTAAGTCAAGATCACA
GTGTTAGTGTGGCCTGTAAAAATCCGGTGTCTTTAGTGATAACAAATAAA
AAACCCGATTCCATTATCGTTGGAGTTAGAATCGGAATTAATGTAACTGA
TCCCACTAAAATACCGAAATATTTTGAAATTTACAATCGCAAAATTCCCA
TACCCGAATTTTTAAACAAAAACCGTCTCGTAGACATTGGTCTCTATAAA
TCAGAAATTTTAAACAATGATAAATCATTGCACCTTATAATTGGTCCTAG
CAAAAATTCTAATGACATAATTGTTATTGATTATGTTAAAGTGTTCGTCA
GGCTAAAATCCAGTTTATTGTGGCTCAATGAAAAACAAGAATTTTTGAGA
TCCAAAGAAAGTTCGAAAACTAAAATTCAAAATAAAAGTTCATCTAATAT
GGAAGGTCTGAATAAATGCATCGGACATATCATCACAAATTGCAAAATAA
ATTTATCCACAATTAATCCCTATTTGCCGAAGCCCGAATTGCTATCATCC
GGACTACAATTGTTGACAGCCTTTTTCCATTTCAAAAATACTTTGAATCT
TGAGGGTAGACCAACTTTTTCTTCTTCTGAAGTGGTTACAAGTTCAGTAA
TCCAAACATTTGCTAACGATGTCTTATCATCATTCTATCCTTCTACTATC
ATTCTAAATGCAATAACATTATTAGCCTGTGTTGGATCTATCAAACAAAT
CGAAAGTGATTTAAATCCCAGTTTTAAAAAATGCCTCGTATCTAATGTTG
GTCACAAATTATTTTCAAGCTGTAGTGATTTGATAAAAAAATTAAAACAT
GAAGAAATAGACCCAGTGAATGTTCTTCTAGTTGAAGCAACTATAACTCG
TTTAGCCCATTTAATAAATCTGCACAAGTATTGGATGAGTATTGAAGAAG
AAAATTGGCCTCAGTTGTCATATCTGGAAATATTTGACTTAATGACAACA
TGCATTGAGCTCATCACCAAATACCATGCTGTTTGCAGTTCTGTACAGCC
GGATATGGGAACAGATTCAGAAATCGTCATCTTGGCAAATTTTATCAATC
CCGTTTACTGTCAAAAACTCGATTGCCTACCATCATTAATTCCATTTATA
ATAAAAGGCTTATTAAATTTTAATTTTATGAACACTGAAAATACATCAAC
ATCATCCGATGCTAATCATTCTGCAACGGTTTCAGTTCAAATCAAATTAA
CGGATTTATTAATAAACATGTTGATCGATTCTAATTTGACGATCTCTCAC
AATACGCGACGATCTCTGAATTATTTTATGAAACTCAGCGACAAGAAATT
TATTGATAATAATTCACCTGAAAAGAAAATTGATGATGTCAATCAAACGA
GTGAATTGAAACAGTTAAAGAAAGAGCCAATAGAAAATTCAGATCAAAAT
GTACAAGAATTTGGACAAATATTACAAAGTATCGATACGGCAGCTATCAA
CACTGATGATATGCAGACTTTATCGATTTTACTACCCGACAATCCAGAGG
GACCATCCAATGATAATGAACCGGACGAAGAAGAAATGGATGATCGAGAA
TATTTCTGTAGAGCGGCTGACGATGAATGGATGGTTGCCGTTTCGAATTC
TGAATCTAATTCTCTCGGTGGCAGCACTTTGGCCAATGATGCGACTAACT
TTTTCCAGCAAATCGATACGGAAGCGGTTCCAACAATGGCAGAAGTTATG
CAGGAAATGATAGATAATGCAGATGACCAGAGAATGCTTGATTATGCATT
AAGAAAAAGCCTTGAAGATCAAGGAGGCTCTTCGAATGATGCAAATATCG
AAGGAGGAGCGGCTTCGAATATAAGTCAAATATTTCTTGATTCCAGAAGC
CTAAGAACTGATCCTATTTCTTCGATTTATACAGAAGAAGAGCAACAGTC
ATTGAATAATACCGGAACACCAACTATCGATAATTGGGGTATGAATAAAA
CCAATAAAAAGAATTCCAAGCAGGCTGAGAATTTATCAACACCAGATAGA
GAATACAGTGAATCGAATTCTGAATCCGATATTGCTACTTATGCTATGCT
GAAAAATGCAAGCATTACTTCCAAACTTTCTCCAAATAATTCACAAAAAG
TGTTCTTGGTATGTATTCAAAAATTCGGAATTCAATTTATAAAAAGAATT
ATTGTAAAATGGTCAAGCTTAATGATTTCCTTGCAAGGAACAAGAGTTAT
AACACTTTATAAATCGGTATTGGATGTTATACGTTACATGGATATGCGCG
ATGAAGAAGCTAGGAGTGTGGTTCAAAATCTCGTTGAATTAATGCTTGAC
TTAGTATTGGGGATCAAAAAAGATGACGATCAATTAACTATATTAGAGTA
TGATACAAATGAGAAACGTATTCACTGTCAATCGATTTGCGTAGTTTTAA
GAACTCTTCTTAACTTTATTCTTTCTGGATCAAAAATTCAAACGATTGTT
CCGCCAATCAAAGAAGACAATAACTCAACTGCAGCTGAAGGAAAACCGAC
ACCATCGTCATGCTTCAATCAAGTTTTCACCCAAGATTCTGTTGCTTTTA
TAACTTTGAAACTCGCCTATGAAAAAAAATTGATATCTTTCTGTTTGTTA
AATCTTGACCAATTATTGATTTTATGGAGAAATCAATCTCCAGATCAGAA
AAATTCCGAAAAAGAATTAGATACTTCAAATAAAATTTTAAAACAAAACC
TAACTTCAAACCAGGGTTTTGATGTGTCAGTAACTTTTGACTGGTTACCA
ATGTCTGATATTGATTCTACTTTTGACATGCATTTATTACTTACGGAACT
CATTTTGCGGTTACCCTATGCTGTTTTGAAACTCTGTAGAAATACTTTGA
AAGTCGGAATAGAGCGAACAAGCGATGATCGTGAAATAATGATGGAATTA
GTAAATAGCATTCAGAAAGAAAGTAAATGGCATTCGGTTTTGTGTGAATT
TATCGAAGTGAATATCAGTGAACATATTACAAAAGCAAGCAGAACTTTAC
TGAATTCTGTGGTTGGTGCAAAACATTATCGAACTGTCCGAGATATTCAT
TTAATAGGTGGATCTATCAATAAAATAAAGTCTCTTTTAAATAAACAGTT
TTCTGATCATAATGTTATCAACCGCATCAAACTGCCATTTGACGATACAC
TGAAACTTCTTGAGCTTGTTGATTCATGTATTAATAAAGTCAAAGAAAGA
CCTTCGAATTGGAAAGTTTATTGTTCTAAATGCCCTGAGATTTTGAATTT
CCTCATGGTGAATTCAGTTAGCCTTCATGAAACTATCGGTTTAAAGCTAC
TATATCTTTTACAACTTGCTCTTTTGGAATCTGAATCCTCTAAGTTGAAA
AAGGAAACTGCATCTTCTAATCCCCCAGTTGGAACCTCAGCAGCCGTGAC
TTCTGTTATTACTTCATCTAAAACAGCTGATAAAAACACTCAAAGAAAAT
CGGCAGGTTCAGCACCGGAGGTCAATAAACAAGAAGCCAAGCTTTGTCGG
GCATTAACCAGCAAAATGGATAACACAGTATTAGCTGAGTTCGTTAAAGT
TTATCTCTGTGAACATGAAGATTCTGGAGTGCGATGGCTAACAGAAGCAG
TTCTATCCAATTTGTACAATCACGGAAAAGCAGCTTTTCGGTTAAATCTA
TTAAACACGCTGGCTGATTGTTGGTCATTTTCATATATTTCTCCACAACT
TGCGGATCTCATTGGCCATCTATTAACTAAATATCCAAATTGGGAACGCA
TAGAATCATTTTCTCACCAATTAACAAATGACATTGTTCAATCTAGTCAA
GAATTATTATCAAATTCCTGTACACCATTCTATAATTGCCTTCAAAGACT
TGTTAAATTACCAGGTTACTATCTTGATTCGGAACCATGTTCAGTGTGCT
TACCACCGTCTTCTACTAACGAAATGCATGTATATCGTTGGGATAGCGAA
CCTACCGACAATCGAAGAAACCAAGCAAAATCTGCAACTATTACAGGAAT
GGGCTTACATACTGCATCTACGGCAATTAGTAATAATGATTATTTGACTC
CTAATGTTCGGTCAAATCCAACTGTTCATGTTTTCAATTTACGTGCTCCA
TATTCCATTCAATCTATTACAGTTAAATTTACTGGGACTCGTCGACAACG
TCCACAATGCGGAGTAACTCTCTATTATAGCGACATAAGCACCGTATCAA
CTACTCAAATGCTTGATCAAGCAAATTTATGGCAAAAAGTGAAAACAGTG
ACCGTTTCTAAAGATATGGCTGAAATGAAATTGGATTTCCCTGTTCTTTT
AACAGCTGTTTATTTAATATTTGAATATGACTGTTTTACTGGATCAGTTT
CTAATAGTGATAACGTGAAGTGCCCAAGATGTCACAGTGCTAGCATCCAG
GGAAATGTCTGTCTCAATTGCCGTGATAATATTAATCAATGTTTTCGATG
CCGGGCTATTAATTATGCAGGGATAGATTCATTTATCTGTGCCAATTGCA
GCAGTTGTCGGTATGGTCGCATTGACTTTTCAATGTTTGCTAAGCCTTGC
TATGATTTTATTGAAGAATTGAAGAGTGAAGAAAGTAGAGAAGTTATGAT
TAACAGAATAACAACATGGAGTGAAACAGTTGAGAAAAATGTTCAAGAAA
TGATTATTCTCAAGCAGGAACTGGAAGTTTTCCTCGATCAAATAAAAATG
ATGGACGCAGCTGAAATGTCAAGCCAGAAAAAAGTGAACAATTCTGCTTT
TATAACTAGTGGCACTAATATAAGTGGATTGGGAACAACCAAATTACCGG
TCTCGGGTGGCAAAACATATGCTGAAGTAACTGGAGCATCTGCAATGGAT
GATAGCGGATTACCAGCAAAATCATACAGGCGTATTCGTAGAGCTGCTGG
GGGAGAAAATGAACCTGAAAAAGAATCTACAAAACCACCTAATGTAAATC
CAATAACTACTGCCGAGACAGTAAAAGAAGAGAAAAAAGATTCACATTCG
AAACACATACATGATGCATTGAATCAATTAATTTTGAAATACAGTACTGA
CGCTAAAGAACAACAATTAGAAATAGGTTGTTTATGGCGCCAACTTTGGG
CCGCTAAGAAAGCGGTTGCTAATTACGATACACGATTAGCTCGAGCTAAG
AACAATCTTGTTAATGTTAATGAATCTTTGTTTGAAAGTAATAAAATTAG
GCAGAATTGTTATGCATGTTTATTGTCGAAATTGCAACAACATATTTGGT
TAATGAAAGGTCTTTCTTTCATTCCTGATATAAGGCATACTGTAACTAAT
GCCGCCAATTTAAAGGACATGCAAAGCTTATTTTTGGGTGAGATACTTAA
TGCAGTTTCAAGCTCCATGCGCCAGGAAATAGTGATTCTAGTAGTTCAAA
TAACCCGTGACAAAAAAGAAGAAGTAATAAAACTCAATCAACTTATTACT
TCAGAATTACTTTTTGCATTGCGTACTCCATATTTGTCAGCTCCCCGAGA
GTCACGAATCAAAGTCATAATTTCATTATTGAAATCAAGCATTGCATGCC
CCGATTCACTTTGGGAATTACGTTTGAGGCCTGCAATTGCGGTTTTGTTA
GAGGTCAGTAATAATGGACCATCATCTGAAAATTGCACGAAGGTCGTAGT
TGCTCCATGCATTGCATTAATCCAGGCCTGTATGAGGTTTTTGGTGGGAA
AATTAAAACAACCTGTGTTAATAAAAAAGCCTAATTTAGTGAGTGAAAAT
GAGCCAGCAATAGAACATAAGTCATCACTTATATTTCCATCAATGCCTGT
GCTTTGTATCAATCAATGGCTGCAAGACGATAGCTCCCAATTGTTTGAGA
CATGGCTTCAATGTACTCGTGAGGAAAACCAAATTCCTAGAGATATTACA
TTGAATTCTGATCAAGGAAATGTAGGATTGATTCAGAAATTTGCTTCCAG
ATGGTTTAATAAGGTGCAAAAGAAAAAATTATCGAAGGTCAAGTTTATTA
AATTGGTCAATGTCGAAGATATGTTTGTCAGTCAAGCTTGGTTATGGCAA
GCTCTTTTGAGTTCAAGCAATCCATCATGTCGTCAAGCTACTCATTTATT
AGTTGAAATGCTTGGATATCAATCATTTGAACGACATCGTATTGTACTGT
CAGTGTTAGTTCAATGTTTACCGTTTATGGTATCTGGAATTGGTGCAAAT
GTTGATGATTTAATGAAAATGTGTTTCCCGAACAGACAGCCTTTGAGATC
AACGCAAAAATTTCAAATGACAAATAATGAAACTAGTGTTCAATATGTTG
CATTATTGAAAAGATTGTGTCAAGAAAAACATTGGAGATGTTATCTAGTA
ATCAAATGCAGATTAATCGAAATTATCGACCTTGCAATGAGTCGAGTGTT
AAAGTTTTTAGCACAAGTTGAAGAATCGTGTCTAGATAGCTGGAGAAATG
GTCAAGCCAGACCTGGATTATCAAATGGAGGTTGGGTTGCGATAATTTAC
TGAAAAGTTTAGCAGAACTATTGCTGCATTTACAAGAAATTCCTGCAATA
GCATATAAATATAGAACGACAATTGTGAAATGTTTACTCACATCGAGTCT
GAACATGCGTAGATTGATAGTTTTCCGATCCAAAATCACAACTGACATGG
AATCTCGTTTTAATAAAACTGTCGACGATCTATCTAAGGATTCTGAAGAA
ATTATCCGAAGTTTTATTAAAATAGCCGTTTCTGTATTAAATCAATTTCC
TGTGACTGATCTGCAATCTGCTGGACATATAATCGAAAAGATAAATGCGT
ATATTTGTCCAAGAGATTATGAACATCCCGTTTTCGAAGTTGTCCTTGAT
ATCTTTAAAGGCCAAGAAGACTTTCTTCCTCATCGTATGATAGGAGTATC
TCTAAGTTCTCAATCATTTGGTCACAATCCAACTGTAAATGATGTCATAA
ACTTCCTAGTTAGAGAAAATGGAGTCACCAGTGACATAAGACTTGACTTG
ATATGTGATAAAAAAGTTCTCATGTATGATCTCTTATTAGAAGATATATA
TGAACACGTGTGGCTCTGTAGTGACGCCAATAACAAGAGTCGACCGATGC
GACTTACAGTTCGGATTAGTGGGCTAGTGGAAGATAATATGCCCTATGTT
GAAAGTTTGAGAAAGGAAGTTCCACTTGAACATTATCAACGTTCTAATGA
ATTGATTGAAGGAGGCATGCACACAATTATCGAGCGATTGGCGGCAGTCG
ATGAATTAGCACATGGGTTTTCAGTTATAGCATCATCAGTCAGGCTTCTC
AATTATTTTATTAAAGTTCCCAATAATGATGTGAGATTGATTGAGCCTGG
TTTAGACACGGTCAAAGTTTTATTGCAATGTTTGCTGGTATGTTTAAAGG
GAGGATTGGATGAAAAACGAATGACGGAATATGAGGAGTCTACAGTTGTC
CCGCTGATTAATTTGCTTTGTAGAATTCTCACTCTTGGCAGAGCGGGTTC
AATTACTCAGCAAAATCATATGATAAATCAAGTCGAGAACATGCATGCTA
TTCCCATCTTGTTGGACTATATTCACAAAAATTCTAGAGTGGAATTATAT
CAGAAGCATATCACAAAGATTCCAGCTTTATTGGCTTTTCAATTTTCGCA
TGAAATGGTATTGATAATAGATTACGTTGTTCCTCATTTCCAGTTACTTA
TACCCAATGCGCACATTGATGATAATCAGAAACAAATTTTGCTGTGTTGT
TGTAACCTTATGAGCTCGATCCCTTCTGATGAATATGGTACCTTGTTTCG
ACATCATATGATGGAAAAGGGATTGCTAAATATTTGTATTGACTTCCTTG
TTGCCGTGGCTCCGGAAGATGCACTGAAAGAAGGAATTAAACTAGACCTT
AAACGACCAGATACAATAGCTTTCTTAGAGCAACAAGCCCTTCAGTTTCT
ATTGGTATTAGGTCAGGCATGTGTTGGATCAAATGGGTTTGTGGAAGCTG
GACAAATACTGCTTGCAGTTCCAGGATTATTGGGCTTCCTTCATAAACTA
GAAACCGTCAAATCTGTCCAAGCAATCGGTGTTCTATCTGAGGATTGGTT
AAATGCATTAAAGGAATGTTCGGCCGATATGAACAAAGTTATAAGTGGAC
TTCGAAGCAGTACTCAAAAAAATCTCCGTGCTCAAGCCCTCAAAGTTCGT
CAGAAGCAACTAAACGAGATGCAAATGACTGTAAATGATAAAGGGCAAGT
GCTCACCTCGAGTTCATTACTCAAAGATTTATCCAGTCAAGTGCTTGAAG
AGCCTGGGCATTGTTGTGATATTTGTTTAGATGGATATGTGAATAAACCT
CAAGAATCATTAGGAGTTTATACCTTTGTTAAGAAAGTTCTTGTCCACGA
TTTAATGTCAGGCAAAATGCAAGCATTGCCTAATTCAGTTCCTTGTGCCA
ATCAATATTATTATACATCGGTATCAAATTATGTCTGTGTCCATTTCTCT
TGTCATAATCAAGCTGTGAAAGTTGTCAATGAGAATGAATGGGTCGTAGC
CCAAAGACACAATCAAAACGCTAAATGCAATAGCCTCATGCCTATTTTGG
GTCCTCACCCTGATAACAATTTTAAAGCCAATCTCAATCGATATCAAACT
TCTATATGGAACAACACAAATGTACCTGAAATAAATTATCAACTGATGGT
GCATGATTTGAAATTTCTACTACTTCGTTTTGCACACAATCGCCAGTTTA
ATGAAGACACAGGAGGCGGAGCGAGACTCAGCAACATTCGATTAGTCCCT
CAAATTATCCAAATTGCCATAGCAAATCTAATATCTCAAGCAGATCTTAT
TAATAAAGAAATGCAGGCCATGTCGAAGTGGCTGGAACAGGCGGGAGGCG
GTTGTAAAGTATTCAATCAGAACCTCTGGCAAGCAACCAATACTCCATAT
CGCATCGTTCAATTTCTCCTATTCCATTCTCGTGAATTGTGGTTGCAACA
TCGAGTCCAAATATTGAAATTACTGCTCCAATTTGCTCACATGCGCCATC
TAAATCTAGCTGACGTATCCCAGATCCAGCCCGCCCAATTGGAACCGTTA
CCGTACTCGATTTATCATCCGTTTTTGGTCTTATTCGGAATTATTCATTC
GTTTTACAATATTCTCTTGAAAAATGTCACCTCATCCCCCGGTACCGGTA
AAGCATGGATGGATGCAGTTTCACTTTATACCCGTGAAAATGACGTTGCT
CTTCTTGATGATTCCAATAAGGTTATTAGATTTTATGAAGACAATTTGTT
GCCGTGTGAATCGTTGAGTGAATTTTGGGATGTCATTGAGCTGGGATACA
ATATACCATTCGAGGAGGACTATCTGTCAGCCGTGCTCACCGAACTCAAA
GATGTCAAGCAGTGAAAAATCATGTGAAAGTGTTTTTAATAGAACTAGTG
TTTTTATTGTTACAAATTTAGTTATTGTGGCAAATAAAGTTATTTGTTGA
CTCATTTATTTATATTGTTATCGATTGGCGGCACTGTTATTGAATAATTT
CATAGTTTTAATTGGTGGAATTTTGTGTTTCGCGCCACCAGTTATCACAA
TACATGAGATCGGAAGAG
back to top

protein sequence of SMED30017151-orf-1

>SMED30017151-orf-1 ID=SMED30017151-orf-1|Name=SMED30017151-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=4628bp
MNDINLQTKNVVQLFIINPREFSKLSSLDFDFLKDLLIKINTEKDNAVND
KINTITISLELIKAIVINNFPCNVEGLFKFLIGKSLDLIHFKSSRYTVTS
LLLKIIEEEFSSNEKYVDNNKNIIKKMNIFLDEENQFDVKDLIKSLRESV
LNKELILCIEPHSNIDNKIITNNISISSNMIQEGLLNFQNRAYNSILKMS
KSDNSRPYSKLSNGLFIKMITKLYKDSDGGKIISNCLENDFKLSLAIAEC
TTNNYLMEIIETIKTDDDTKHNFERIDSCLAEIPDILSMIQLIKYCSFDI
NNLENIMSILGSVIAASYKSLLNNLAKSKHQDTNDELAGNSPLEFLNKLI
IETSATFDYLHMHKPLLVFGALNILGFHKFINEATRTCKSEFENLVHNNQ
DFLFLSRAVLQKLNNLIIFSNKESELNWQGDNDIDITSNLTVLLKSSSRN
WLCLILNDKNLQIMLFWLEILHHNAAQTITNLLEQNTLSSPPHVSTTDNI
LYVDDEDGPGEEYGLNHLFTDYQEKVKPSISNTSSIIRYESRNDNQKLSA
QFVNEILKSMSLVVMNDDPVIHKLILQQFDEKALQSVFTLATLIDQEIIN
MKDSQAPSDLNELTKLFVNFINLLFSSNVINQARSVYFLSLISVQLPKDC
HIKECEMPMNLELGPMTILIIMNISIHFTNPGAFQDNSIGWLKSDIYIKL
MWKNIFHSIKQSTINNNYKCVDIRQELIQLYLLIFHGLTSISGKTEIVFD
LLNCITDCSGFKTGVQPRLISRLLIILTYLVHHFYEQSSSLAFQIQYNLL
TKYISDSINSDASNYQYDEVQIFDQKTNVIFYDISIPWIASKKFWPGLNP
DSLILKNMVNHPQYESFFNGVLDGIQMCLDHRQVYDESQKFSLLSFTGSF
YNILLSWRLMEVLPLPDKYQQDIPNIELSCYTRLICSFLKLRNDAKANLL
SGKNNLTEELLLIDCQSETKYDLDQHIIHLIANLCERICLDIKNEPPHLP
QQIYQIDMIIVSLNFILQCIKDDIDHPSTAEKPSVNTKCYLNSETSENSA
LSKNLIPIILNIYETLIRQIQLFISRHNCQTGLASLDLLSLTKMSSMELK
FDYVNLDLLKSLNVDLEKAIDKANWKDIGKESNEITFSHIKQFLASKSFD
RKFCIEHDNIIDMIRAESYRRFVFIADHCKFDSSPIGDSVKLILSTTMLA
IEDLRETLNLLDNFQMEIPNIPIDSFGKYVDLIVINNINTFVPTTNLPAK
SLKSIPNSIYSQVIARKLFSIFFDFHGNTSEANNAGYYDIMNQTIECLIN
MLDKTIDLSCLSEIVSVFLENASNESHSNIYLIFTLIFNVDRSVPIALKC
SLLKLINLIFYRYKNCGKDKQLQDILKKLNYGIHHVTNEQSNTDMIAKIK
NWVQELLMNVEVPDENCKSDYLANVLLFSELLALTSYDDEDDRNLCIVIC
KSILQMDENVRSWLIENRNAFSTSDYSENCQLINLHIIIEMMCVISNGNC
SLSVYVNVIQTLLDWNKEINKSLSKYTEHKQSYGPKMELICASLTKIYNH
IGAVICALNTNYQSESMKSNLNDILYNMKPSSELYLNDFNMNQLSIDKRA
IEEILFCQVKHNPNFGENDLINSESEEEKIMKLNPLDDQLCTFAATQKEF
TDQHWYHCHTCSMVENEGVCTICAKVCHLGHDLTYAKRGSFFCDCGAKGS
NFCEALTRRTNRTTISKKSQLHASQSTSIDAIKKDKPSMKSQFFEKSKYN
FQTRFSKFSSNEKLLRKSYKADTKSRLTAHKMTAAADSGSCPEVTNDDES
TSTNMISNAISTVFSVNQSKQVAYRNWITAVLRERILKENETLTILLETS
TLLDDCFTALQIIHESFKVQYSDWTVGKNKQMKEAFKSVRTSEKISERVT
TIMGSSIQLRNAEAPSDMSGIPPTSVLASEIAGANSHVRGMLQSGYVRRN
VLAVVSPNKGIAGDQYFLAVAQDKSRIMIYKISNLLEELHDGTLIKENNG
NMDKESVDLESKQGIIEQVCTTTLPFTVLSMCANPVNQQYMAVCGLKEVS
VLIFTSMGSISSKTVVQPILEDSNQFIIYSMWLPGSLNYLVLILTQSVQI
FDLSQTTSQPIYHFKSVESRFKDATFAFIPAKTTGSKISTEAKSDCYVLV
MSESGCIHCKKLDKTCMASSGFYLAEMLDWNPELYNMNRDLKTGVLGKGG
ASIHYDHNLQLLFHSYNNGRTFCSVLDSGQDEIYVDKNYYVDIRNEAEFD
CTLVNWFSIHDHPGLLMAICQQTNSPVYISVEPEKYCFQILEKSENSEND
ITDISVASLSKVTDAITFPWRTTLEDKIKVQRTLSMILFNDGRIKILMAN
IRSPNSDGRFWLQERFTNTFLNECLQGTPSSATPDMPTLELHGIDSNKSS
SSKRHINKDEIFLDNSSCGKVPVDFFEHCEQTNEVIFGGDRFLELYSQEV
LNLRMLSQDHSVSVACKNPVSLVITNKKPDSIIVGVRIGINVTDPTKIPK
YFEIYNRKIPIPEFLNKNRLVDIGLYKSEILNNDKSLHLIIGPSKNSNDI
IVIDYVKVFVRLKSSLLWLNEKQEFLRSKESSKTKIQNKSSSNMEGLNKC
IGHIITNCKINLSTINPYLPKPELLSSGLQLLTAFFHFKNTLNLEGRPTF
SSSEVVTSSVIQTFANDVLSSFYPSTIILNAITLLACVGSIKQIESDLNP
SFKKCLVSNVGHKLFSSCSDLIKKLKHEEIDPVNVLLVEATITRLAHLIN
LHKYWMSIEEENWPQLSYLEIFDLMTTCIELITKYHAVCSSVQPDMGTDS
EIVILANFINPVYCQKLDCLPSLIPFIIKGLLNFNFMNTENTSTSSDANH
SATVSVQIKLTDLLINMLIDSNLTISHNTRRSLNYFMKLSDKKFIDNNSP
EKKIDDVNQTSELKQLKKEPIENSDQNVQEFGQILQSIDTAAINTDDMQT
LSILLPDNPEGPSNDNEPDEEEMDDREYFCRAADDEWMVAVSNSESNSLG
GSTLANDATNFFQQIDTEAVPTMAEVMQEMIDNADDQRMLDYALRKSLED
QGGSSNDANIEGGAASNISQIFLDSRSLRTDPISSIYTEEEQQSLNNTGT
PTIDNWGMNKTNKKNSKQAENLSTPDREYSESNSESDIATYAMLKNASIT
SKLSPNNSQKVFLVCIQKFGIQFIKRIIVKWSSLMISLQGTRVITLYKSV
LDVIRYMDMRDEEARSVVQNLVELMLDLVLGIKKDDDQLTILEYDTNEKR
IHCQSICVVLRTLLNFILSGSKIQTIVPPIKEDNNSTAAEGKPTPSSCFN
QVFTQDSVAFITLKLAYEKKLISFCLLNLDQLLILWRNQSPDQKNSEKEL
DTSNKILKQNLTSNQGFDVSVTFDWLPMSDIDSTFDMHLLLTELILRLPY
AVLKLCRNTLKVGIERTSDDREIMMELVNSIQKESKWHSVLCEFIEVNIS
EHITKASRTLLNSVVGAKHYRTVRDIHLIGGSINKIKSLLNKQFSDHNVI
NRIKLPFDDTLKLLELVDSCINKVKERPSNWKVYCSKCPEILNFLMVNSV
SLHETIGLKLLYLLQLALLESESSKLKKETASSNPPVGTSAAVTSVITSS
KTADKNTQRKSAGSAPEVNKQEAKLCRALTSKMDNTVLAEFVKVYLCEHE
DSGVRWLTEAVLSNLYNHGKAAFRLNLLNTLADCWSFSYISPQLADLIGH
LLTKYPNWERIESFSHQLTNDIVQSSQELLSNSCTPFYNCLQRLVKLPGY
YLDSEPCSVCLPPSSTNEMHVYRWDSEPTDNRRNQAKSATITGMGLHTAS
TAISNNDYLTPNVRSNPTVHVFNLRAPYSIQSITVKFTGTRRQRPQCGVT
LYYSDISTVSTTQMLDQANLWQKVKTVTVSKDMAEMKLDFPVLLTAVYLI
FEYDCFTGSVSNSDNVKCPRCHSASIQGNVCLNCRDNINQCFRCRAINYA
GIDSFICANCSSCRYGRIDFSMFAKPCYDFIEELKSEESREVMINRITTW
SETVEKNVQEMIILKQELEVFLDQIKMMDAAEMSSQKKVNNSAFITSGTN
ISGLGTTKLPVSGGKTYAEVTGASAMDDSGLPAKSYRRIRRAAGGENEPE
KESTKPPNVNPITTAETVKEEKKDSHSKHIHDALNQLILKYSTDAKEQQL
EIGCLWRQLWAAKKAVANYDTRLARAKNNLVNVNESLFESNKIRQNCYAC
LLSKLQQHIWLMKGLSFIPDIRHTVTNAANLKDMQSLFLGEILNAVSSSM
RQEIVILVVQITRDKKEEVIKLNQLITSELLFALRTPYLSAPRESRIKVI
ISLLKSSIACPDSLWELRLRPAIAVLLEVSNNGPSSENCTKVVVAPCIAL
IQACMRFLVGKLKQPVLIKKPNLVSENEPAIEHKSSLIFPSMPVLCINQW
LQDDSSQLFETWLQCTREENQIPRDITLNSDQGNVGLIQKFASRWFNKVQ
KKKLSKVKFIKLVNVEDMFVSQAWLWQALLSSSNPSCRQATHLLVEMLGY
QSFERHRIVLSVLVQCLPFMVSGIGANVDDLMKMCFPNRQPLRSTQKFQM
TNNETSVQYVALLKRLCQEKHWRCYLVIKCRLIEIIDLAMSRVLKFLAQV
EESCLDSWRNGQARPGLSNGGWVAIIY*
back to top

protein sequence of SMED30017151-orf-2

>SMED30017151-orf-2 ID=SMED30017151-orf-2|Name=SMED30017151-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=937bp
MRRLIVFRSKITTDMESRFNKTVDDLSKDSEEIIRSFIKIAVSVLNQFPV
TDLQSAGHIIEKINAYICPRDYEHPVFEVVLDIFKGQEDFLPHRMIGVSL
SSQSFGHNPTVNDVINFLVRENGVTSDIRLDLICDKKVLMYDLLLEDIYE
HVWLCSDANNKSRPMRLTVRISGLVEDNMPYVESLRKEVPLEHYQRSNEL
IEGGMHTIIERLAAVDELAHGFSVIASSVRLLNYFIKVPNNDVRLIEPGL
DTVKVLLQCLLVCLKGGLDEKRMTEYEESTVVPLINLLCRILTLGRAGSI
TQQNHMINQVENMHAIPILLDYIHKNSRVELYQKHITKIPALLAFQFSHE
MVLIIDYVVPHFQLLIPNAHIDDNQKQILLCCCNLMSSIPSDEYGTLFRH
HMMEKGLLNICIDFLVAVAPEDALKEGIKLDLKRPDTIAFLEQQALQFLL
VLGQACVGSNGFVEAGQILLAVPGLLGFLHKLETVKSVQAIGVLSEDWLN
ALKECSADMNKVISGLRSSTQKNLRAQALKVRQKQLNEMQMTVNDKGQVL
TSSSLLKDLSSQVLEEPGHCCDICLDGYVNKPQESLGVYTFVKKVLVHDL
MSGKMQALPNSVPCANQYYYTSVSNYVCVHFSCHNQAVKVVNENEWVVAQ
RHNQNAKCNSLMPILGPHPDNNFKANLNRYQTSIWNNTNVPEINYQLMVH
DLKFLLLRFAHNRQFNEDTGGGARLSNIRLVPQIIQIAIANLISQADLIN
KEMQAMSKWLEQAGGGCKVFNQNLWQATNTPYRIVQFLLFHSRELWLQHR
VQILKLLLQFAHMRHLNLADVSQIQPAQLEPLPYSIYHPFLVLFGIIHSF
YNILLKNVTSSPGTGKAWMDAVSLYTRENDVALLDDSNKVIRFYEDNLLP
CESLSEFWDVIELGYNIPFEEDYLSAVLTELKDVKQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003126Znf_UBR
IPR025704E3_Ub_ligase_UBR4
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0016874ligase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 4166..4186
NoneNo IPR availableCOILSCoilCoilcoord: 1106..1126
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 3113..3133
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2955..2974
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 4092..4124
NoneNo IPR availablePANTHERPTHR21725:SF1E3 UBIQUITIN-PROTEIN LIGASE UBR4coord: 331..4591
NoneNo IPR availablePANTHERPTHR21725PUSHOVER/RETINOBLASTOMA-ASSOCIATED FACTOR 600coord: 331..4591
IPR003126Zinc finger, UBR-typeSMARTSM00396push_1coord: 1639..1707
e-value: 1.2E-21
score: 87.9
IPR003126Zinc finger, UBR-typePFAMPF02207zf-UBRcoord: 1647..1703
e-value: 4.9E-7
score: 29.8
IPR003126Zinc finger, UBR-typePROSITEPS51157ZF_UBRcoord: 1639..1708
score: 8.464