SMED30017149

Overview
NameSMED30017149
Smed IDSMED30017149
Length (bp)2087
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30017149 (SMED30017149) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30017149 (SMED30017149) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30017149 (SMED30017149) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30017149 (SMED30017149) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017149

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30017149h1SMcG0012387 SmedASXL_012891SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior sideSMED30017149h1SMcG0012387 dd_Smed_v4_12799_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30017149h1SMcG0012387 dd_Smed_v4_12799_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30017149 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.010263:5744..9530 +10229
Homology
BLAST of SMED30017149 vs. Ensembl Human
Match: SIRT1 (sirtuin 1 [Source:HGNC Symbol;Acc:HGNC:14929])

HSP 1 Score: 367.466 bits (942), Expect = 3.434e-116
Identity = 177/330 (53.64%), Postives = 228/330 (69.09%), Query Frame = -2
Query:  893 GQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL 1882
            G    V Q +  G  P+ ILK+     +     D +  W I+++I+ E  +RK+ + INT + A  L++  K I+VLTGAG+SV CG+PDFRSR+GIYARLAVDFPDL +PQ+MFDI YF K+P+PFFKFAKEIYPG+F PS  H+FI + + +GKLLRNY+QNIDTLEQ+AGI+ II CHGSFA+A+C+ C+YKV  E +  D+ NQ +P CP C                     D  + IMKP++VFFGE LP+ FH  +  DKD+VDLLIVIGSSLKVRPVA IP  +P  +PQILIN+E L    FD+ELLGDCD I+ E+C +L
Sbjct:  183 GPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCP-------------------ADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRL 493          
BLAST of SMED30017149 vs. Ensembl Human
Match: SIRT1 (sirtuin 1 [Source:HGNC Symbol;Acc:HGNC:14929])

HSP 1 Score: 263.462 bits (672), Expect = 6.064e-80
Identity = 124/217 (57.14%), Postives = 154/217 (70.97%), Query Frame = -2
Query:  893 MFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL 1543
            MFDI YF K+P+PFFKFAKEIYPG+F PS  H+FI + + +GKLLRNY+QNIDTLEQ+AGI+ II CHGSFA+A+C+ C+YKV  E +  D+ NQ +P CP C                     D  + IMKP++VFFGE LP+ FH  +  DKD+VDLLIVIGSSLKVRPVA IP  +P  +PQILIN+E L    FD+ELLGDCD I+ E+C +L
Sbjct:    1 MFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCP-------------------ADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRL 198          
BLAST of SMED30017149 vs. Ensembl Human
Match: SIRT1 (sirtuin 1 [Source:HGNC Symbol;Acc:HGNC:14929])

HSP 1 Score: 228.024 bits (580), Expect = 8.892e-67
Identity = 109/198 (55.05%), Postives = 137/198 (69.19%), Query Frame = -2
Query:  893 EIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL 1486
            EIYPG+F PS  H+FI + + +GKLLRNY+QNIDTLEQ+AGI+ II CHGSFA+A+C+ C+YKV  E +  D+ NQ +P CP C                     D  + IMKP++VFFGE LP+ FH  +  DKD+VDLLIVIGSSLKVRPVA IP  +P  +PQILIN+E L    FD+ELLGDCD I+ E+C +L
Sbjct:   12 EIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCP-------------------ADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRL 190          
BLAST of SMED30017149 vs. Ensembl Human
Match: SIRT1 (sirtuin 1 [Source:HGNC Symbol;Acc:HGNC:14929])

HSP 1 Score: 228.024 bits (580), Expect = 8.892e-67
Identity = 109/198 (55.05%), Postives = 137/198 (69.19%), Query Frame = -2
Query:  893 EIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL 1486
            EIYPG+F PS  H+FI + + +GKLLRNY+QNIDTLEQ+AGI+ II CHGSFA+A+C+ C+YKV  E +  D+ NQ +P CP C                     D  + IMKP++VFFGE LP+ FH  +  DKD+VDLLIVIGSSLKVRPVA IP  +P  +PQILIN+E L    FD+ELLGDCD I+ E+C +L
Sbjct:   12 EIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCP-------------------ADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRL 190          
BLAST of SMED30017149 vs. Ensembl Human
Match: SIRT3 (sirtuin 3 [Source:HGNC Symbol;Acc:HGNC:14931])

HSP 1 Score: 196.438 bits (498), Expect = 1.699e-56
Identity = 105/274 (38.32%), Postives = 161/274 (58.76%), Query Frame = -2
Query:  881 RVSKNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGI--KNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGF-----DIELLGDCDNIVTEICKQLQWDD 1678
            R  + ++V+ GAGIS P G+PDFRS  +G+Y+ L     DL  P+++F++ +F  NPKPFF  AKE+YPG + P+  H F+++L DKG LLR Y+QNID LE+++GI    ++  HG+FASATC  C+    GE I +DVM  ++P CP CT                         ++KPD+VFFGE LP+ F   +  D    DLL+++G+SL+V P A +   +  ++P++LIN++ +    +     D+  LGD  + V  + + L W +
Sbjct:   54 RACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQY--DLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTG------------------------VVKPDIVFFGEPLPQRFLLHVV-DFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTE 300          
BLAST of SMED30017149 vs. Ensembl Celegans
Match: sir-2.1 (NAD-dependent protein deacetylase sir-2.1 [Source:UniProtKB/Swiss-Prot;Acc:Q21921])

HSP 1 Score: 317.005 bits (811), Expect = 2.258e-99
Identity = 162/384 (42.19%), Postives = 236/384 (61.46%), Query Frame = -2
Query:  767 WRNT---RGQLELVNQCIQKGETPKEILKNHF----KVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWDDLSASTLSNDFVEKSIFDMKSEIESLYRDESERKSISDE 1897
            W+N       L    + +  G TP +I++  F       +  +S++A  H++I+  ++     R+++   N+   A +L +  K+I+VLTGAG+SV CG+PDFRS++GIYARL  +FPDL +P +MFDI YF +NP PF+ FA+EI+PG+F PS  HRFIK LE  G+LLRNY+QNIDTLE   GIK ++ CHGSF+  TC RC  K  G  I  +V+  ++  C  C                          ++KP++VFFGE L ++FH  ++EDK +VDL++VIGSSLKVRPVA IP C+  N+PQILIN+E+L  +  DIELLG+CD+I+ +IC  L     S + L   +   SI + + + +S    +++R+ IS E
Sbjct:   35 WQNNDEMMSNLRRAQRLLDDGATPLQIIQQIFPDFNASRIATMSENA--HFAILSDLLERAPVRQKLTNYNSLADAVELFKTKKHILVLTGAGVSVSCGIPDFRSKDGIYARLRSEFPDLPDPTAMFDIRYFRENPAPFYNFAREIFPGQFVPSVSHRFIKELETSGRLLRNYTQNIDTLEHQTGIKRVVECHGSFSKCTCTRCGQKYDGNEIREEVLAMRVAHCKRCEG------------------------VIKPNIVFFGEDLGREFHQHVTEDKHKVDLIVVIGSSLKVRPVALIPHCVDKNVPQILINRESLPHYNADIELLGNCDDIIRDICFSLGG---SFTELITSY--DSIMEQQGKTKSQKPSQNKRQLISQE 387          
BLAST of SMED30017149 vs. Ensembl Celegans
Match: sir-2.1 (NAD-dependent protein deacetylase sir-2.1 [Source:UniProtKB/Swiss-Prot;Acc:Q21921])

HSP 1 Score: 317.005 bits (811), Expect = 2.258e-99
Identity = 162/384 (42.19%), Postives = 236/384 (61.46%), Query Frame = -2
Query:  767 WRNT---RGQLELVNQCIQKGETPKEILKNHF----KVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWDDLSASTLSNDFVEKSIFDMKSEIESLYRDESERKSISDE 1897
            W+N       L    + +  G TP +I++  F       +  +S++A  H++I+  ++     R+++   N+   A +L +  K+I+VLTGAG+SV CG+PDFRS++GIYARL  +FPDL +P +MFDI YF +NP PF+ FA+EI+PG+F PS  HRFIK LE  G+LLRNY+QNIDTLE   GIK ++ CHGSF+  TC RC  K  G  I  +V+  ++  C  C                          ++KP++VFFGE L ++FH  ++EDK +VDL++VIGSSLKVRPVA IP C+  N+PQILIN+E+L  +  DIELLG+CD+I+ +IC  L     S + L   +   SI + + + +S    +++R+ IS E
Sbjct:   35 WQNNDEMMSNLRRAQRLLDDGATPLQIIQQIFPDFNASRIATMSENA--HFAILSDLLERAPVRQKLTNYNSLADAVELFKTKKHILVLTGAGVSVSCGIPDFRSKDGIYARLRSEFPDLPDPTAMFDIRYFRENPAPFYNFAREIFPGQFVPSVSHRFIKELETSGRLLRNYTQNIDTLEHQTGIKRVVECHGSFSKCTCTRCGQKYDGNEIREEVLAMRVAHCKRCEG------------------------VIKPNIVFFGEDLGREFHQHVTEDKHKVDLIVVIGSSLKVRPVALIPHCVDKNVPQILINRESLPHYNADIELLGNCDDIIRDICFSLGG---SFTELITSY--DSIMEQQGKTKSQKPSQNKRQLISQE 387          
BLAST of SMED30017149 vs. Ensembl Celegans
Match: sir-2.1 (NAD-dependent protein deacetylase sir-2.1 [Source:UniProtKB/Swiss-Prot;Acc:Q21921])

HSP 1 Score: 317.005 bits (811), Expect = 2.258e-99
Identity = 162/384 (42.19%), Postives = 236/384 (61.46%), Query Frame = -2
Query:  767 WRNT---RGQLELVNQCIQKGETPKEILKNHF----KVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWDDLSASTLSNDFVEKSIFDMKSEIESLYRDESERKSISDE 1897
            W+N       L    + +  G TP +I++  F       +  +S++A  H++I+  ++     R+++   N+   A +L +  K+I+VLTGAG+SV CG+PDFRS++GIYARL  +FPDL +P +MFDI YF +NP PF+ FA+EI+PG+F PS  HRFIK LE  G+LLRNY+QNIDTLE   GIK ++ CHGSF+  TC RC  K  G  I  +V+  ++  C  C                          ++KP++VFFGE L ++FH  ++EDK +VDL++VIGSSLKVRPVA IP C+  N+PQILIN+E+L  +  DIELLG+CD+I+ +IC  L     S + L   +   SI + + + +S    +++R+ IS E
Sbjct:   35 WQNNDEMMSNLRRAQRLLDDGATPLQIIQQIFPDFNASRIATMSENA--HFAILSDLLERAPVRQKLTNYNSLADAVELFKTKKHILVLTGAGVSVSCGIPDFRSKDGIYARLRSEFPDLPDPTAMFDIRYFRENPAPFYNFAREIFPGQFVPSVSHRFIKELETSGRLLRNYTQNIDTLEHQTGIKRVVECHGSFSKCTCTRCGQKYDGNEIREEVLAMRVAHCKRCEG------------------------VIKPNIVFFGEDLGREFHQHVTEDKHKVDLIVVIGSSLKVRPVALIPHCVDKNVPQILINRESLPHYNADIELLGNCDDIIRDICFSLGG---SFTELITSY--DSIMEQQGKTKSQKPSQNKRQLISQE 387          
BLAST of SMED30017149 vs. Ensembl Celegans
Match: sir-2.1 (NAD-dependent protein deacetylase sir-2.1 [Source:UniProtKB/Swiss-Prot;Acc:Q21921])

HSP 1 Score: 317.775 bits (813), Expect = 2.537e-99
Identity = 162/384 (42.19%), Postives = 236/384 (61.46%), Query Frame = -2
Query:  767 WRNT---RGQLELVNQCIQKGETPKEILKNHF----KVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWDDLSASTLSNDFVEKSIFDMKSEIESLYRDESERKSISDE 1897
            W+N       L    + +  G TP +I++  F       +  +S++A  H++I+  ++     R+++   N+   A +L +  K+I+VLTGAG+SV CG+PDFRS++GIYARL  +FPDL +P +MFDI YF +NP PF+ FA+EI+PG+F PS  HRFIK LE  G+LLRNY+QNIDTLE   GIK ++ CHGSF+  TC RC  K  G  I  +V+  ++  C  C                          ++KP++VFFGE L ++FH  ++EDK +VDL++VIGSSLKVRPVA IP C+  N+PQILIN+E+L  +  DIELLG+CD+I+ +IC  L     S + L   +   SI + + + +S    +++R+ IS E
Sbjct:   65 WQNNDEMMSNLRRAQRLLDDGATPLQIIQQIFPDFNASRIATMSENA--HFAILSDLLERAPVRQKLTNYNSLADAVELFKTKKHILVLTGAGVSVSCGIPDFRSKDGIYARLRSEFPDLPDPTAMFDIRYFRENPAPFYNFAREIFPGQFVPSVSHRFIKELETSGRLLRNYTQNIDTLEHQTGIKRVVECHGSFSKCTCTRCGQKYDGNEIREEVLAMRVAHCKRCEG------------------------VIKPNIVFFGEDLGREFHQHVTEDKHKVDLIVVIGSSLKVRPVALIPHCVDKNVPQILINRESLPHYNADIELLGNCDDIIRDICFSLGG---SFTELITSY--DSIMEQQGKTKSQKPSQNKRQLISQE 417          
BLAST of SMED30017149 vs. Ensembl Celegans
Match: sir-2.1 (NAD-dependent protein deacetylase sir-2.1 [Source:UniProtKB/Swiss-Prot;Acc:Q21921])

HSP 1 Score: 317.775 bits (813), Expect = 2.537e-99
Identity = 162/384 (42.19%), Postives = 236/384 (61.46%), Query Frame = -2
Query:  767 WRNT---RGQLELVNQCIQKGETPKEILKNHF----KVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWDDLSASTLSNDFVEKSIFDMKSEIESLYRDESERKSISDE 1897
            W+N       L    + +  G TP +I++  F       +  +S++A  H++I+  ++     R+++   N+   A +L +  K+I+VLTGAG+SV CG+PDFRS++GIYARL  +FPDL +P +MFDI YF +NP PF+ FA+EI+PG+F PS  HRFIK LE  G+LLRNY+QNIDTLE   GIK ++ CHGSF+  TC RC  K  G  I  +V+  ++  C  C                          ++KP++VFFGE L ++FH  ++EDK +VDL++VIGSSLKVRPVA IP C+  N+PQILIN+E+L  +  DIELLG+CD+I+ +IC  L     S + L   +   SI + + + +S    +++R+ IS E
Sbjct:   65 WQNNDEMMSNLRRAQRLLDDGATPLQIIQQIFPDFNASRIATMSENA--HFAILSDLLERAPVRQKLTNYNSLADAVELFKTKKHILVLTGAGVSVSCGIPDFRSKDGIYARLRSEFPDLPDPTAMFDIRYFRENPAPFYNFAREIFPGQFVPSVSHRFIKELETSGRLLRNYTQNIDTLEHQTGIKRVVECHGSFSKCTCTRCGQKYDGNEIREEVLAMRVAHCKRCEG------------------------VIKPNIVFFGEDLGREFHQHVTEDKHKVDLIVVIGSSLKVRPVALIPHCVDKNVPQILINRESLPHYNADIELLGNCDDIIRDICFSLGG---SFTELITSY--DSIMEQQGKTKSQKPSQNKRQLISQE 417          
BLAST of SMED30017149 vs. Ensembl Fly
Match: Sirt1 (gene:FBgn0024291 transcript:FBtr0080434)

HSP 1 Score: 366.696 bits (940), Expect = 1.852e-115
Identity = 170/339 (50.15%), Postives = 242/339 (71.39%), Query Frame = -2
Query:  881 QLELVNQCIQKGETPKEILKN---HFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNI---PIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWDD 1879
            +L  + +    G  P++++ +   HF   +   +DD++  W  + H++ E  +R ++  +NTF     L++ S+ I+VLTGAG+SV CG+PDFRS NGIYARLA DFPDL +PQ+MFDI+YF ++P+PF+KFA+EIYPG+F PS  HRFIK+LE KGKLLRNY+QNIDTLE++AGI+ +I CHGSF++A+C +C +K   + + +D+  Q+IP+CP C    E   +++ +S+  ++E    +    IMKPD+VFFGEGLP ++H  ++ DKD  DLLIVIGSSLKVRPVAHIP  +P  +PQILIN+E L    FD+ELLGD D I+ +IC +L  +D
Sbjct:  150 KLRWLQREFYTGRVPRQVIASIMPHFATGLAGDTDDSV-LWDYLAHLLNEPKRRNKLASVNTFDDVISLVKKSQKIIVLTGAGVSVSCGIPDFRSTNGIYARLAHDFPDLPDPQAMFDINYFKRDPRPFYKFAREIYPGEFQPSPCHRFIKMLETKGKLLRNYTQNIDTLERVAGIQRVIECHGSFSTASCTKCRFKCNADALRADIFAQRIPVCPQCQPNKE---QSVDASVAVTEEELRQLVENGIMKPDIVFFGEGLPDEYHTVMATDKDVCDLLIVIGSSLKVRPVAHIPSSIPATVPQILINREQLHHLKFDVELLGDSDVIINQICHRLSDND 484          
BLAST of SMED30017149 vs. Ensembl Fly
Match: Sirt2 (gene:FBgn0038788 transcript:FBtr0083882)

HSP 1 Score: 189.119 bits (479), Expect = 1.021e-53
Identity = 102/285 (35.79%), Postives = 156/285 (54.74%), Query Frame = -2
Query:  884 KNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGI--KNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETL--------------------VSHGFDIELLGDCDNIVTEICKQLQWD 1669
            + I+ + GAGIS   G+PDFRS  +G+Y+ L     +L  P ++FD+ YF KNP PFF  AKE+YPG F P+  H FI++L DKG L R+Y+QNIDTL+++ G+    II  HGSF +  C++C  +   +++++++   ++P C  C                          ++KPD+VFFGE LPK F++   ED    DLLI++G+SL+V+P A +     P   ++LIN++ +                     ++  D+  LGDCD  V  + K L WD
Sbjct:   48 RKIVTMVGAGISTSAGIPDFRSPGSGLYSNLKKY--ELPHPTAIFDLDYFEKNPAPFFALAKELYPGSFIPTPAHYFIRLLNDKGLLQRHYTQNIDTLDRLTGLPEDKIIEAHGSFHTNHCIKCRKEYDMDWMKAEIFADRLPKCQKCQG------------------------VVKPDIVFFGENLPKRFYSSPEEDFQDCDLLIIMGTSLEVQPFASLVWRPGPRCIRLLINRDAVGQASCVLFMDPNTRSLLFDKPNNTRDVAFLGDCDAGVMALAKALGWD 306          
BLAST of SMED30017149 vs. Ensembl Fly
Match: Sirt2 (gene:FBgn0038788 transcript:FBtr0344243)

HSP 1 Score: 189.119 bits (479), Expect = 1.021e-53
Identity = 102/285 (35.79%), Postives = 156/285 (54.74%), Query Frame = -2
Query:  884 KNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGI--KNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETL--------------------VSHGFDIELLGDCDNIVTEICKQLQWD 1669
            + I+ + GAGIS   G+PDFRS  +G+Y+ L     +L  P ++FD+ YF KNP PFF  AKE+YPG F P+  H FI++L DKG L R+Y+QNIDTL+++ G+    II  HGSF +  C++C  +   +++++++   ++P C  C                          ++KPD+VFFGE LPK F++   ED    DLLI++G+SL+V+P A +     P   ++LIN++ +                     ++  D+  LGDCD  V  + K L WD
Sbjct:   48 RKIVTMVGAGISTSAGIPDFRSPGSGLYSNLKKY--ELPHPTAIFDLDYFEKNPAPFFALAKELYPGSFIPTPAHYFIRLLNDKGLLQRHYTQNIDTLDRLTGLPEDKIIEAHGSFHTNHCIKCRKEYDMDWMKAEIFADRLPKCQKCQG------------------------VVKPDIVFFGENLPKRFYSSPEEDFQDCDLLIIMGTSLEVQPFASLVWRPGPRCIRLLINRDAVGQASCVLFMDPNTRSLLFDKPNNTRDVAFLGDCDAGVMALAKALGWD 306          
BLAST of SMED30017149 vs. Ensembl Fly
Match: Sirt4 (gene:FBgn0029783 transcript:FBtr0070852)

HSP 1 Score: 73.1738 bits (178), Expect = 9.947e-14
Identity = 59/204 (28.92%), Postives = 96/204 (47.06%), Query Frame = -2
Query: 1112 KQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRN-GIYAR---LAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDV--MNQQIPICPSCTTEDERNQENLLSSIGNSD--EVDTNIPIMKPDVVFFGEGLPK 1699
            K+  D +    N++VLTGAGIS   G+PD+RS   G+YAR     V   +  +  S     Y+++N   + KF+         P+  H  +   E + ++    +QN+D L   AG +N++  HGS     C+ CEY++     +S +  +N      P     D  + E  L  I N    E       +KP++VFFG+ +P+
Sbjct:   36 KRLEDFLLSKPNVLVLTGAGISTESGIPDYRSEGVGLYARSNHKPVQHMEFVK-SSAVRKRYWARNFVGWPKFSAT------QPNATHHALARFEREERVQAVVTQNVDRLHTKAGSRNVVEVHGSGYVVKCLSCEYRIDRHEFQSILASLNPAFKDAPDMIRPDG-DVEIPLEYIENFRIPECTQCGGDLKPEIVFFGDSVPR 231          
BLAST of SMED30017149 vs. Ensembl Fly
Match: Sirt6 (gene:FBgn0037802 transcript:FBtr0305358)

HSP 1 Score: 50.8322 bits (120), Expect = 1.993e-6
Identity = 53/230 (23.04%), Postives = 97/230 (42.17%), Query Frame = -2
Query: 1016 KQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGI--KNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIP 1699
            ++  +LI+ S ++++ TGAGIS   G+PDFR   G++         L+E           K  KP F  + +    +  P+  H  I  L + G +    SQNID L   +G+  K +   HG+     C +C    + +F+    +           T  +++ +    S  +S        I+  +V+ +   LP++            DL I +G++L++ P   +P
Sbjct:   35 QELAELIKKSGHVVLHTGAGISTSAGIPDFRGPKGVWT--------LEE-----------KGEKPDFNVSFD----EARPTKTHMAIIALIESGYVQYVISQNIDGLHLKSGLDRKYLSELHGNIYIEQCKKC----RRQFVSPSAVE----------TVGQKSLQRACKSSMDSKGRSCRSGILYDNVLDWEHDLPENDLEMGVMHSTVADLNIALGTTLQIVPSGDLP 227          
BLAST of SMED30017149 vs. Ensembl Zebrafish
Match: sirt1 (sirtuin 1 [Source:ZFIN;Acc:ZDB-GENE-070801-2])

HSP 1 Score: 370.163 bits (949), Expect = 6.131e-118
Identity = 181/333 (54.35%), Postives = 230/333 (69.07%), Query Frame = -2
Query:  884 GQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWD 1882
            G    + Q I +G  P+ ILK+     V     D +  W II++I  E  +RK+ + INT +    L+   K I+VLTGAG+SV CG+PDFRSR+GIYARLAVDFPDL +PQ+MFDI YF ++P+PFFKFAKEIYPG+F PS  HRFI +L+ KG+LLRNY+QNIDTLEQ+AGI+ II CHGSFA+A+C+ C++KV  E I  D+ NQ +P CP C +                   D    IMKPD+VFFGE LP+ FH  + +DKD+VDLLIVIGSSLKVRPVA IP  +P ++PQ+LIN+E L    FD+ELLGDCD IV E+C +L  D
Sbjct:  120 GSYRFIQQHIMRGTDPRAILKDLLPETVLPPDLDDMTLWQIIINI-SEPPKRKKRKDINTLEDVVRLLNERKKILVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIDYFRRDPRPFFKFAKEIYPGQFQPSPCHRFISMLDKKGRLLRNYTQNIDTLEQVAGIQKIIQCHGSFATASCLICKHKVDCEAIREDIFNQVVPHCPRCPS-------------------DVPYAIMKPDIVFFGENLPEFFHRAMKQDKDEVDLLIVIGSSLKVRPVALIPSSIPHDVPQVLINREPLPHLNFDVELLGDCDVIVNELCHRLNGD 432          
BLAST of SMED30017149 vs. Ensembl Zebrafish
Match: sirt3 (sirtuin 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1762])

HSP 1 Score: 200.29 bits (508), Expect = 1.245e-57
Identity = 111/273 (40.66%), Postives = 159/273 (58.24%), Query Frame = -2
Query:  887 RVSKNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGI--KNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETL------VSHGFDIELLGDCDNIVTEICKQLQW 1678
            R  K I+V+ GAGIS P G+PDFRS  +G+Y  L     +L   +++F+I+YF  NP PFF  AKE+YPG + P+  H FI++L DK +LLR Y+QNID LE++AGI  K ++  HG+FA+ATC  C    KGE +  D+M   +P CP+C                          I+KPD+VFFGE LP+ F   L+ D    DLLIV+G+SL+V P A + G +  ++P++LIN++ +           D+  LGD  N V ++ + L W
Sbjct:   98 RKFKRIVVMAGAGISTPSGIPDFRSPGSGLYDNLQQY--NLPYAEAIFEINYFHHNPNPFFALAKELYPGNYQPNLTHYFIRMLHDKEQLLRMYTQNIDGLERMAGIPPKMLVEAHGTFATATCTVCRRDYKGEELRDDIMAGTVPKCPTCKG------------------------IIKPDIVFFGEELPQHFFTYLT-DFPIADLLIVMGTSLEVEPFASLAGAVRGSVPRLLINRDLVGPFASGSQRHTDVAELGDVVNGVKKLVELLGW 343          
BLAST of SMED30017149 vs. Ensembl Zebrafish
Match: sirt3 (sirtuin 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1762])

HSP 1 Score: 199.904 bits (507), Expect = 1.534e-57
Identity = 111/273 (40.66%), Postives = 159/273 (58.24%), Query Frame = -2
Query:  887 RVSKNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGI--KNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETL------VSHGFDIELLGDCDNIVTEICKQLQW 1678
            R  K I+V+ GAGIS P G+PDFRS  +G+Y  L     +L   +++F+I+YF  NP PFF  AKE+YPG + P+  H FI++L DK +LLR Y+QNID LE++AGI  K ++  HG+FA+ATC  C    KGE +  D+M   +P CP+C                          I+KPD+VFFGE LP+ F   L+ D    DLLIV+G+SL+V P A + G +  ++P++LIN++ +           D+  LGD  N V ++ + L W
Sbjct:   98 RKFKRIVVMAGAGISTPSGIPDFRSPGSGLYDNLQQY--NLPYAEAIFEINYFHHNPNPFFALAKELYPGNYQPNLTHYFIRMLHDKEQLLRMYTQNIDGLERMAGIPPKMLVEAHGTFATATCTVCRRDYKGEELRDDIMAGTVPKCPTCKG------------------------IIKPDIVFFGEELPQHFFTYLT-DFPIADLLIVMGTSLEVEPFASLAGAVRGSVPRLLINRDLVGPFASGSQRHTDVAELGDVVNGVKKLVELLGW 343          
BLAST of SMED30017149 vs. Ensembl Zebrafish
Match: sirt3 (sirtuin 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1762])

HSP 1 Score: 194.512 bits (493), Expect = 8.746e-57
Identity = 107/265 (40.38%), Postives = 154/265 (58.11%), Query Frame = -2
Query:  887 LTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGI--KNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHG------FDIELLGDCDNIVTEICKQLQW 1654
            + GAGIS P G+PDFRS  +G+Y  L     +L   +++F+I+YF  NP PFF  AKE+YPG + P+  H FI++L DK +LLR Y+QNID LE++AGI  K ++  HG+FA+ATC  C    KGE +  D+M   +P CP+C                          I+KPD+VFFGE LP+ F   L+ D    DLLIV+G+SL+V P A + G +  ++P++LIN++ +           D+  LGD  N V ++ + L W
Sbjct:    1 MAGAGISTPSGIPDFRSPGSGLYDNLQQY--NLPYAEAIFEINYFHHNPNPFFALAKELYPGNYQPNLTHYFIRMLHDKEQLLRMYTQNIDGLERMAGIPPKMLVEAHGTFATATCTVCRRDYKGEELRDDIMAGTVPKCPTCKG------------------------IIKPDIVFFGEELPQHFFTYLT-DFPIADLLIVMGTSLEVEPFASLAGAVRGSVPRLLINRDLVGPFASGSQRHTDVAELGDVVNGVKKLVELLGW 238          
BLAST of SMED30017149 vs. Ensembl Zebrafish
Match: si:dkey-103i16.6 (si:dkey-103i16.6 [Source:ZFIN;Acc:ZDB-GENE-061207-46])

HSP 1 Score: 185.652 bits (470), Expect = 6.454e-52
Identity = 105/284 (36.97%), Postives = 157/284 (55.28%), Query Frame = -2
Query:  887 INTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKN--IIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVS------HGFDIELLGDCDNIVTEICKQLQW 1711
            + T  +   L RV +NI+V+ GAGIS   G+PDFR+   G+YA LA    D+  P+++F+I YFS NP PFF  AKE+YPG   P++ H FI++L  KG LLR Y+QNID LE++ GI +  ++  HGSFA+A C  C      E  +  +MN  +PIC  C                           +KP+VVFFGE LP+ +  + +ED  + DLL+++G+SLK+ P A +   +   +P++L+N++ +           D   LGD    V ++ + L W
Sbjct:  102 LETIGRLMKLGRV-RNIVVVAGAGISTASGIPDFRTPGTGLYANLAKY--DIPYPEAVFNIDYFSDNPHPFFSLAKELYPGHHRPNYVHYFIRMLHQKGLLLRMYTQNIDGLEKLCGIPDDKLVEAHGSFATAACHLCYTPYPAEEAKQAIMNGSVPICTFCAGA------------------------VKPNVVFFGEDLPEKYF-QHAEDFPKADLLMIMGTSLKIEPFASLINTVKSTVPRLLLNRDAVGPFERRPLRRADYMELGDLSESVRKLAEILGW 357          
BLAST of SMED30017149 vs. Ensembl Xenopus
Match: tspear (thrombospondin-type laminin G domain and EAR repeats [Source:Xenbase;Acc:XB-GENE-6050978])

HSP 1 Score: 370.933 bits (951), Expect = 1.332e-118
Identity = 183/353 (51.84%), Postives = 237/353 (67.14%), Query Frame = -2
Query:  893 GSNELDILSMLIGDDEEKWRNTRGQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL 1951
            G  E     M  GD  ++  +  G    V + +  G  P+ ILK+     V     D +  W I+++I+ +  +RK+ + INT   A  L++ SK I+VLTGAG+SV CG+PDFRSR+GIYARLAVDFPDL  PQ+MFDI YF K+P+PFFKFAKEI+PG+F PS  HRFI +L+ + KLLRNY+QNIDTLEQ+AGI+ II CHGSFA A+C+ C+YKV  E +  D+ NQ +P CP C++                   D  + IMKPD+VFFGE LP+ FH  +  DK++VDLLIVIGSSLKVRPVA IP  +P  +PQILIN+E L    FDIELLGDCD I+ E+C++L
Sbjct:   94 GQEEGGAEEMPNGDLSDQAVDYGGPYTFVQRHLMMGTDPRTILKDLLPDTVAPSELDDMTLWQIVINILSDPPKRKKRKDINTIDDAVKLLQESKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPNPQAMFDIEYFRKDPRPFFKFAKEIFPGQFQPSLCHRFIAMLDKEEKLLRNYTQNIDTLEQVAGIEKIIQCHGSFAEASCLVCKYKVDCEAVREDIFNQIVPRCPRCSS-------------------DEPLAIMKPDIVFFGENLPEQFHRAMKYDKNEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDIELLGDCDVIINELCQRL 427          
BLAST of SMED30017149 vs. Ensembl Xenopus
Match: tspear (thrombospondin-type laminin G domain and EAR repeats [Source:Xenbase;Acc:XB-GENE-6050978])

HSP 1 Score: 367.851 bits (943), Expect = 3.197e-118
Identity = 178/330 (53.94%), Postives = 229/330 (69.39%), Query Frame = -2
Query:  893 GQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL 1882
            G    V + +  G  P+ ILK+     V     D +  W I+++I+ +  +RK+ + INT   A  L++ SK I+VLTGAG+SV CG+PDFRSR+GIYARLAVDFPDL  PQ+MFDI YF K+P+PFFKFAKEI+PG+F PS  HRFI +L+ + KLLRNY+QNIDTLEQ+AGI+ II CHGSFA A+C+ C+YKV  E +  D+ NQ +P CP C++                   D  + IMKPD+VFFGE LP+ FH  +  DK++VDLLIVIGSSLKVRPVA IP  +P  +PQILIN+E L    FDIELLGDCD I+ E+C++L
Sbjct:   57 GPYTFVQRHLMMGTDPRTILKDLLPDTVAPSELDDMTLWQIVINILSDPPKRKKRKDINTIDDAVKLLQESKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPNPQAMFDIEYFRKDPRPFFKFAKEIFPGQFQPSLCHRFIAMLDKEEKLLRNYTQNIDTLEQVAGIEKIIQCHGSFAEASCLVCKYKVDCEAVREDIFNQIVPRCPRCSS-------------------DEPLAIMKPDIVFFGENLPEQFHRAMKYDKNEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDIELLGDCDVIINELCQRL 367          
BLAST of SMED30017149 vs. Ensembl Xenopus
Match: tspear (thrombospondin-type laminin G domain and EAR repeats [Source:Xenbase;Acc:XB-GENE-6050978])

HSP 1 Score: 367.466 bits (942), Expect = 7.169e-118
Identity = 178/330 (53.94%), Postives = 229/330 (69.39%), Query Frame = -2
Query:  893 GQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL 1882
            G    V + +  G  P+ ILK+     V     D +  W I+++I+ +  +RK+ + INT   A  L++ SK I+VLTGAG+SV CG+PDFRSR+GIYARLAVDFPDL  PQ+MFDI YF K+P+PFFKFAKEI+PG+F PS  HRFI +L+ + KLLRNY+QNIDTLEQ+AGI+ II CHGSFA A+C+ C+YKV  E +  D+ NQ +P CP C++                   D  + IMKPD+VFFGE LP+ FH  +  DK++VDLLIVIGSSLKVRPVA IP  +P  +PQILIN+E L    FDIELLGDCD I+ E+C++L
Sbjct:   71 GPYTFVQRHLMMGTDPRTILKDLLPDTVAPSELDDMTLWQIVINILSDPPKRKKRKDINTIDDAVKLLQESKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPNPQAMFDIEYFRKDPRPFFKFAKEIFPGQFQPSLCHRFIAMLDKEEKLLRNYTQNIDTLEQVAGIEKIIQCHGSFAEASCLVCKYKVDCEAVREDIFNQIVPRCPRCSS-------------------DEPLAIMKPDIVFFGENLPEQFHRAMKYDKNEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDIELLGDCDVIINELCQRL 381          
BLAST of SMED30017149 vs. Ensembl Xenopus
Match: tspear (thrombospondin-type laminin G domain and EAR repeats [Source:Xenbase;Acc:XB-GENE-6050978])

HSP 1 Score: 368.237 bits (944), Expect = 5.407e-117
Identity = 178/330 (53.94%), Postives = 229/330 (69.39%), Query Frame = -2
Query:  893 GQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL 1882
            G    V + +  G  P+ ILK+     V     D +  W I+++I+ +  +RK+ + INT   A  L++ SK I+VLTGAG+SV CG+PDFRSR+GIYARLAVDFPDL  PQ+MFDI YF K+P+PFFKFAKEI+PG+F PS  HRFI +L+ + KLLRNY+QNIDTLEQ+AGI+ II CHGSFA A+C+ C+YKV  E +  D+ NQ +P CP C++                   D  + IMKPD+VFFGE LP+ FH  +  DK++VDLLIVIGSSLKVRPVA IP  +P  +PQILIN+E L    FDIELLGDCD I+ E+C++L
Sbjct:  165 GPYTFVQRHLMMGTDPRTILKDLLPDTVAPSELDDMTLWQIVINILSDPPKRKKRKDINTIDDAVKLLQESKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPNPQAMFDIEYFRKDPRPFFKFAKEIFPGQFQPSLCHRFIAMLDKEEKLLRNYTQNIDTLEQVAGIEKIIQCHGSFAEASCLVCKYKVDCEAVREDIFNQIVPRCPRCSS-------------------DEPLAIMKPDIVFFGENLPEQFHRAMKYDKNEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDIELLGDCDVIINELCQRL 475          
BLAST of SMED30017149 vs. Ensembl Xenopus
Match: SIRT2 (sirtuin 2 [Source:NCBI gene;Acc:100489469])

HSP 1 Score: 184.496 bits (467), Expect = 4.127e-51
Identity = 105/289 (36.33%), Postives = 159/289 (55.02%), Query Frame = -2
Query:  887 KNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIK--NIIHCHGSFASATCM----RCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHG---------------------FDIELLGDCDNIVTEICKQLQW 1669
            KN++ + GAGIS   G+PDFRS  +G+Y+ L     +L  P+++F I YF +NP+PFF  A+E++PG+F P+  H FI++L++KG LLR YSQNIDTLE++AG+   +++  HG+F S+ C+    R EY +   +++  + +  IP C  C                          ++KPD+VFFGE LP  F + +  D  +VDLLIV+G+SL+V+P A +   +    P++LINKE L   G                      D+  LGDCD+    +   L W
Sbjct:  106 KNVVCMVGAGISTSAGIPDFRSPGSGLYSNLQKY--NLPYPEAIFQIGYFKENPEPFFALARELFPGQFKPTICHYFIRLLKEKGLLLRCYSQNIDTLERVAGLTSDDLVEAHGTFHSSHCVDTFCRAEYSL--SWMKEKIFSDLIPKCEKCNN------------------------LVKPDIVFFGESLPSRFFSAIKSDFPKVDLLIVMGTSLQVQPFASLVSKVSSKTPRLLINKE-LAGQGDPFFSVFGFGGGMDFDSEKAYRDVAWLGDCDDGCLALADFLGW 365          
BLAST of SMED30017149 vs. Ensembl Mouse
Match: Sirt1 (sirtuin 1 [Source:MGI Symbol;Acc:MGI:2135607])

HSP 1 Score: 369.007 bits (946), Expect = 1.334e-117
Identity = 177/331 (53.47%), Postives = 229/331 (69.18%), Query Frame = -2
Query:  893 RGQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL 1885
            RG    V Q +  G  P+ ILK+     +     D +  W I+++I+ E  +RK+ + INT + A  L++  K I+VLTGAG+SV CG+PDFRSR+GIYARLAVDFPDL +PQ+MFDI YF K+P+PFFKFAKEIYPG+F PS  H+FI + + +GKLLRNY+QNIDTLEQ+AGI+ I+ CHGSFA+A+C+ C+YKV  E +  D+ NQ +P CP C                     D  + IMKP++VFFGE LP+ FH  +  DKD+VDLLIVIGSSLKVRPVA IP  +P  +PQILIN+E L    FD+ELLGDCD I+ E+C +L
Sbjct:  135 RGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRILQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPA-------------------DEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRL 446          
BLAST of SMED30017149 vs. Ensembl Mouse
Match: Sirt1 (sirtuin 1 [Source:MGI Symbol;Acc:MGI:2135607])

HSP 1 Score: 366.696 bits (940), Expect = 3.134e-116
Identity = 176/330 (53.33%), Postives = 228/330 (69.09%), Query Frame = -2
Query:  893 GQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL 1882
            G    V Q +  G  P+ ILK+     +     D +  W I+++I+ E  +RK+ + INT + A  L++  K I+VLTGAG+SV CG+PDFRSR+GIYARLAVDFPDL +PQ+MFDI YF K+P+PFFKFAKEIYPG+F PS  H+FI + + +GKLLRNY+QNIDTLEQ+AGI+ I+ CHGSFA+A+C+ C+YKV  E +  D+ NQ +P CP C                     D  + IMKP++VFFGE LP+ FH  +  DKD+VDLLIVIGSSLKVRPVA IP  +P  +PQILIN+E L    FD+ELLGDCD I+ E+C +L
Sbjct:  175 GPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRILQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCP-------------------ADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRL 485          
BLAST of SMED30017149 vs. Ensembl Mouse
Match: Sirt1 (sirtuin 1 [Source:MGI Symbol;Acc:MGI:2135607])

HSP 1 Score: 366.696 bits (940), Expect = 3.134e-116
Identity = 176/330 (53.33%), Postives = 228/330 (69.09%), Query Frame = -2
Query:  893 GQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL 1882
            G    V Q +  G  P+ ILK+     +     D +  W I+++I+ E  +RK+ + INT + A  L++  K I+VLTGAG+SV CG+PDFRSR+GIYARLAVDFPDL +PQ+MFDI YF K+P+PFFKFAKEIYPG+F PS  H+FI + + +GKLLRNY+QNIDTLEQ+AGI+ I+ CHGSFA+A+C+ C+YKV  E +  D+ NQ +P CP C                     D  + IMKP++VFFGE LP+ FH  +  DKD+VDLLIVIGSSLKVRPVA IP  +P  +PQILIN+E L    FD+ELLGDCD I+ E+C +L
Sbjct:  175 GPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRILQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCP-------------------ADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRL 485          
BLAST of SMED30017149 vs. Ensembl Mouse
Match: Sirt1 (sirtuin 1 [Source:MGI Symbol;Acc:MGI:2135607])

HSP 1 Score: 321.242 bits (822), Expect = 6.913e-101
Identity = 157/299 (52.51%), Postives = 203/299 (67.89%), Query Frame = -2
Query:  998 GQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPG----CLPPN 1882
            G    V Q +  G  P+ ILK+     +     D +  W I+++I+ E  +RK+ + INT + A  L++  K I+VLTGAG+SV CG+PDFRSR+GIYARLAVDFPDL +PQ+MFDI YF K+P+PFFKFAKEIYPG+F PS  H+FI + + +GKLLRNY+QNIDTLEQ+AGI+ I+ CHGSFA+A+C+ C+YKV  E +  D+ NQ +P CP C                     D  + IMKP++VFFGE LP+ FH  +  DKD+VDLLIVIGSSLKVRPVA IP      +PPN
Sbjct:  175 GPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRILQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCP-------------------ADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSNQYLFVPPN 454          
BLAST of SMED30017149 vs. Ensembl Mouse
Match: Sirt2 (sirtuin 2 [Source:MGI Symbol;Acc:MGI:1927664])

HSP 1 Score: 186.422 bits (472), Expect = 1.573e-52
Identity = 109/319 (34.17%), Postives = 172/319 (53.92%), Query Frame = -2
Query:  878 GSQRKRI------EYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGI--KNIIHCHGSFASATCM--RCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKE-TLVSHGF--------------------DIELLGDCDNIVTEICKQLQWDDL 1738
            GSQ++R+      E +  + Q+       + ++ L GAGIS   G+PDFRS   G+YA L  +   L  P+++F+I YF K+P+PFF  AKE+YPG+F P+  H FI++L++KG LLR Y+QNIDTLE++AG+  ++++  HG+F ++ C+   C  +    +++  + ++  P C  C +                        ++KPD+VFFGE LP  F + +  D  +VDLLI++G+SL+V+P A +    P   P++LINKE T  +  F                    D+  LGDCD     +   L W +L
Sbjct:   15 GSQKERLLDELTLEGVTRYMQS----ERCRKVICLVGAGISTSAGIPDFRSPSTGLYANL--EKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFIRLLKEKGLLLRCYTQNIDTLERVAGLEPQDLVEAHGTFYTSHCVNTSCRKEYTMGWMKEKIFSEATPRCEQCQS------------------------VVKPDIVFFGENLPSRFFSCMQSDFSKVDLLIIMGTSLQVQPFASLISKAPLATPRLLINKEKTGQTDPFLGMMMGLGGGMDFDSKKAYRDVAWLGDCDQGCLALADLLGWKEL 303          
BLAST of SMED30017149 vs. UniProt/SwissProt
Match: sp|A0A0G2JZ79|SIR1_RAT (NAD-dependent protein deacetylase sirtuin-1 OS=Rattus norvegicus OX=10116 GN=Sirt1 PE=3 SV=2)

HSP 1 Score: 364.385 bits (934), Expect = 9.925e-117
Identity = 174/318 (54.72%), Postives = 224/318 (70.44%), Query Frame = -2
Query:  893 GETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL 1846
            G  P+ ILK+     +     D +  W I+++I+ E  +RK+ + INT + A  L++  K I+VLTGAG+SV CG+PDFRSR+GIYARLAVDFPDL +PQ+MFDI YF K+P+PFFKFAKEIYPG+F PS  H+FI + + +GKLLRNY+QNIDTLEQ+AGI+ II CHGSFA+A+C+ C+YKV  E +  D+ NQ +P CP C                     D  + IMKP++VFFGE LP+ FH  +  DKD+VDLLIVIGSSLKVRPVA IP  +P  +PQILIN+E L    FD+ELLGDCD I+ E+C +L
Sbjct:    3 GTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPA-------------------DEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRL 301          
BLAST of SMED30017149 vs. UniProt/SwissProt
Match: sp|Q96EB6|SIR1_HUMAN (NAD-dependent protein deacetylase sirtuin-1 OS=Homo sapiens OX=9606 GN=SIRT1 PE=1 SV=2)

HSP 1 Score: 367.466 bits (942), Expect = 1.649e-115
Identity = 177/330 (53.64%), Postives = 228/330 (69.09%), Query Frame = -2
Query:  893 GQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL 1882
            G    V Q +  G  P+ ILK+     +     D +  W I+++I+ E  +RK+ + INT + A  L++  K I+VLTGAG+SV CG+PDFRSR+GIYARLAVDFPDL +PQ+MFDI YF K+P+PFFKFAKEIYPG+F PS  H+FI + + +GKLLRNY+QNIDTLEQ+AGI+ II CHGSFA+A+C+ C+YKV  E +  D+ NQ +P CP C                     D  + IMKP++VFFGE LP+ FH  +  DKD+VDLLIVIGSSLKVRPVA IP  +P  +PQILIN+E L    FD+ELLGDCD I+ E+C +L
Sbjct:  183 GPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCP-------------------ADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRL 493          
BLAST of SMED30017149 vs. UniProt/SwissProt
Match: sp|Q923E4|SIR1_MOUSE (NAD-dependent protein deacetylase sirtuin-1 OS=Mus musculus OX=10090 GN=Sirt1 PE=1 SV=2)

HSP 1 Score: 366.696 bits (940), Expect = 2.192e-115
Identity = 176/330 (53.33%), Postives = 228/330 (69.09%), Query Frame = -2
Query:  893 GQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL 1882
            G    V Q +  G  P+ ILK+     +     D +  W I+++I+ E  +RK+ + INT + A  L++  K I+VLTGAG+SV CG+PDFRSR+GIYARLAVDFPDL +PQ+MFDI YF K+P+PFFKFAKEIYPG+F PS  H+FI + + +GKLLRNY+QNIDTLEQ+AGI+ I+ CHGSFA+A+C+ C+YKV  E +  D+ NQ +P CP C                     D  + IMKP++VFFGE LP+ FH  +  DKD+VDLLIVIGSSLKVRPVA IP  +P  +PQILIN+E L    FD+ELLGDCD I+ E+C +L
Sbjct:  175 GPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRILQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCP-------------------ADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRL 485          
BLAST of SMED30017149 vs. UniProt/SwissProt
Match: sp|Q9VK34|SIRT1_DROME (NAD-dependent histone deacetylase sirtuin-1 OS=Drosophila melanogaster OX=7227 GN=Sirt1 PE=1 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 1.857e-114
Identity = 170/339 (50.15%), Postives = 242/339 (71.39%), Query Frame = -2
Query:  881 QLELVNQCIQKGETPKEILKN---HFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNI---PIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWDD 1879
            +L  + +    G  P++++ +   HF   +   +DD++  W  + H++ E  +R ++  +NTF     L++ S+ I+VLTGAG+SV CG+PDFRS NGIYARLA DFPDL +PQ+MFDI+YF ++P+PF+KFA+EIYPG+F PS  HRFIK+LE KGKLLRNY+QNIDTLE++AGI+ +I CHGSF++A+C +C +K   + + +D+  Q+IP+CP C    E   +++ +S+  ++E    +    IMKPD+VFFGEGLP ++H  ++ DKD  DLLIVIGSSLKVRPVAHIP  +P  +PQILIN+E L    FD+ELLGD D I+ +IC +L  +D
Sbjct:  150 KLRWLQREFYTGRVPRQVIASIMPHFATGLAGDTDDSV-LWDYLAHLLNEPKRRNKLASVNTFDDVISLVKKSQKIIVLTGAGVSVSCGIPDFRSTNGIYARLAHDFPDLPDPQAMFDINYFKRDPRPFYKFAREIYPGEFQPSPCHRFIKMLETKGKLLRNYTQNIDTLERVAGIQRVIECHGSFSTASCTKCRFKCNADALRADIFAQRIPVCPQCQPNKE---QSVDASVAVTEEELRQLVENGIMKPDIVFFGEGLPDEYHTVMATDKDVCDLLIVIGSSLKVRPVAHIPSSIPATVPQILINREQLHHLKFDVELLGDSDVIINQICHRLSDND 484          
BLAST of SMED30017149 vs. UniProt/SwissProt
Match: sp|Q21921|SIR2_CAEEL (NAD-dependent protein deacetylase sir-2.1 OS=Caenorhabditis elegans OX=6239 GN=sir-2.1 PE=1 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 3.227e-98
Identity = 162/384 (42.19%), Postives = 236/384 (61.46%), Query Frame = -2
Query:  767 WRNT---RGQLELVNQCIQKGETPKEILKNHF----KVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWDDLSASTLSNDFVEKSIFDMKSEIESLYRDESERKSISDE 1897
            W+N       L    + +  G TP +I++  F       +  +S++A  H++I+  ++     R+++   N+   A +L +  K+I+VLTGAG+SV CG+PDFRS++GIYARL  +FPDL +P +MFDI YF +NP PF+ FA+EI+PG+F PS  HRFIK LE  G+LLRNY+QNIDTLE   GIK ++ CHGSF+  TC RC  K  G  I  +V+  ++  C  C                          ++KP++VFFGE L ++FH  ++EDK +VDL++VIGSSLKVRPVA IP C+  N+PQILIN+E+L  +  DIELLG+CD+I+ +IC  L     S + L   +   SI + + + +S    +++R+ IS E
Sbjct:   65 WQNNDEMMSNLRRAQRLLDDGATPLQIIQQIFPDFNASRIATMSENA--HFAILSDLLERAPVRQKLTNYNSLADAVELFKTKKHILVLTGAGVSVSCGIPDFRSKDGIYARLRSEFPDLPDPTAMFDIRYFRENPAPFYNFAREIFPGQFVPSVSHRFIKELETSGRLLRNYTQNIDTLEHQTGIKRVVECHGSFSKCTCTRCGQKYDGNEIREEVLAMRVAHCKRCEG------------------------VIKPNIVFFGEDLGREFHQHVTEDKHKVDLIVVIGSSLKVRPVALIPHCVDKNVPQILINRESLPHYNADIELLGNCDDIIRDICFSLGG---SFTELITSY--DSIMEQQGKTKSQKPSQNKRQLISQE 417          
BLAST of SMED30017149 vs. TrEMBL
Match: A0A1S3JLZ2 (NAD-dependent protein deacetylase sirtuin-1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106174398 PE=4 SV=1)

HSP 1 Score: 406.371 bits (1043), Expect = 3.482e-128
Identity = 203/383 (53.00%), Postives = 262/383 (68.41%), Query Frame = -2
Query:  878 LSYFLMSSETNNPEMEVGSNELDILSMLIG----DDEEKWRNTRGQLELVNQCIQKGETPKEILKNHFKVNVNHLSD--DALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL--QWDDL 2002
            L Y+L S  + +     GS E D +S +        EE+WR+  G +  V++ +  G  P+EIL +H   +   + D  D L  W I++ I+ E  +RK++ ++NT     +LI+ ++NI+VLTGAG+SV CG+PDFRSRNGIYARL+VD+PDL +PQ+MFDI YF  NPKPFFKFAKEIYPG+F PS  HRFIK+LED  KLLRNY+QNIDTLEQ+AGI+N+I CHGSFA+ATCM C+YKV    ++ D+M Q IP CP+C  E E                   +PIMKPD+VFFGE LP++FH  +S DKD  DLLIVIGSSLKVRPVA IP  + P++PQILIN+E L    FD+ELLGDCD IV E+C++L   W  L
Sbjct:   97 LEYYL-SGGSGDGSDNTGSQEEDNISEMSDLSGMSAEEEWRSMAGPISWVHRQMAGGREPREIL-HHLLPHSTFIPDEVDDLTLWKIVVEILSEPPKRKKLSHVNTMDDVVELIKRARNIIVLTGAGVSVSCGIPDFRSRNGIYARLSVDYPDLPDPQAMFDIRYFRNNPKPFFKFAKEIYPGQFQPSPCHRFIKLLEDHEKLLRNYAQNIDTLEQVAGIQNVIQCHGSFATATCMTCKYKVDANAVKEDIMKQVIPRCPNCPPEAE-------------------MPIMKPDIVFFGESLPEEFHKSMSHDKDNCDLLIVIGSSLKVRPVALIPNSVSPHVPQILINREPLKHLNFDVELLGDCDGIVQELCRRLGEGWGSL 458          
BLAST of SMED30017149 vs. TrEMBL
Match: A0A1S3JLZ9 (NAD-dependent protein deacetylase sirtuin-1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106174398 PE=4 SV=1)

HSP 1 Score: 405.986 bits (1042), Expect = 6.578e-128
Identity = 203/385 (52.73%), Postives = 263/385 (68.31%), Query Frame = -2
Query:  878 LSYFLM------SSETNNPEMEVGSNELDILSMLIGDDEEKWRNTRGQLELVNQCIQKGETPKEILKNHFKVNVNHLSD--DALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL--QWDDL 2002
            L Y+L       S  T + + E   +E+  LS +    EE+WR+  G +  V++ +  G  P+EIL +H   +   + D  D L  W I++ I+ E  +RK++ ++NT     +LI+ ++NI+VLTGAG+SV CG+PDFRSRNGIYARL+VD+PDL +PQ+MFDI YF  NPKPFFKFAKEIYPG+F PS  HRFIK+LED  KLLRNY+QNIDTLEQ+AGI+N+I CHGSFA+ATCM C+YKV    ++ D+M Q IP CP+C  E E                   +PIMKPD+VFFGE LP++FH  +S DKD  DLLIVIGSSLKVRPVA IP  + P++PQILIN+E L    FD+ELLGDCD IV E+C++L   W  L
Sbjct:   97 LEYYLSGGSGDGSDNTGSQQEEDNISEMSDLSGMSA--EEEWRSMAGPISWVHRQMAGGREPREIL-HHLLPHSTFIPDEVDDLTLWKIVVEILSEPPKRKKLSHVNTMDDVVELIKRARNIIVLTGAGVSVSCGIPDFRSRNGIYARLSVDYPDLPDPQAMFDIRYFRNNPKPFFKFAKEIYPGQFQPSPCHRFIKLLEDHEKLLRNYAQNIDTLEQVAGIQNVIQCHGSFATATCMTCKYKVDANAVKEDIMKQVIPRCPNCPPEAE-------------------MPIMKPDIVFFGESLPEEFHKSMSHDKDNCDLLIVIGSSLKVRPVALIPNSVSPHVPQILINREPLKHLNFDVELLGDCDGIVQELCRRLGEGWGSL 459          
BLAST of SMED30017149 vs. TrEMBL
Match: A0A444TSS9 (NAD-dependent histone deacetylase Sir2 OS=Armadillidium vulgare OX=13347 GN=Avbf_03284 PE=4 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 1.995e-125
Identity = 203/422 (48.10%), Postives = 266/422 (63.03%), Query Frame = -2
Query:  872 ETNNPEMEVGSNELDI--LSMLIGDDEEKWRNTRGQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEH--WSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQ--------------------------------------ENLLSSIGNSDEVDTNI---------PIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL--QWDDLSA 1978
            E N+  + VGS   D+  LS   G D   W+   G +  V Q ++KG  P+ +L  H   N  H+     +   W  I++++ E  +R+R+ +INT +    LI+V K I+VLTGAG+SV CG+PDFRS++GIY+RLA+DFPDL +PQ+MFDI+YF K+P+PFFKFAKEIYPG+FTPS  HRFI+ LE   KLLRNY+QNIDTLE+ AGIKN+I CHGSFA+ATC +C YKV  E I+ DV  Q IP+CP C++    N+                                       N   S   SD +  N          P+MKPD+VFFGEGLP +FH K++EDKD+ DLLIVIGSSLKVRPVA IP  + P++PQILIN+E L    FD+ELLGDCD IV+E+C++L   W +L+ 
Sbjct:    5 EDNDDAVSVGSTASDVSGLSDFSGKD---WKPCAGPMSWVQQQMEKGVNPRTVL-THLLGNSFHIQQGVSDFMLWHFIVNMLSEPPKRERLRHINTLEDVIRLIKVCKKIIVLTGAGVSVSCGIPDFRSKDGIYSRLAIDFPDLPDPQAMFDINYFRKDPRPFFKFAKEIYPGQFTPSLCHRFIRFLEQNNKLLRNYTQNIDTLEKQAGIKNVIECHGSFATATCQKCAYKVDAEEIKDDVFAQHIPMCPLCSSNVNENEGKFTETKSPHCTNGKNKSVENYECNRVSNTSNSSGSNVRNSFESCSESDVLGNNFMKDTEPPSDPVMKPDIVFFGEGLPDEFHDKMAEDKDECDLLIVIGSSLKVRPVALIPSSIDPHVPQILINREPLTHMTFDVELLGDCDVIVSELCRRLNDSWKELAT 422          
BLAST of SMED30017149 vs. TrEMBL
Match: A0A162Q0V9 (Putative Histone deacetylase silent information regulator protein Sir2 OS=Daphnia magna OX=35525 GN=APZ42_014162 PE=4 SV=1)

HSP 1 Score: 393.66 bits (1010), Expect = 7.119e-125
Identity = 209/455 (45.93%), Postives = 290/455 (63.74%), Query Frame = -2
Query:  605 WRNTRGQLELVNQCIQKGETPKEILKNHFKVNV---NHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCT--TEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL--QWDD-------------LSASTLSNDFVEKSIFDMKSEIESLYRDES-ERKSISDEATXXXXXXXXXXXXXEILK---LLNVGDLLRNGVTCICVPPNKYVFKGAEFLINAED 1897
            W  + G +  V Q +  G  P+ IL      +     HL D  L  W II++I+ E  +R+R+ +IN+   A  L+R  K I+VLTGAG+SV CG+PDFRSR+GIYARLAVDFPDL +PQ+MFDIHYF K+P+PFFKFA++++PG+FTPS  H+FI++LE + KLLRNY+QNIDTLEQ A I+ +I CHGSFA+ATC+RC+++V    IE D+M Q+IP+CP C+  ++DE  + +  S+ G S +     PIMKPD+VFFGEG+P +FH  +  DK++ DL+IVIGSSLKVRPVA IP  LP ++PQILIN+E L    FD+ELLGDCD IV ++C  L  QW+D             L    + +  +   +F  + + + L RD      S+  EATE  +      D     +    +N+ D L    T + V P +Y+F GAE   + ++
Sbjct:  116 WEPSSGTMSWVQQQMLLGTNPRTILNELVPNDAQIPTHLDDVTL--WKIIVNIVSEPPRRERLRHINSISDAVRLLRSCKKILVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIHYFRKDPRPFFKFARDLWPGQFTPSKCHKFIRLLERQNKLLRNYTQNIDTLEQQADIERVIQCHGSFATATCLRCQHRVPSNEIEKDIMEQRIPLCPKCSNASKDEEEEASTSSAAGLSAQ-----PIMKPDIVFFGEGMPDEFHQAMVLDKEECDLIIVIGSSLKVRPVALIPCALPNHVPQILINREPLRHMVFDVELLGDCDIIVNQLCHLLGPQWEDGICYRESLKEISRLPPRPIPSVALPAPLFPKRDQEDPLRRDSGMSTGSLEMEATESNDVEAVTHDMTGWWEPRIKVNLADQLPEN-TYLAVQPGRYLFPGAELFYDPDE 562          
BLAST of SMED30017149 vs. TrEMBL
Match: A0A3R7MC11 (Putative histone deacetylase silent information regulator protein Sir2 OS=Penaeus vannamei OX=6689 GN=C7M84_009082 PE=4 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 3.538e-123
Identity = 190/371 (51.21%), Postives = 258/371 (69.54%), Query Frame = -2
Query:  869 WRNTRGQLELVNQCIQKGETPKEILKNHFKVN---VNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGN------SDEVDTN-----------------IPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQL--QWDDLSAS 1897
            W+   G +  V Q + +G  P+ +L           + ++DDAL  W +I++++ E  +R+++ +INT +    L++  + I+VLTGAG+SV CG+PDFRSR+GIYARLAVDFPDL +PQ+MFDIHYF ++P+PFFKFA+EIYPG+FTPS  HRFI+++E   KLLRNY+QNIDTLEQ+AGIK++I CHGSFA+ATC  C YKV  E I+ D+  Q+IP CP CT  +E  Q + ++          S + +TN                  PIMKPD+VFFGEGLP +FH +++EDKD+ DLLIVIGSSLKVRPVA IP  +P ++PQILIN+E L    FD+ELLGDCD I+ E+C++L   WD+LS +
Sbjct:  151 WKPCAGPMSWVQQQMLRGVNPRTVLNQILGSTREIPDGVADDAL--WRLIVNMLSEPPRREKLRHINTLEDVVRLMKACQKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIHYFRRDPRPFFKFAREIYPGQFTPSLCHRFIRLIEQHNKLLRNYTQNIDTLEQVAGIKDVIQCHGSFATATCQVCGYKVDAEAIKGDIFAQRIPQCPKCTENEETTQGSRIAGDEQKIEDAVSRQTETNGLDFMQQRQTDPQSLPPQPIMKPDIVFFGEGLPDEFHDRMAEDKDECDLLIVIGSSLKVRPVALIPSSVPSHVPQILINREPLRHLTFDVELLGDCDIIINELCRRLGRGWDELSQT 519          
BLAST of SMED30017149 vs. Ensembl Cavefish
Match: ENSAMXT00000003809.2 (pep primary_assembly:Astyanax_mexicanus-2.0:25:45151234:45158481:-1 gene:ENSAMXG00000003731.2 transcript:ENSAMXT00000003809.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 360.918 bits (925), Expect = 2.448e-113
Identity = 177/333 (53.15%), Postives = 225/333 (67.57%), Query Frame = -2
Query:  884 GQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWD 1882
            G    + Q I +   P+ ILK+     V     D +  W II++I  E  +RK+ + INT +    L+   K I+VLTGAG+SV CG+PDFRSR+GIYARLAVDFPDL +PQ+MFDI YF ++P+PFFKFAKEIYPG+F PS  HRFI +L+ K KLLRNY+QNIDTLEQ+AG++ II CHGSFA+A+C+ C++KV  E +  D+  Q +P CP C                     D    IMKPD+VFFGE LP+ FH  + +DKD VDLLIVIGSSLKVRPVA IP  +P ++PQ+LIN+E L    FD+ELLGDCD IV E+C +L  D
Sbjct:  220 GSYRFIQQHIMRETDPRTILKDLLPETVLPPDLDDMTLWQIIINI-SEPPKRKKRKDINTLEDVVRLLNDGKKILVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIDYFRRDPRPFFKFAKEIYPGQFQPSLCHRFISMLDKKEKLLRNYTQNIDTLEQVAGVQKIIQCHGSFATASCLVCKHKVDCEAVREDIFRQVVPHCPKCP--------------------DIPFAIMKPDIVFFGENLPESFHRAMKQDKDAVDLLIVIGSSLKVRPVALIPSSVPHDVPQVLINREPLPHLNFDVELLGDCDVIVNELCHRLGGD 531          
BLAST of SMED30017149 vs. Ensembl Cavefish
Match: sirt3 (sirtuin 3 [Source:NCBI gene;Acc:103044645])

HSP 1 Score: 201.06 bits (510), Expect = 4.404e-58
Identity = 114/296 (38.51%), Postives = 169/296 (57.09%), Query Frame = -2
Query:  818 RVSKNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGI--KNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGF------DIELLGDCDNIVTEICKQLQWDDLSASTLSNDFVEKSIFDMKSE 1678
            R  K I+V+ GAGIS P G+PDFRS  +G+Y  L     +L   +++F+I+YF  NPKPFF  AKE+YPG + P+  H FI++L DKG+LLR Y+QNID LE++AGI  K ++  HG+FA+ATC  C    KGE + +D+M   +P CP C                          ++KPD+VFFGE LP+ F   L+ D    DL+IV+G+SL+V P A + G +  ++ ++LIN++ +    +      D+  LGD  + V  + + L W     + +S D   K   +M+ E
Sbjct:   87 REYKRIVVMAGAGISTPSGIPDFRSPGSGLYDNLQQY--NLPYAEAIFEINYFHHNPKPFFALAKELYPGNYQPNLTHYFIRLLHDKGQLLRMYTQNIDGLERMAGIPPKMLVEAHGTFATATCTVCRRDYKGEELRNDIMAGTVPNCPHCKG------------------------VIKPDIVFFGEELPQHFFLYLT-DFPIADLVIVMGTSLEVEPFASLAGAVRGSVSRLLINRDLVGPFAWGSPRHNDVAELGDVVSGVRRLAEALGWMPELEALMSAD--AKKASEMREE 353          
BLAST of SMED30017149 vs. Ensembl Cavefish
Match: sirt2 (sirtuin 2 [Source:NCBI gene;Acc:103038996])

HSP 1 Score: 181.8 bits (460), Expect = 1.467e-50
Identity = 94/238 (39.50%), Postives = 145/238 (60.92%), Query Frame = -2
Query:  971 KNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGI--KNIIHCHGSFASATCMR--CEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKE 1669
            KNI+ + GAGIS   G+PDFRS   G+YA L     +L  P+++F I YF K+P+PFF  A+E+YPG+F P+  H FI++L+DKG L R YSQNIDTLE++AG+  +++I  HG+F ++ C+   C  +   ++++  + ++ IP C +C                          ++KPD+VFFGE LP  F   + +D    DLLI++G+SL+V+P A +   +P + P++LIN E
Sbjct:   77 KNIICMVGAGISTSAGIPDFRSPGTGLYANLQK--YNLPYPEAIFQIDYFKKHPEPFFALARELYPGQFKPTVCHYFIRMLKDKGLLRRCYSQNIDTLERVAGLEGEDLIEAHGTFHTSHCVSLFCRKEYTMDWMKEKIFSEDIPKCDACNN------------------------LVKPDIVFFGENLPARFFTTMKKDFPHCDLLIIMGTSLQVQPFASLVSRVPNSCPRLLINME 288          
BLAST of SMED30017149 vs. Ensembl Cavefish
Match: si:dkey-103i16.6 (si:dkey-103i16.6 [Source:ZFIN;Acc:ZDB-GENE-061207-46])

HSP 1 Score: 175.637 bits (444), Expect = 5.026e-48
Identity = 95/270 (35.19%), Postives = 153/270 (56.67%), Query Frame = -2
Query:  887 KNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKN--IIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVS------HGFDIELLGDCDNIVTEICKQLQW 1669
            +N++V+ GAGIS   G+PDFR+   G+YA L  +  ++  P+++F+I YFS +P+PFF  AKE+YPG+  P++ H FI++L  KG LLR Y+QNID LE++ GI +  ++  HGSFA+A+C  C      E  +  +M+  IP C  C+                          +KP VVFFGE LP+ +  + ++D  + DLLI++G+SL++ P A +   +   +P++L+N+  +           D   LGD  + V ++ + L W
Sbjct:  122 RNVVVVAGAGISTASGIPDFRTPGTGLYANL--EKYNVPYPEAVFNIDYFSDDPRPFFSLAKELYPGRHRPNYIHYFIRMLHQKGLLLRMYTQNIDGLEKMCGIPDDKLVEAHGSFATASCHLCYTPFPSEEAKEAIMSDNIPTCSFCSA------------------------TVKPSVVFFGEDLPETYF-QHAQDFPKADLLIIMGTSLQIEPFASLVNTVKSTVPRLLLNRHAVGPFERKPLRRRDYLELGDLVHSVRKLAEILGW 364          
BLAST of SMED30017149 vs. Ensembl Cavefish
Match: si:dkey-103i16.6 (si:dkey-103i16.6 [Source:ZFIN;Acc:ZDB-GENE-061207-46])

HSP 1 Score: 167.933 bits (424), Expect = 6.924e-47
Identity = 95/270 (35.19%), Postives = 151/270 (55.93%), Query Frame = -2
Query:  887 KNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKN--IIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVS------HGFDIELLGDCDNIVTEICKQLQW 1669
            +N++V+ GAGIS   G+PDFR+   G+YA L  +  ++  P+++F+I YFS +P+PFF  AKE+YPG+  P++ H FI++L  KG LLR Y+QNID LE++ GI +  ++  HGSFA+A+C  C         E  +M+  IP C  C+                          +KP VVFFGE LP+ +    ++D  + DLLI++G+SL++ P A +   +   +P++L+N+  +           D   LGD  + V ++ + L W
Sbjct:    7 RNVVVVAGAGISTASGIPDFRTPGTGLYANL--EKYNVPYPEAVFNIDYFSDDPRPFFSLAKELYPGRHRPNYIHYFIRMLHQKGLLLRMYTQNIDGLEKMCGIPDDKLVEAHGSFATASCHLCYTPFPS---EEAIMSDNIPTCSFCSA------------------------TVKPSVVFFGEDLPETYFQH-AQDFPKADLLIIMGTSLQIEPFASLVNTVKSTVPRLLLNRHAVGPFERKPLRRRDYLELGDLVHSVRKLAEILGW 246          
BLAST of SMED30017149 vs. Ensembl Sea Lamprey
Match: sirt2 (sirtuin 2 (silent mating type information regulation 2, homolog) 2 (S. cerevisiae) [Source:NCBI gene;Acc:322309])

HSP 1 Score: 193.741 bits (491), Expect = 6.420e-56
Identity = 105/286 (36.71%), Postives = 160/286 (55.94%), Query Frame = -2
Query:  881 KNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKN--IIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETL-----------VSHGF---------DIELLGDCDNIVTEICKQLQWDD 1669
            KNI+ + GAGIS   G+PDFRS   G+Y  L     +L  PQ++FDI YF +NP+PFF  AKE+YPG+F P+  H FI++L+DK  LLR Y+QNIDTLE++AG++N  ++  HG+F ++ C+ C ++    +++  + + ++P C  C +                        ++KPD+VFFGE LP+ F   +  D  + DLLI++G+SL V+P A +   +P + P++LIN E             +  GF         D+  LG CD+   E  + L W D
Sbjct:   42 KNIVCMVGAGISTAAGIPDFRSPGTGLYDNLQKY--NLPHPQAVFDIGYFRENPEPFFALAKELYPGQFKPTVSHYFIRLLKDKECLLRCYTQNIDTLERVAGLENNELVEAHGTFHTSHCLGCRHEYCLSWMKEQIFSDKVPRCEKCKS------------------------VVKPDIVFFGEALPEKFFTCVQSDFPKCDLLIIMGTSLVVQPFASLTSRVPDSTPRLLINLEKSGQCDPMLAALGLGSGFDFDSDDAYRDVAWLGTCDDGCLEFAELLGWKD 301          
BLAST of SMED30017149 vs. Ensembl Sea Lamprey
Match: sirt3 (sirtuin 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1762])

HSP 1 Score: 170.629 bits (431), Expect = 2.845e-48
Identity = 104/287 (36.24%), Postives = 159/287 (55.40%), Query Frame = -2
Query:  884 INTFKQACDLIRVS--KNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKN--IIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETL------VSHGFDIELLGDCDNIVTEICKQLQWD 1711
            I T +    LIR    KNI+++ GAG+S   G+PDFR+   G+Y  L      L  P+++FD+ +F+ +PKPFF  A+E+YPG   P+  H F ++L ++  LLR Y+QNID LE++AG+    ++  HG+FASATC +C     G+ +   VM+ +IP C +C+                         ++KPD+VFFGE LP+ F+A   +D    DLLIVIG+SL+V P A +   + P +P++L+N+E +       S   D+  L D    V  +   + WD
Sbjct:   11 IETLEDVARLIRDGHCKNIVLMAGAGMSTASGIPDFRTPGTGLYDNLQRY--HLPFPEAVFDLDFFAVDPKPFFTLAQELYPGNCRPNDAHYFARLLHERRLLLRLYTQNIDGLERVAGLPPDMLVEAHGTFASATCTQCRKPQPGDQVRRTVMSGKIPHCGACSA------------------------VVKPDIVFFGEDLPRRFYA-YDQDFSMADLLIVIGTSLEVMPFAGLVSAVRPGVPRLLLNREAVGLFRRAASSPTDVAHLDDVVAGVRRLTNLVGWD 270          
BLAST of SMED30017149 vs. Ensembl Sea Lamprey
Match: sirt4 (sirtuin 4 [Source:ZFIN;Acc:ZDB-GENE-041010-65])

HSP 1 Score: 68.5514 bits (166), Expect = 7.995e-13
Identity = 59/235 (25.11%), Postives = 108/235 (45.96%), Query Frame = -2
Query: 1037 DLIRVSKNIMVLTGAGISVPCGVPDFRSRN-GIYARLAVDFPDLDE--PQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDER----NQENLLSSIGNSDEVDTNIP-------IMKPDVVFFGEGLPK----DFHAKLSEDKDQVDLLIVIGSSLKV 1687
            D +  S+ + VL GAG+S   G+PD+RS   G+YAR +       E    ++    Y+++N   + +F+         P+  H  +   E +G+L    +QN+D L   AG + I   HG      C+ C+   +     +++  + + + P    + E+    + + LLS   +S      +P        +KP+V FFG+ + +    D + +L     + D ++V GSSL+V
Sbjct:   45 DFLANSRRLFVLAGAGLSTESGIPDYRSEGVGLYARTSRRPMQHAEFARSAVARRRYWARNFTGWPRFSSR------RPNAAHLALGRWEQQGRLHWLVTQNVDALHAKAGSRRITELHGCSHRVVCLDCKEVTQ----RTELQQRMLDMNPGWQQQHEQAIAPDGDVLLS---DSQVESFRVPPCRSCGGPLKPEVTFFGDNVDRRTVDDVYQRL-----ESDTVLVAGSSLQV 261          
BLAST of SMED30017149 vs. Ensembl Yeast
Match: HST1 (NAD(+)-dependent histone deacetylase; essential subunit of the Sum1p/Rfm1p/Hst1p complex required for ORC-dependent silencing and meiotic repression; non-essential subunit of the Set3C deacetylase complex; involved in telomere maintenance; HST1 has a paralog, SIR2, that arose from the whole genome duplication [Source:SGD;Acc:S000005429])

HSP 1 Score: 238.039 bits (606), Expect = 4.652e-71
Identity = 120/294 (40.82%), Postives = 181/294 (61.56%), Query Frame = -2
Query:  884 SQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIK--NIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNI--------PIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWD 1735
            S R R+   NT       +R +K I+VLTGAG+S   G+PDFRS  G Y++  +    L++PQ +F++  F ++P  F+  A  + P +   S  H FIK+L+DKGKLLRNY+QNID LE  AGI    ++ CHGSFA+A+C+ C +++ GE I  ++ N ++P+CP C    +R Q   +S+  N+ + + N          ++KPD+ FFGE LP  FH  + +D  + DLLI IG+SLKV PV+ I   +P ++PQILIN++ +    FD+ LLG CD++ + + K+  WD
Sbjct:  179 STRLRLPNFNTIDHFTATLRNAKKILVLTGAGVSTSLGIPDFRSSEGFYSK--IRHLGLEDPQDVFNLDIFLQDPSVFYNIAHMVLPPENMYSPLHSFIKMLQDKGKLLRNYTQNIDNLESYAGIDPDKLVQCHGSFATASCVTCHWQIPGEKIFENIRNLELPLCPYCY--QKRKQYFPMSNGNNTVQTNINFNSPILKSYGVLKPDMTFFGEALPSRFHKTIRKDILECDLLICIGTSLKVAPVSEIVNMVPSHVPQILINRDMVTHAEFDLNLLGFCDDVASLVAKKCHWD 468          
BLAST of SMED30017149 vs. Ensembl Yeast
Match: SIR2 (Conserved NAD+ dependent histone deacetylase of the Sirtuin family; deacetylation targets are primarily nuclear proteins; required for telomere hypercluster formation in quiescent yeast cells; involved in regulation of lifespan; plays roles in silencing at HML, HMR, telomeres, and rDNA; negatively regulates initiation of DNA replication; functions as regulator of autophagy like mammalian homolog SIRT1, and also of mitophagy [Source:SGD;Acc:S000002200])

HSP 1 Score: 225.328 bits (573), Expect = 9.364e-66
Identity = 116/294 (39.46%), Postives = 173/294 (58.84%), Query Frame = -2
Query:  887 RKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKN--IIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTT-------EDERNQENLLSSIGNSDE----VDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQW 1729
            R R+    T       +  ++ I+VLTGAG+S   G+PDFRS  G Y++  +    LD+PQ +F+ + F  +P  F+  A  + P +   S  H FIK+L+ KGKLLRNY+QNID LE  AGI    ++ CHGSFA+ATC+ C + + GE I + + N ++P+CP C         E   N+  + +S G+  E    +  +  ++KPD+ FFGE LP  FH  + ED  + DLLI IG+SLKV PV+ I   +P ++PQ+LIN++ +    FD+ LLG CD+I   + ++  W
Sbjct:  235 RLRLSNFFTIDHFIQKLHTARKILVLTGAGVSTSLGIPDFRSSEGFYSK--IKHLGLDDPQDVFNYNIFMHDPSVFYNIANMVLPPEKIYSPLHSFIKMLQMKGKLLRNYTQNIDNLESYAGISTDKLVQCHGSFATATCVTCHWNLPGERIFNKIRNLELPLCPYCYKKRREYFPEGYNNKVGVAASQGSMSERPPYILNSYGVLKPDITFFGEALPNKFHKSIREDILECDLLICIGTSLKVAPVSEIVNMVPSHVPQVLINRDPVKHAEFDLSLLGYCDDIAAMVAQKCGW 526          
BLAST of SMED30017149 vs. Ensembl Yeast
Match: HST2 (Cytoplasmic NAD(+)-dependent protein deacetylase; deacetylation targets are primarily cytoplasmic proteins; member of the silencing information regulator 2 (Sir2) family of NAD(+)-dependent protein deacetylases; modulates nucleolar (rDNA) and telomeric silencing; possesses NAD(+)-dependent histone deacetylase activity in vitro; contains a nuclear export signal (NES); function regulated by its nuclear export [Source:SGD;Acc:S000005936])

HSP 1 Score: 154.836 bits (390), Expect = 4.148e-42
Identity = 104/321 (32.40%), Postives = 161/321 (50.16%), Query Frame = -2
Query:  779 IMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKN--IIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKD-------------QVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLV-----SHGFDIELLGDCDNIVTEICKQLQWDD-----LSASTLSNDFVEKSIFDMKSEIESLYRDESERKS 1663
            ++ + GAGIS  CG+PDFRS   G+Y  LA     L  P+++FD+ +F  +P PF+  AKE+YPG F PS  H  +K+ +DK  L R Y+QNIDTLE+ AG+K+  II  HGSFA   C+ C     G+     V   ++   P                I +  + D    ++KP +VFFGE LP  F      D +             Q  L+IV+G+SL V P A +P  +P  + ++L N ET+          D+ +    D    ++ ++L W +     L+A     D  ++ + ++  ++E+L  D+SE +S
Sbjct:   27 VIFMVGAGISTSCGIPDFRSPGTGLYHNLAR--LKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGC-----GKVYPPQVFKSKLAEHP----------------IKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITTSGKHPQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTAQGGMGDNSKEQLLEIVHDLENLSLDQSEHES 324          
BLAST of SMED30017149 vs. Ensembl Yeast
Match: HST3 (Member of the Sir2 family of NAD(+)-dependent protein deacetylases; involved along with Hst4p in telomeric silencing, cell cycle progression, radiation resistance, genomic stability and short-chain fatty acid metabolism [Source:SGD;Acc:S000005551])

HSP 1 Score: 116.701 bits (291), Expect = 2.633e-28
Identity = 91/299 (30.43%), Postives = 142/299 (47.49%), Query Frame = -2
Query:  893 SKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVD---FPDLDEPQSMFDIHYFSKNPK--PFFKFAKEIYPGK--FTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIK------------------NIIHCHGSFASATCMRCEYKVKGEFIESDVMNQ-QIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLP--KDFHAKLSED--KDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQ-----ILINKETLVS---HG-FDIELLGDCDNIVTEICKQL 1672
            S+ I  LTGAGIS   G+PDFRS +G+Y  +  D   +  +   + MFDI  F  + K   F KF + +Y       P+  H+FI  L+D+ KLLR Y+QNID LE+  G+                   +++  HG   + +C +C          S  + + ++P+CP C     +       ++G      +N+ I++P++V +GE  P  +     L+ D  K   D LI++G+SLKV  V  +   L   I       IL+NK  +     HG  D ++  DCDN VT +  Q+
Sbjct:   52 SRRIACLTGAGISCNAGIPDFRSSDGLYDLVKKDCSQYWSIKSGREMFDISLFRDDFKISIFAKFMERLYSNVQLAKPTKTHKFIAHLKDRNKLLRCYTQNIDGLEESIGLTLSNRKLPLTSFSSHWKNLDVVQLHGDLKTLSCTKCFQTFPWSRYWSRCLRRGELPLCPDCEALINKRLNEGKRTLG------SNVGILRPNIVLYGENHPSCEIITQGLNLDIIKGNPDFLIIMGTSLKVDGVKQLVKKLSKKIHDRGGLIILVNKTPIGESSWHGIIDYQIHSDCDNWVTFLESQI 344          
BLAST of SMED30017149 vs. Ensembl Yeast
Match: HST4 (NAD(+)-dependent protein deacetylase; deacetylation targets are primarily mitochondrial proteins; involved along with Hst3p in silencing at telomeres, cell cycle progression, radiation resistance, genomic stability and short-chain fatty acid metabolism; accumulates in mitochondria in response to biotin starvation and may link biotin metabolism with energy homeostasis; member of the Sir2 family and may be the functional equivalent of human SIRT3 [Source:SGD;Acc:S000002599])

HSP 1 Score: 84.3445 bits (207), Expect = 5.574e-18
Identity = 84/298 (28.19%), Postives = 132/298 (44.30%), Query Frame = -2
Query:  911 SKNIMVLTGAGISVPCGVPDFRSRNGIYARL----AVDFPDL-----DEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQ-----------IAGIKNIIHCHGSFASATCMRC---------EYKVKGEFIESDVMNQQIPICPSCTT-EDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPK-DFHAKLSED--KDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQ-----ILIN-----KETLVSHGF-DIELLGDCDNIVT 1672
            SK ++V++GAGISV  G+PDFRS  GI++ +      D  D      DE  S+     F++     F+ +K   P KF     H  +      G+LLR Y+QNID L+               I + +  HGS     C +C          +K   +F   D   + IP CP C   E  R    L S         T +  ++P V+ + E  P+ DF  +++ +  K ++D LI++G+SLK+  V +I       +       + +N     K  L S  F D+ +LGDC ++ +
Sbjct:   92 SKRMVVVSGAGISVAAGIPDFRSSEGIFSTVNGGSGKDLFDYNRVYGDESMSL----KFNQLMVSLFRLSKNCQPTKF-----HEMLNEFARDGRLLRLYTQNIDGLDTQLPHLSTNVPLAKPIPSTVQLHGSIKHMECNKCLNIKPFDPELFKCDDKF---DSRTEIIPSCPQCEEYETVRKMAGLRS---------TGVGKLRPRVILYNEVHPEGDFIGEIANNDLKKRIDCLIIVGTSLKIPGVKNICRQFAAKVHANRGIVLYLNTSMPPKNVLDSLKFVDLVVLGDCQHVTS 368          
BLAST of SMED30017149 vs. Ensembl Nematostella
Match: EDO31684 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX90])

HSP 1 Score: 350.903 bits (899), Expect = 2.818e-116
Identity = 173/324 (53.40%), Postives = 231/324 (71.30%), Query Frame = -2
Query:  905 VNQCIQKGETPKEILKN---HFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEI 1867
            V + I  G +P++IL     H +V  N +S+  L  W I++ I+ E ++R+++  +NT      LI+  KNI+VLTGAG+SV CG+PDFRSR+GIYA+L+V++PDL +PQ+MFDI YF++NPKPFFKFAKEIYPG+F PS  HRFI  LE+ G LLRNYSQNIDTLEQ+AGI  +I CHGSF++A+CMRC++KV  E I+ D+  + IP+C +C+ ++E                     IMKPD+VFFGE LP +F+  L +D ++ DLLIVIGSSLKVRPVA IP  + P +PQILIN+E L    FD+ELLGDCD IV+E+
Sbjct:    4 VQRQIDLGISPRDILSYMVPHARVPPN-VSNSTL--WKIVIDILTEPTKRQKLPNVNTLDDVVRLIKKCKNIIVLTGAGVSVSCGIPDFRSRDGIYAKLSVEYPDLPDPQAMFDITYFNQNPKPFFKFAKEIYPGQFKPSLCHRFIHQLEEHGHLLRNYSQNIDTLEQVAGITRVIQCHGSFSTASCMRCKHKVPCEAIKEDIFRKNIPVCSTCSPDEEFPS------------------IMKPDIVFFGESLPSNFYTHLGDDSNKADLLIVIGSSLKVRPVALIPSHISPEVPQILINREPLRHMTFDVELLGDCDAIVSEL 306          
BLAST of SMED30017149 vs. Ensembl Nematostella
Match: EDO48459 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIU3])

HSP 1 Score: 183.341 bits (464), Expect = 9.988e-53
Identity = 106/279 (37.99%), Postives = 154/279 (55.20%), Query Frame = -2
Query:  887 KNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIK--NIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSH------GFDIEL---------LGDCDNIVTEICKQLQW 1669
            KNI+VLTGAGIS   G+PDFR+  +G++  L      L   +S+F+I YF  NPKPFF  AK +YPG+F P+  H FIK+L++KG LLR+Y+QNIDTLE++AGI   +++  HGSF +  CM C  +   ++I  ++M  +IP C  C                          ++KPD+ FFG+ +P  F+   +ED  + DLLIV+G+SL V+P A +   +  + P++LIN+E           GF  EL         LG  D+    +   L W
Sbjct:   19 KNIVVLTGAGISTTAGIPDFRTPGSGLFNVLQTY--GLTTARSIFEIDYFQMNPKPFFVAAKAVYPGQFKPTISHYFIKLLQNKGLLLRHYTQNIDTLERVAGITGDHLMEAHGSFHTGHCMACNKEYSQDWIRVEIMADKIPRCTECDG------------------------VVKPDIGFFGDPMPDKFYQLAAEDFPKCDLLIVMGTSLIVQPFASLIARVSVDTPRLLINREKCGYEVHGPRPGFQFELKDNKRDVAWLGTTDDGCLALAALLGW 271          
BLAST of SMED30017149 vs. Ensembl Nematostella
Match: EDO47672 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLD5])

HSP 1 Score: 183.726 bits (465), Expect = 2.763e-52
Identity = 103/268 (38.43%), Postives = 156/268 (58.21%), Query Frame = -2
Query:  881 LTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGI--KNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETL--VSHGF-----DIELLGDCDNIVTEICKQLQWDD 1654
            + GAGIS P G+PDFR+   G+Y  L     ++ EP ++FDI YF  +P+PFF  AK +YPG + P++ H F+K+L DKG LLR Y+QNID LE++AG+  + ++  HG+F++A+C+ C +   GE I   + N  IP C +   +                       ++KPDVVFFGE LPK F++    D  + DLL+V+G+SL+V P A I   +  + P++LIN+E++    H +     D+ L GD  + V  + K L+W D
Sbjct:    1 MAGAGISTPSGIPDFRTPGTGLYDNLQEY--NIPEPTAIFDIEYFWYDPRPFFCLAKTLYPGNYQPNYVHYFVKLLHDKGFLLRMYTQNIDGLERLAGLPAEKLVEAHGTFSTASCISCHHSYDGEQIRKTIENGDIPRCETIKCKG----------------------VIKPDVVFFGEDLPKRFYS-FEIDFRKCDLLLVMGTSLEVEPFAGIVNEVSRSTPRVLINRESVGPFLHPWRRRPKDVVLKGDIVSSVKRLAKLLEWTD 243          
BLAST of SMED30017149 vs. Ensembl Nematostella
Match: EDO46813 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNW2])

HSP 1 Score: 176.407 bits (446), Expect = 7.191e-50
Identity = 112/319 (35.11%), Postives = 171/319 (53.61%), Query Frame = -2
Query:  887 LHIIMEGSQRKRIEYI---NTFKQACDLIRVSK--NIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKN--IIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKE------------TLVSHGF---------DIELLGDCDNIVTEICKQLQW 1756
            L++  E S++++ E +    +F+   + I+  K  +I+V+TGAGIS   G+PDFRS   G+Y  L     +L  P+S+F+I YF  NP+PFF   KE+YPG F P+  H FIK+L DK  LLRNY+QN+DTLE+IAG+ +  ++  HGSF +A C+ C+ +   E +  ++   ++P C  C                          ++KPD+VFFGE LP  FH  + +D    DL+I++G+SL V+P A +   +    P++LINKE            + V  GF         D+  LG  D+    + + L W
Sbjct:    9 LNLTQEKSEKEKPEQLLDEVSFEGVANYIKSGKCKHIIVMTGAGISTAAGIPDFRSPGTGLYDNLQKY--NLPYPESIFEIGYFRSNPEPFFALCKELYPGSFKPTMSHYFIKLLYDKKLLLRNYTQNVDTLERIAGVPDDLLVEAHGSFHTAHCIECKKEYTKEDVRDEIFADKVPRCSGCEG------------------------VIKPDIVFFGESLPGRFHRLVPQDMPHCDLIIIMGTSLAVQPFASLIDRVLATTPRLLINKEKCGRQASFLSFLSGVDSGFKFDKEDNYRDVAWLGTTDDGCLALAELLGW 301          
BLAST of SMED30017149 vs. Ensembl Nematostella
Match: EDO47362 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMK8])

HSP 1 Score: 75.485 bits (184), Expect = 4.577e-15
Identity = 65/231 (28.14%), Postives = 102/231 (44.16%), Query Frame = -2
Query: 1025 DLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPK---PFFKFAKEIYPGKFTPSFGH----RFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCT---TEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVA 1687
            DL+  +KNI+ LTGAGIS   G+P FR   G++   +    DL  P +      F  NP     F+ + +E+   K  P+  H     F K + ++GK +   +QNID L + AG +++I  HG+       RC +      I   ++    P  P      TE  R             E D    +++P VV+FGE L      ++ +   + D   ++G+S  V P A
Sbjct:   20 DLLSKAKNILFLTGAGISAESGIPTFRGAGGLWRTFSAT--DLATPGA------FHTNPSLVWEFYSYRREVVLSK-KPNPAHFAIAEFQKKMRNEGKQVWVVTQNIDELHKTAGAEDVIELHGTLFKT---RCNHVTTQGSITLGIVLAPDPNAPDAKIPLTELPRCVR---------PECDA---LVRPHVVWFGEALDPVVLQQIEKVLGECDFCFIVGTSSVVYPAA 226          
BLAST of SMED30017149 vs. Ensembl Medaka
Match: ENSORLT00000017143.2 (sirtuin 1 [Source:NCBI gene;Acc:101175344])

HSP 1 Score: 362.073 bits (928), Expect = 3.031e-115
Identity = 178/333 (53.45%), Postives = 233/333 (69.97%), Query Frame = -2
Query:  884 GQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWD 1882
            G   L++Q I++ + P+ IL++     +     D +  W II++I  E  +RK+ + +NT +    L+  SK IMVLTGAG+SV CG+PDFRSR+GIYARLAVDFPDL +PQSMFDI YF ++P+PFFKFAKEI+PG+F PS  HRFI +L+ + KLLRNY+QNIDTLEQ+AG++ II CHGSFA+A+C+ C++KV  E I  D+ NQ +P CP C+                    D  + IMKPD+VFFGE LP+ FH  + +DKD+VDLLIVIGSSLKVRPVA IP  +P  +PQ+LIN+E L    FD+ELLGDCD IV E+C +L  D
Sbjct:  153 GSYSLIHQHIRETD-PRAILRDLLPETILPPDLDDMTLWQIIINI-SEPPKRKKRKDVNTVEDVVRLLHESKRIMVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQSMFDIEYFRRDPRPFFKFAKEIFPGQFQPSPCHRFIAMLDKQEKLLRNYTQNIDTLEQVAGVQKIIQCHGSFATASCLVCKHKVDCEAIREDIFNQVVPRCPRCS--------------------DIPLAIMKPDIVFFGENLPEMFHRAMKQDKDEVDLLIVIGSSLKVRPVALIPNSIPHEVPQVLINREPLPHLNFDVELLGDCDGIVNELCHRLGGD 463          
BLAST of SMED30017149 vs. Ensembl Medaka
Match: sirt3 (sirtuin 3 [Source:NCBI gene;Acc:101161471])

HSP 1 Score: 189.504 bits (480), Expect = 5.180e-54
Identity = 104/272 (38.24%), Postives = 156/272 (57.35%), Query Frame = -2
Query:  887 RVSKNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGI--KNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGF-----DIELLGDCDNIVTEICKQLQW 1678
            R  K ++V+ GAGIS P G+PDFRS  +G+Y  L     DL   +++F+I +F +NP PFF  AKE+YPG + P+  H F+ +L  KG+LLR Y+QNID LE++AGI  + ++  HG+FA+ATC  C  K KGE +   VM+  +P C +C                          ++KPD+VFFGE LP  F   L+ D    DLLI++G+SL+V P A + G +  ++P++LIN++ +    +     D+  LG+    V  + + L W
Sbjct:   78 RQHKRVVVMAGAGISTPSGIPDFRSPGSGLYDNLQQY--DLPYAEAIFEIGFFHRNPAPFFALAKELYPGNYRPNPTHFFVHLLHQKGQLLRMYTQNIDGLERLAGIPPEKLVEAHGTFATATCTSCLQKYKGEELRPAVMSGSVPKCSACGG------------------------VVKPDIVFFGEELPPHFLKYLT-DFPLADLLIIMGTSLEVEPFASLAGAVRSSVPRLLINRDPVGPFVWGRRPQDVLQLGEVMGGVQALVEALGW 322          
BLAST of SMED30017149 vs. Ensembl Medaka
Match: sirt3 (sirtuin 3 [Source:NCBI gene;Acc:101161471])

HSP 1 Score: 182.57 bits (462), Expect = 2.897e-52
Identity = 106/294 (36.05%), Postives = 163/294 (55.44%), Query Frame = -2
Query:  809 LTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGI--KNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGF-----DIELLGDCDNIVTEICKQLQW----DDLSASTLSNDFVEKSIFDMKSEIES 1654
            + GAGIS P G+PDFRS  +G+Y  L     DL   +++F+I +F +NP PFF  AKE+YPG + P+  H F+ +L  KG+LLR Y+QNID LE++AGI  + ++  HG+FA+ATC  C  K KGE +   VM+  +P C +C                          ++KPD+VFFGE LP  F   L+ D    DLLI++G+SL+V P A + G +  ++P++LIN++ +    +     D+  LG+    V  + + L W      L A+  ++ +  + I  + S + S
Sbjct:    1 MAGAGISTPSGIPDFRSPGSGLYDNLQQY--DLPYAEAIFEIGFFHRNPAPFFALAKELYPGNYRPNPTHFFVHLLHQKGQLLRMYTQNIDGLERLAGIPPEKLVEAHGTFATATCTSCLQKYKGEELRPAVMSGSVPKCSACGG------------------------VVKPDIVFFGEELPPHFLKYLT-DFPLADLLIIMGTSLEVEPFASLAGAVRSSVPRLLINRDPVGPFVWGRRPQDVLQLGEVMGGVQALVEALGWTRELQALMAAGKTDGWQREPIRTVFSSVAS 267          
BLAST of SMED30017149 vs. Ensembl Medaka
Match: si:dkey-103i16.6 (NAD-dependent protein deacetylase sirtuin-3, mitochondrial [Source:NCBI gene;Acc:101165477])

HSP 1 Score: 182.57 bits (462), Expect = 1.457e-50
Identity = 110/313 (35.14%), Postives = 169/313 (53.99%), Query Frame = -2
Query:  767 KNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKN--IIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDF--HAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETL-------VSHGFDIELLGDCDNIVTEICKQLQWDDLSASTLSNDFVEKSIFDMKSEIESLYRDESERKSISDE 1669
            KN++V+ GAGIS   G+PDFR+   G+Y+ L  +  ++  P+++F+I YFS NP+PFF  AK +YPG   P++ H FI+VL  KG LLR Y+QNID LE++ GI +  ++  HGSFA+A+C  C      E     +M+ ++P C  CT                          +KPDVVFFGE LP+ +  H K   D  + DLLI++G+SLK+ P A +   +   +P++L+N+  +       +  G  +E LGD  + V +  + L WD      + +  V +   D +S  E+   + S   S S+E
Sbjct:  120 KNVVVVAGAGISTASGIPDFRTPGTGLYSNL--EKYNVPYPEAIFNIDYFSDNPQPFFSLAKVLYPGSHRPNYIHYFIRVLHHKGLLLRMYTQNIDGLEKLCGIPDDKLVEAHGSFATASCHLCYTPYPAEEARYAIMHDRVPTCSFCTA------------------------TVKPDVVFFGEDLPRKYFLHRK---DFPKADLLIIMGTSLKIEPFASLVNSVRSTVPRLLLNRNAVGPFERVPLRRGDHME-LGDLADSVRKFAEMLGWDGEIQELMRSQEVNRGASDQESCEETSRTEGSGAPSSSEE 402          
BLAST of SMED30017149 vs. Ensembl Medaka
Match: sirt2 (sirtuin 2 [Source:NCBI gene;Acc:101155450])

HSP 1 Score: 179.104 bits (453), Expect = 1.118e-49
Identity = 95/238 (39.92%), Postives = 144/238 (60.50%), Query Frame = -2
Query:  971 KNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGI--KNIIHCHGSFASATCMR--CEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKE 1669
            KNI+ + GAGIS   G+PDFRS   G+YA L     +L  P+++F I YF K+P+PFF  AKE+YPG+F P+  H FIK+L++KG L R Y+QNIDTLE++AG+  +++I  HG+F ++ C+   C  +   ++++  + +  IP C  C +                        ++KPD+VFFGE LP  F   +  D  + DLLIV+G+SL+V+P A + G +  + P++LIN E
Sbjct:   76 KNIICMVGAGISTSAGIPDFRSPETGLYANLQKY--NLPYPEAIFQIDYFKKHPEPFFTLAKELYPGQFKPTICHYFIKLLKNKGLLRRCYTQNIDTLERVAGLEKEDLIEAHGTFYTSHCVSFCCRKEYSLDWMKEKIFSDAIPKCEKCNS------------------------LVKPDIVFFGENLPARFFTSVKMDFPRCDLLIVMGTSLQVQPFAGLVGRVSKSCPRLLINME 287          
BLAST of SMED30017149 vs. Planmine SMEST
Match: SMESG000079103.1 (SMESG000079103.1)

HSP 1 Score: 1009.59 bits (2609), Expect = 0.000e+0
Identity = 532/535 (99.44%), Postives = 533/535 (99.63%), Query Frame = -2
Query:  383 MSSETNNPEMEVGSNELDILSMLIGDDEEKWRNTRGQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWDDLSASTLSNDFVEKSIFDMKSEIESLYRDESERKSISDEATXXXXXXXXXXXXXEILKLLNVGDLLRNGVTCICVPPNKYVFKGAEFLINAEDIDNPDSLFAPVTDQYXXXXXXXXXXXXXXXXXXXXXEIQLQTQESISKQPSVESSPGCNQSKRQRLSNSKDSEL 1987
            MSSETNNPEMEVGSNELDILSMLIGDDEEKWRNTRGQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWDDLSASTLSNDFVEKSIFDMKSEIESLYRDESERKSISDEATEDKEKSK KEDEKEILKLLNVGDLLRNGVTCICVPPNKYVFKGAEFLINAEDIDNPDSLFAPVT+QYDSSAYSSSSEDSET DDNSDDEIQLQTQESISKQPSVESSPGCNQSKRQRLSNSKDSEL
Sbjct:    1 MSSETNNPEMEVGSNELDILSMLIGDDEEKWRNTRGQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWDDLSASTLSNDFVEKSIFDMKSEIESLYRDESERKSISDEATEDKEKSKYKEDEKEILKLLNVGDLLRNGVTCICVPPNKYVFKGAEFLINAEDIDNPDSLFAPVTNQYDSSAYSSSSEDSETDDDNSDDEIQLQTQESISKQPSVESSPGCNQSKRQRLSNSKDSEL 535          
BLAST of SMED30017149 vs. Planmine SMEST
Match: SMESG000079103.1 (SMESG000079103.1)

HSP 1 Score: 990.719 bits (2560), Expect = 0.000e+0
Identity = 523/526 (99.43%), Postives = 524/526 (99.62%), Query Frame = -2
Query:  383 MEVGSNELDILSMLIGDDEEKWRNTRGQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWDDLSASTLSNDFVEKSIFDMKSEIESLYRDESERKSISDEATXXXXXXXXXXXXXEILKLLNVGDLLRNGVTCICVPPNKYVFKGAEFLINAEDIDNPDSLFAPVTDQYXXXXXXXXXXXXXXXXXXXXXEIQLQTQESISKQPSVESSPGCNQSKRQRLSNSKDSEL 1960
            MEVGSNELDILSMLIGDDEEKWRNTRGQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWDDLSASTLSNDFVEKSIFDMKSEIESLYRDESERKSISDEATEDKEKSK KEDEKEILKLLNVGDLLRNGVTCICVPPNKYVFKGAEFLINAEDIDNPDSLFAPVT+QYDSSAYSSSSEDSET DDNSDDEIQLQTQESISKQPSVESSPGCNQSKRQRLSNSKDSEL
Sbjct:    1 MEVGSNELDILSMLIGDDEEKWRNTRGQLELVNQCIQKGETPKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIELLGDCDNIVTEICKQLQWDDLSASTLSNDFVEKSIFDMKSEIESLYRDESERKSISDEATEDKEKSKYKEDEKEILKLLNVGDLLRNGVTCICVPPNKYVFKGAEFLINAEDIDNPDSLFAPVTNQYDSSAYSSSSEDSETDDDNSDDEIQLQTQESISKQPSVESSPGCNQSKRQRLSNSKDSEL 526          
BLAST of SMED30017149 vs. Planmine SMEST
Match: SMESG000079803.1 (SMESG000079803.1)

HSP 1 Score: 176.407 bits (446), Expect = 7.826e-48
Identity = 102/271 (37.64%), Postives = 150/271 (55.35%), Query Frame = -2
Query:  884 KNIMVLTGAGISVPCGVPDFRS-RNGIYARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYP-GKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIK--NIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETL-----VSHGFDIELLGDCDNIVTEICKQLQWD 1669
            KNI+++ GAGIS P G+PDFRS   G+Y  L      +  P+++FDI YF +NPKPFF  AKE++P GK+ P+  H F ++L++K  L R Y+QNID LE++AG+   N++  HG+FASA+C+RC        ++  +   +I  C  C                          I+KPD+VFFGE LP  FH     D  Q DLL+V+G+SL+V P A I        P++LIN++ +          D  +LGD  + +  + K L+W+
Sbjct:  156 KNIVIMAGAGISCPSGIPDFRSPGTGLYDNLKQY--KIPYPEAIFDIDYFLQNPKPFFALAKELFPSGKYRPNKVHYFFRLLQEKKLLRRVYTQNIDGLERLAGLNDTNLVEAHGTFASASCVRCGEDYSATQLKESIDKSEICYCSKCRG------------------------IVKPDIVFFGEDLPSKFHL-FRSDFQQADLLLVMGTSLEVEPFASIVDSTRFGTPRVLINRQPVGVFRSKRRVHDNCVLGDIIDGIDVLSKNLRWE 399          
BLAST of SMED30017149 vs. Planmine SMEST
Match: SMESG000062887.1 (SMESG000062887.1)

HSP 1 Score: 126.331 bits (316), Expect = 5.681e-32
Identity = 91/278 (32.73%), Postives = 142/278 (51.08%), Query Frame = -2
Query:  887 DLIRVSKN-IMVLTGAGISVPCGVPDFRSRNGIY--ARLAVDFPDLDEPQSMFDIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNIDTLEQIAGIKNIIH--CHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKET------LVSHGFDIELLGDCDNIVTEICKQLQW 1687
            ++IR +++ I+  TGAGIS   G+PDFRS NG+Y   +  ++ P+   P+ +FDI YF  +P  F   AK+     + P+  H F+K+L +K  LLRN++QNID L+   GI + I+  CHG F +  C+ CE     E ++S + +     C                      + +    ++KPD+V FGE LPK     L++   + DL+IV+GSSL+V P            P ++IN E       L S  + ++L   CD+ + +IC  L W
Sbjct:   35 EIIRSNESKIVTFTGAGISTSAGIPDFRSENGLYNIVKSKLNMPN---PELIFDISYFEIDPTMFCCIAKQFIQNDYYPTLTHCFLKLLHNKKLLLRNFTQNIDGLDSKVGIPDDINIECHGHFKTGHCLSCEKLYSYEEMKSQLESNDFIKC----------------------QAENCNGLVKPDIVLFGESLPKKVFENLNK-ISKADLIIVMGSSLRVTPFNQFINLARKETPLLVINNEQPSGGILLSSKKYFLQL--PCDDGIKKICDLLHW 284          
BLAST of SMED30017149 vs. Planmine SMEST
Match: SMESG000027361.1 (SMESG000027361.1)

HSP 1 Score: 92.8189 bits (229), Expect = 9.713e-21
Identity = 78/243 (32.10%), Postives = 114/243 (46.91%), Query Frame = -2
Query: 1016 FKQACDLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMFDIHYFSKNPK---PFFKFAKEIYPGKFTPSFGHRFIKVLEDK----GKLLRNYSQNIDTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPSCTTEDERNQENLLSSIGNSDEVDTNIP-------IMKPDVVFFGEGLPKDFHAKLSEDKDQVDLLIVIGSSLKVRPVAHIP 1702
            FKQ    ++++KNI+V+TGAGIS   G+P FR    +  R         E  ++  +  F +NP     F+ F +EI   K  P+  H  +   E K     K     +QN+D L + AG +NII  HG      CM+C+  VK  FI         PIC     + + N      S  NS   + ++P       +++P+VV+FGE L  D   K  +     DL +VIG+S  V+PVA  P
Sbjct:    6 FKQT---LKLAKNILVITGAGISADSGIPTFRGSRALRWRNY-------ESCNLATLPAFLENPSLVWEFYHFRREICL-KANPNAAHAALSKFEMKCKKENKQFTLITQNVDGLHRRAGSENIISIHGEIFETKCMKCK-NVKENFIS--------PICEGLRDKGDPN------STENSSIPEESLPTCEFCRGLLRPNVVWFGENLHPDTLEKSYDAIKNCDLCVVIGTSGIVQPVASFP 222          
The following BLAST results are available for this feature:
BLAST of SMED30017149 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SIRT13.434e-11653.64sirtuin 1 [Source:HGNC Symbol;Acc:HGNC:14929][more]
SIRT16.064e-8057.14sirtuin 1 [Source:HGNC Symbol;Acc:HGNC:14929][more]
SIRT18.892e-6755.05sirtuin 1 [Source:HGNC Symbol;Acc:HGNC:14929][more]
SIRT18.892e-6755.05sirtuin 1 [Source:HGNC Symbol;Acc:HGNC:14929][more]
SIRT31.699e-5638.32sirtuin 3 [Source:HGNC Symbol;Acc:HGNC:14931][more]
back to top
BLAST of SMED30017149 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sir-2.12.258e-9942.19NAD-dependent protein deacetylase sir-2.1 [Source... [more]
sir-2.12.258e-9942.19NAD-dependent protein deacetylase sir-2.1 [Source... [more]
sir-2.12.258e-9942.19NAD-dependent protein deacetylase sir-2.1 [Source... [more]
sir-2.12.537e-9942.19NAD-dependent protein deacetylase sir-2.1 [Source... [more]
sir-2.12.537e-9942.19NAD-dependent protein deacetylase sir-2.1 [Source... [more]
back to top
BLAST of SMED30017149 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sirt11.852e-11550.15gene:FBgn0024291 transcript:FBtr0080434[more]
Sirt21.021e-5335.79gene:FBgn0038788 transcript:FBtr0083882[more]
Sirt21.021e-5335.79gene:FBgn0038788 transcript:FBtr0344243[more]
Sirt49.947e-1428.92gene:FBgn0029783 transcript:FBtr0070852[more]
Sirt61.993e-623.04gene:FBgn0037802 transcript:FBtr0305358[more]
back to top
BLAST of SMED30017149 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sirt16.131e-11854.35sirtuin 1 [Source:ZFIN;Acc:ZDB-GENE-070801-2][more]
sirt31.245e-5740.66sirtuin 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1762][more]
sirt31.534e-5740.66sirtuin 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1762][more]
sirt38.746e-5740.38sirtuin 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1762][more]
si:dkey-103i16.66.454e-5236.97si:dkey-103i16.6 [Source:ZFIN;Acc:ZDB-GENE-061207-... [more]
back to top
BLAST of SMED30017149 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspear1.332e-11851.84thrombospondin-type laminin G domain and EAR repea... [more]
tspear3.197e-11853.94thrombospondin-type laminin G domain and EAR repea... [more]
tspear7.169e-11853.94thrombospondin-type laminin G domain and EAR repea... [more]
tspear5.407e-11753.94thrombospondin-type laminin G domain and EAR repea... [more]
SIRT24.127e-5136.33sirtuin 2 [Source:NCBI gene;Acc:100489469][more]
back to top
BLAST of SMED30017149 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sirt11.334e-11753.47sirtuin 1 [Source:MGI Symbol;Acc:MGI:2135607][more]
Sirt13.134e-11653.33sirtuin 1 [Source:MGI Symbol;Acc:MGI:2135607][more]
Sirt13.134e-11653.33sirtuin 1 [Source:MGI Symbol;Acc:MGI:2135607][more]
Sirt16.913e-10152.51sirtuin 1 [Source:MGI Symbol;Acc:MGI:2135607][more]
Sirt21.573e-5234.17sirtuin 2 [Source:MGI Symbol;Acc:MGI:1927664][more]
back to top
BLAST of SMED30017149 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0A0G2JZ79|SIR1_RAT9.925e-11754.72NAD-dependent protein deacetylase sirtuin-1 OS=Rat... [more]
sp|Q96EB6|SIR1_HUMAN1.649e-11553.64NAD-dependent protein deacetylase sirtuin-1 OS=Hom... [more]
sp|Q923E4|SIR1_MOUSE2.192e-11553.33NAD-dependent protein deacetylase sirtuin-1 OS=Mus... [more]
sp|Q9VK34|SIRT1_DROME1.857e-11450.15NAD-dependent histone deacetylase sirtuin-1 OS=Dro... [more]
sp|Q21921|SIR2_CAEEL3.227e-9842.19NAD-dependent protein deacetylase sir-2.1 OS=Caeno... [more]
back to top
BLAST of SMED30017149 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JLZ23.482e-12853.00NAD-dependent protein deacetylase sirtuin-1 isofor... [more]
A0A1S3JLZ96.578e-12852.73NAD-dependent protein deacetylase sirtuin-1 isofor... [more]
A0A444TSS91.995e-12548.10NAD-dependent histone deacetylase Sir2 OS=Armadill... [more]
A0A162Q0V97.119e-12545.93Putative Histone deacetylase silent information re... [more]
A0A3R7MC113.538e-12351.21Putative histone deacetylase silent information re... [more]
back to top
BLAST of SMED30017149 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000003809.22.448e-11353.15pep primary_assembly:Astyanax_mexicanus-2.0:25:451... [more]
sirt34.404e-5838.51sirtuin 3 [Source:NCBI gene;Acc:103044645][more]
sirt21.467e-5039.50sirtuin 2 [Source:NCBI gene;Acc:103038996][more]
si:dkey-103i16.65.026e-4835.19si:dkey-103i16.6 [Source:ZFIN;Acc:ZDB-GENE-061207-... [more]
si:dkey-103i16.66.924e-4735.19si:dkey-103i16.6 [Source:ZFIN;Acc:ZDB-GENE-061207-... [more]
back to top
BLAST of SMED30017149 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sirt26.420e-5636.71sirtuin 2 (silent mating type information regulati... [more]
sirt32.845e-4836.24sirtuin 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1762][more]
sirt47.995e-1325.11sirtuin 4 [Source:ZFIN;Acc:ZDB-GENE-041010-65][more]
back to top
BLAST of SMED30017149 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HST14.652e-7140.82NAD(+)-dependent histone deacetylase; essential su... [more]
SIR29.364e-6639.46Conserved NAD+ dependent histone deacetylase of th... [more]
HST24.148e-4232.40Cytoplasmic NAD(+)-dependent protein deacetylase; ... [more]
HST32.633e-2830.43Member of the Sir2 family of NAD(+)-dependent prot... [more]
HST45.574e-1828.19NAD(+)-dependent protein deacetylase; deacetylatio... [more]
back to top
BLAST of SMED30017149 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO316842.818e-11653.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484599.988e-5337.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476722.763e-5238.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468137.191e-5035.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473624.577e-1528.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30017149 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000017143.23.031e-11553.45sirtuin 1 [Source:NCBI gene;Acc:101175344][more]
sirt35.180e-5438.24sirtuin 3 [Source:NCBI gene;Acc:101161471][more]
sirt32.897e-5236.05sirtuin 3 [Source:NCBI gene;Acc:101161471][more]
si:dkey-103i16.61.457e-5035.14NAD-dependent protein deacetylase sirtuin-3, mitoc... [more]
sirt21.118e-4939.92sirtuin 2 [Source:NCBI gene;Acc:101155450][more]
back to top
BLAST of SMED30017149 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079103.10.000e+099.44SMESG000079103.1[more]
SMESG000079103.10.000e+099.43SMESG000079103.1[more]
SMESG000079803.17.826e-4837.64SMESG000079803.1[more]
SMESG000062887.15.681e-3232.73SMESG000062887.1[more]
SMESG000027361.19.713e-2132.10SMESG000027361.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017149 ID=SMED30017149|Name=SMED30017149|organism=Schmidtea mediterranea sexual|type=transcript|length=2087bp
TCCCTGCAAAAAAAATGCAATTATATCAAAATTGTCTATATAATATTTTG
AGACTTGCTATACAATTCGTTAAATAACCCATGAACAAATAAAATGCACA
TACTACTATAGACCTTACAATAAAATAGTTATCTTTTCATTTGATGACAT
ATGAGAAAAGCAAGTCAGAAAAAGTAAAATGGCAAATATGTTGTGTACAG
TAAAATAATTATTATCGACAAGCATAATTCTACATCAATCGATATAAATA
ATAAAACCTATCATCTGAATTAAATATATATATTTAGATAGGTGCAGTTC
TGGACAAAGATATTTAAGGCAAATGGAACATCATCTATTACAAACATATA
TTCTCTATACACTTAGACTTATTCCATTCTCATAACTCAGAATCTTTCGA
ATTAGACAAACGCTGCCTCTTTGATTGATTACATCCAGGAGATGATTCAA
CAGAAGGCTGTTTGCTAATAGACTCCTGAGTTTGGAGTTGAATTTCATCG
TCACTATTGTCATCACCGGTTTCTGAATCTTCGCTTGAAGATGAATAAGC
CGACGAATCGTATTGATCAGTAACTGGAGCAAAAAGACTATCGGGATTGT
CTATATCCTCTGCATTTATTAGAAATTCAGCTCCTTTAAATACATATTTA
TTCGGTGGAACACAAATGCAGGTGACGCCATTTCTAAGTAGATCTCCAAC
ATTGAGCAATTTTAATATTTCTTTTTCGTCTTCCTTGTCCTTCGATTTTT
CTTTATCCTCAGTCGCTTCATCAGATATAGATTTTCTCTCAGACTCATCT
CTATACAGAGATTCAATTTCAGATTTCATATCAAATATGGATTTTTCCAC
AAAATCGTTAGACAAAGTGCTCGCCGAGAGGTCATCCCATTGCAATTGTT
TGCATATTTCCGTAACAATGTTGTCACAATCACCCAATAATTCAATGTCA
AATCCGTGACTGACCAAAGTTTCTTTATTGATGAGAATTTGAGGAATATT
TGGTGGTAAACATCCAGGTATATGAGCCACTGGTCTCACTTTTAATGATG
ATCCAATTACTATTAACAAATCAACTTGATCTTTATCTTCAGATAATTTT
GCATGAAAATCTTTAGGGAGACCTTCACCAAAAAACACAACATCAGGTTT
CATAATCGGTATATTAGTATCGACTTCGTCTGAATTTCCAATAGACGAAA
GTAAATTTTCCTGATTTCTTTCATCTTCAGTAGTACATGATGGACAAATA
GGAATTTGCTGATTCATTACATCACTTTCAATAAATTCACCTTTAACTTT
ATATTCGCATCTCATGCAAGTAGCTGATGCAAATGATCCATGACAATGAA
TAATATTTTTTATGCCAGCAATTTGTTCCAAAGTGTCAATATTTTGACTG
TAATTTCTCAACAATTTACCTTTGTCTTCCAACACCTTGATAAATCGATG
CCCAAAAGATGGAGTAAATTTACCAGGATAAATTTCTTTAGCAAATTTGA
AAAATGGTTTCGGGTTTTTAGAAAAATAATGAATGTCAAACATAGATTGG
GGCTCATCTAAATCTGGGAAATCAACAGCCAGTCTTGCATAAATTCCATT
TCGGCTACGAAAATCCGGTACACCACATGGTACTGATATACCAGCTCCAG
TTAAAACCATAATATTTTTGCTAACTCGAATAAGATCACAGGCTTGCTTA
AACGTGTTAATATATTCAATCCGTTTTCTTTGAGATCCTTCCATTATTAT
ATGTAAAATAATCGACCAGTGCTCAAGAGCATCGTCAGATAAATGATTGA
CATTAACTTTGAAATGATTTTTTAGAATTTCTTTGGGAGTTTCGCCTTTC
TGAATGCACTGATTCACTAGTTCCAACTGACCTCGAGTATTTCGCCACTT
TTCTTCATCATCTCCAATAAGCATTGACAATATATCCAATTCATTGGATC
CAACTTCCATTTCTGGATTATTAGTTTCACTACTCATTAAAAAATATGAT
AGATTACTTATGAATTTAAATATTAAATTTGATATATAGTTAAACAAATT
AATTTAAATTATAATATTTTATTACTTCTACATTTTA
back to top

protein sequence of SMED30017149-orf-1

>SMED30017149-orf-1 ID=SMED30017149-orf-1|Name=SMED30017149-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=536bp
MSSETNNPEMEVGSNELDILSMLIGDDEEKWRNTRGQLELVNQCIQKGET
PKEILKNHFKVNVNHLSDDALEHWSIILHIIMEGSQRKRIEYINTFKQAC
DLIRVSKNIMVLTGAGISVPCGVPDFRSRNGIYARLAVDFPDLDEPQSMF
DIHYFSKNPKPFFKFAKEIYPGKFTPSFGHRFIKVLEDKGKLLRNYSQNI
DTLEQIAGIKNIIHCHGSFASATCMRCEYKVKGEFIESDVMNQQIPICPS
CTTEDERNQENLLSSIGNSDEVDTNIPIMKPDVVFFGEGLPKDFHAKLSE
DKDQVDLLIVIGSSLKVRPVAHIPGCLPPNIPQILINKETLVSHGFDIEL
LGDCDNIVTEICKQLQWDDLSASTLSNDFVEKSIFDMKSEIESLYRDESE
RKSISDEATEDKEKSKDKEDEKEILKLLNVGDLLRNGVTCICVPPNKYVF
KGAEFLINAEDIDNPDSLFAPVTDQYDSSAYSSSSEDSETGDDNSDDEIQ
LQTQESISKQPSVESSPGCNQSKRQRLSNSKDSEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR029035DHS-like_NAD/FAD-binding_dom
IPR003000Sirtuin
IPR026591Sirtuin_cat_small_dom_sf
IPR026590Ssirtuin_cat_dom
Vocabulary: molecular function
TermDefinition
GO:0070403NAD+ binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.1220coord: 85..369
e-value: 2.7E-109
score: 366.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 477..535
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 396..416
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 500..526
NoneNo IPR availablePANTHERPTHR11085HISTONE DEACETYLASE SIR2 FAMILY MEMBERcoord: 40..456
NoneNo IPR availablePANTHERPTHR11085:SF15NAD-DEPENDENT PROTEIN DEACETYLASE SIRTUIN-1coord: 40..456
IPR026591Sirtuin, catalytic core small domain superfamilyGENE3DG3DSA:3.30.1600.10coord: 123..291
e-value: 2.7E-109
score: 366.4
IPR003000Sirtuin familyPFAMPF02146SIR2coord: 114..319
e-value: 1.1E-59
score: 201.3
IPR026590Sirtuin family, catalytic core domainPROSITEPS50305SIRTUINcoord: 97..370
score: 49.167
IPR029035DHS-like NAD/FAD-binding domain superfamilySUPERFAMILYSSF52467DHS-like NAD/FAD-binding domaincoord: 92..372