Dual specificity mitogen-activated protein kinase kinase 6

Overview
NameDual specificity mitogen-activated protein kinase kinase 6
Smed IDSMED30017135
Length (bp)1539
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dual specificity mitogen-activated protein kinase kinase 6 (SMED30017135) t-SNE clustered cells

Violin plots show distribution of expression levels for Dual specificity mitogen-activated protein kinase kinase 6 (SMED30017135) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dual specificity mitogen-activated protein kinase kinase 6 (SMED30017135) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dual specificity mitogen-activated protein kinase kinase 6 (SMED30017135) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017135

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017135SMESG000040748.1 Contig1542GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30017135SMESG000017824.1 SmedASXL_005855SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30017135SMESG000017824.1 SmedASXL_005855SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymal cellSMED30017135SMESG000040748.1 dd_Smed_v4_2106_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30017135SMESG000040748.1 dd_Smed_v4_2106_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017135SMESG000017824.1 dd_Smed_v4_1568_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017135SMESG000017824.1 dd_Smed_v6_1568_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017135SMESG000040748.1 dd_Smed_v4_2106_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30017135SMESG000017824.1 dd_Smed_v4_1568_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017135SMESG000017824.1 SMED_01956_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30017135SMESG000017824.1 SMED_01956_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Human
Match: MAP2K6 (mitogen-activated protein kinase kinase 6 [Source:HGNC Symbol;Acc:HGNC:6846])

HSP 1 Score: 280.796 bits (717), Expect = 3.649e-90
Identity = 148/343 (43.15%), Postives = 215/343 (62.68%), Query Frame = 1
Query:   37 ASSKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQN 1062
            +  KK+ P  K   +     E    +  P + L     + +  +   +   DLE + ELG+G +G+VE+M H PS  + AVK++R + + ++Q R+L DL+ISMR+  CP+ V  YGA+ R GDVWICME++D+SLDKFYK V  I     IPE +L  I   IV ALE+LH  L VIHRDVKPSNVLI+  G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G++++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP +  +S    +F S+CL    K+R +Y EL++H     F+T    E+   + A++V  IL +
Sbjct:    4 SKGKKRNPGLK---IPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQV--IDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD-KFSAEFVDFTSQCLKKNSKERPTYPELMQH----PFFT--LHESKGTDVASFVKLILGD 334          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Human
Match: MAP2K6 (mitogen-activated protein kinase kinase 6 [Source:HGNC Symbol;Acc:HGNC:6846])

HSP 1 Score: 270.011 bits (689), Expect = 9.900e-87
Identity = 138/286 (48.25%), Postives = 195/286 (68.18%), Query Frame = 1
Query:  208 ELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQN 1062
            ELG+G +G+VE+M H PS  + AVK++R + + ++Q R+L DL+ISMR+  CP+ V  YGA+ R GDVWICME++D+SLDKFYK V  I     IPE +L  I   IV ALE+LH  L VIHRDVKPSNVLI+  G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G++++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP +  +S    +F S+CL    K+R +Y EL++H     F+T    E+   + A++V  IL +
Sbjct:    2 ELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQV--IDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD-KFSAEFVDFTSQCLKKNSKERPTYPELMQH----PFFT--LHESKGTDVASFVKLILGD 278          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Human
Match: MAP2K6 (mitogen-activated protein kinase kinase 6 [Source:HGNC Symbol;Acc:HGNC:6846])

HSP 1 Score: 270.011 bits (689), Expect = 9.900e-87
Identity = 138/286 (48.25%), Postives = 195/286 (68.18%), Query Frame = 1
Query:  208 ELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQN 1062
            ELG+G +G+VE+M H PS  + AVK++R + + ++Q R+L DL+ISMR+  CP+ V  YGA+ R GDVWICME++D+SLDKFYK V  I     IPE +L  I   IV ALE+LH  L VIHRDVKPSNVLI+  G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G++++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP +  +S    +F S+CL    K+R +Y EL++H     F+T    E+   + A++V  IL +
Sbjct:    2 ELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQV--IDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD-KFSAEFVDFTSQCLKKNSKERPTYPELMQH----PFFT--LHESKGTDVASFVKLILGD 278          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Human
Match: MAP2K4 (mitogen-activated protein kinase kinase 4 [Source:HGNC Symbol;Acc:HGNC:6844])

HSP 1 Score: 273.092 bits (697), Expect = 2.585e-86
Identity = 144/343 (41.98%), Postives = 217/343 (63.27%), Query Frame = 1
Query:   58 PNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGE-KIT------ISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSL--PENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
            P FK+    +    P  + +  +++L  H+ ++ +G+ KI+       +  DL+ L E+G+G +G V +M+HKPS  + AVK++R + D+K+Q ++L DL++ MRS+ CPY+V  YGA+ R GD WICME++ +S DKFYK V ++  +  IPE +L  IT   V AL +L + L++IHRD+KPSN+L+D+SG +K+CDFGISG LV+S+A+T + G + Y+APERI    S  G+ +RSDVWSLG+++ ELA  +FPYP   S+++ +T V +G PP L   E   +S +  NF++ CL      R  Y ELLKH  +  +      E    E A YV  IL
Sbjct:   51 PPFKSTARFTLNPNPTGVQNPHIERLRTHS-IESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSV-LDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMY------EERAVEVACYVCKIL 385          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Human
Match: MAP2K4 (mitogen-activated protein kinase kinase 4 [Source:HGNC Symbol;Acc:HGNC:6844])

HSP 1 Score: 273.092 bits (697), Expect = 3.659e-86
Identity = 141/329 (42.86%), Postives = 212/329 (64.44%), Query Frame = 1
Query:  100 PVLINDNPVQQLTDHTEVQVNGE-KIT------ISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSL--PENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
            P  + +  +++L  H+ ++ +G+ KI+       +  DL+ L E+G+G +G V +M+HKPS  + AVK++R + D+K+Q ++L DL++ MRS+ CPY+V  YGA+ R GD WICME++ +S DKFYK V ++  +  IPE +L  IT   V AL +L + L++IHRD+KPSN+L+D+SG +K+CDFGISG LV+S+A+T + G + Y+APERI    S  G+ +RSDVWSLG+++ ELA  +FPYP   S+++ +T V +G PP L   E   +S +  NF++ CL      R  Y ELLKH  +  +      E    E A YV  IL
Sbjct:   76 PTGVQNPHIERLRTHS-IESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSV-LDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMY------EERAVEVACYVCKIL 396          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Celegans
Match: sek-1 (Dual specificity mitogen-activated protein kinase kinase sek-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EDF7])

HSP 1 Score: 255.373 bits (651), Expect = 8.488e-81
Identity = 131/321 (40.81%), Postives = 196/321 (61.06%), Query Frame = 1
Query:  115 DNPVQQLTDHTEVQV--NGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNE----FANYVTFIL 1056
            + P   L D   +++    E+I I+ +DL  L ELGKG +GIVE+M H+ S ++ AVK+++ S +D+ Q ++LN+L+   RS  CP +V  YGAM R GDVWICME++D+SLDKFY+    IG    IPE  +  +   ++  L ++ + L +IHRDVKPSN+L+++ G+VK+CDFGISG L NS+A+T   G + Y+ PERI  E + S + +R+DVWSLG++I+E+A+   PY    + +  +  V + PPP LP  S +S   + F+ RCL     +R  Y ELL            F+E  +NE     A ++  IL
Sbjct:   22 ETPTMNLEDRCLIKLTNESEEIEIAATDLVVLEELGKGGYGIVEKMQHRQSGIIMAVKRIKSSINDQSQKQMLNELDACRRSDCCPQMVRFYGAMFREGDVWICMEVMDTSLDKFYRHAYKIG--KHIPEPFIGKMALSVIEGLNFMKEQLNLIHRDVKPSNILLNRHGQVKICDFGISGHLTNSMAKTVQAGCKPYMPPERIDGE-TKSAYDVRADVWSLGITIIEIAVGTHPYANWKTPFEQLKQVVKEPPPKLPMESGFSVDCQYFVKRCLEKDYNERPKYPELL---------AMPFMEQARNEKQFSMARFINEIL 330          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Celegans
Match: sek-1 (Dual specificity mitogen-activated protein kinase kinase sek-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EDF7])

HSP 1 Score: 255.373 bits (651), Expect = 8.488e-81
Identity = 131/321 (40.81%), Postives = 196/321 (61.06%), Query Frame = 1
Query:  115 DNPVQQLTDHTEVQV--NGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNE----FANYVTFIL 1056
            + P   L D   +++    E+I I+ +DL  L ELGKG +GIVE+M H+ S ++ AVK+++ S +D+ Q ++LN+L+   RS  CP +V  YGAM R GDVWICME++D+SLDKFY+    IG    IPE  +  +   ++  L ++ + L +IHRDVKPSN+L+++ G+VK+CDFGISG L NS+A+T   G + Y+ PERI  E + S + +R+DVWSLG++I+E+A+   PY    + +  +  V + PPP LP  S +S   + F+ RCL     +R  Y ELL            F+E  +NE     A ++  IL
Sbjct:   22 ETPTMNLEDRCLIKLTNESEEIEIAATDLVVLEELGKGGYGIVEKMQHRQSGIIMAVKRIKSSINDQSQKQMLNELDACRRSDCCPQMVRFYGAMFREGDVWICMEVMDTSLDKFYRHAYKIG--KHIPEPFIGKMALSVIEGLNFMKEQLNLIHRDVKPSNILLNRHGQVKICDFGISGHLTNSMAKTVQAGCKPYMPPERIDGE-TKSAYDVRADVWSLGITIIEIAVGTHPYANWKTPFEQLKQVVKEPPPKLPMESGFSVDCQYFVKRCLEKDYNERPKYPELL---------AMPFMEQARNEKQFSMARFINEIL 330          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Celegans
Match: mkk-4 (MAP kinase kinase mkk-4 [Source:UniProtKB/Swiss-Prot;Acc:Q20347])

HSP 1 Score: 214.927 bits (546), Expect = 7.226e-65
Identity = 120/278 (43.17%), Postives = 171/278 (61.51%), Query Frame = 1
Query:  175 TISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSK-DDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSS---YSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSF 993
            T S ++L+ L  +G G FG V +M HK +  + AVK++RC+    ++Q R+L + +  ++S + P +V  YGA+   GD WICME++D S+D  YK V  +   S + E ++ +IT C V AL+YL + L++IHRDVKPSN+L+D +G VK+CDFGI G L  S A+T + G Q YLAPERI    S+  + +RSDVWSLG+++ E+A  KFPY    SL++ I  V  G PP L  +S    YS  +  FI+ CL    + R  Y      D LKSF
Sbjct:   60 TFSSANLQDLGAIGNGNFGTVYKMRHKETGKLIAVKRIRCNNIGHREQIRLLREHDTIVKSEKGPNIVKFYGAIFSEGDCWICMELMDISMDLLYKRVYMV-KNSRLNENVVGHITVCTVDALDYLKKELKIIHRDVKPSNILVDGTGAVKLCDFGICGQLEESFAKTHDAGCQPYLAPERI---TSSDKYDVRSDVWSLGITLYEIATGKFPYQEWNSLFDQIATVVSGDPPILHPDSDDFHYSLPLVKFINTCLTKDRRHRPKY------DTLKSF 327          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Celegans
Match: sek-3 (SAPK/ERK kinase [Source:UniProtKB/TrEMBL;Acc:Q8MPS3])

HSP 1 Score: 192.971 bits (489), Expect = 2.085e-56
Identity = 105/276 (38.04%), Postives = 164/276 (59.42%), Query Frame = 1
Query:  193 LETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRC---SKDD---KKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYP--LDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSF 993
            L+ L  LG G FG+V +MLH+PSN+  AVKQ+       DD   K   R   ++  +  ++ C  +V  YG     G  W+CME++D SLDK Y +   I  +  IPE +L  +    + ALE+L     +IHRD+KPSN+L+D+ G VK+CDFGI G L NSVAQ+ ++G + Y+APER+    +  G+ I+S+VWSLG++++E+A  K+PY   +D  + + +  V  G PP L  +   S +++ FI+ C +     RAS+ +L K ++ + +
Sbjct:   71 LQELELLGNGSFGVVRKMLHRPSNVEMAVKQISLINNGPDDAFNKSMQRFRLEVEATKAASNCDEIVRYYGITFNEGVAWMCMELMDLSLDKLYMIAHDI-QKVEIPEQILGAVAVATIRALEHLKTTHHIIHRDIKPSNILLDRHGCVKLCDFGICGYLQNSVAQSVDVGCRPYMAPERLAP--NGDGYDIKSEVWSLGITMVEVANGKYPYDGFMDAPILDQVRMVVYGDPPILDSDHEVSMSMKRFIALCTIKDRNLRASFDDLKKTNIYRDY 343          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Celegans
Match: sek-3 (SAPK/ERK kinase [Source:UniProtKB/TrEMBL;Acc:Q8MPS3])

HSP 1 Score: 192.971 bits (489), Expect = 2.085e-56
Identity = 105/276 (38.04%), Postives = 164/276 (59.42%), Query Frame = 1
Query:  193 LETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRC---SKDD---KKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYP--LDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSF 993
            L+ L  LG G FG+V +MLH+PSN+  AVKQ+       DD   K   R   ++  +  ++ C  +V  YG     G  W+CME++D SLDK Y +   I  +  IPE +L  +    + ALE+L     +IHRD+KPSN+L+D+ G VK+CDFGI G L NSVAQ+ ++G + Y+APER+    +  G+ I+S+VWSLG++++E+A  K+PY   +D  + + +  V  G PP L  +   S +++ FI+ C +     RAS+ +L K ++ + +
Sbjct:   71 LQELELLGNGSFGVVRKMLHRPSNVEMAVKQISLINNGPDDAFNKSMQRFRLEVEATKAASNCDEIVRYYGITFNEGVAWMCMELMDLSLDKLYMIAHDI-QKVEIPEQILGAVAVATIRALEHLKTTHHIIHRDIKPSNILLDRHGCVKLCDFGICGYLQNSVAQSVDVGCRPYMAPERLAP--NGDGYDIKSEVWSLGITMVEVANGKYPYDGFMDAPILDQVRMVVYGDPPILDSDHEVSMSMKRFIALCTIKDRNLRASFDDLKKTNIYRDY 343          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Fly
Match: lic (gene:FBgn0261524 transcript:FBtr0073720)

HSP 1 Score: 257.684 bits (657), Expect = 1.673e-81
Identity = 133/313 (42.49%), Postives = 199/313 (63.58%), Query Frame = 1
Query:  121 PVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
            P + L     +Q+      I    LE + +LG+G +GIV++M HK ++ V AVK++  + + ++Q R++ DL+ISMRS+ CPY V  YGAM+R GDVWICME++ +SLDKFY  V     +  + E +L  I   +V+AL YLH  L+VIHRDVKPSN+LI+++G+VK+CDFGISG LV+S+A+T + G + Y+APERI  + + + + IRSDVWSLG+ ++E+A  ++PY    + +  +  V E  PP LPE  ++S    +FI+ CL      R +Y +LLKH    SF  +    N   + + +V  IL
Sbjct:   22 PPRNLDSRATIQIGDRTFDIDADSLEKICDLGRGAYGIVDKMRHKQTDTVLAVKRIPMTVNIREQHRLVMDLDISMRSSDCPYTVHFYGAMYREGDVWICMEVMSTSLDKFYPKV--FLHDLRMEESVLGKIAMSVVSALHYLHAQLKVIHRDVKPSNILINRAGQVKICDFGISGYLVDSIAKTIDAGCKPYMAPERIDPQGNPAQYDIRSDVWSLGIGMIEMATGRYPYDNWRTPFEQLRQVVEDSPPRLPEG-TFSPEFEDFIAVCLQKEYMARPNYEQLLKH----SFIVEHLQRN--TDISEFVARIL 325          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Fly
Match: Mkk4 (gene:FBgn0024326 transcript:FBtr0334320)

HSP 1 Score: 242.662 bits (618), Expect = 1.110e-74
Identity = 126/300 (42.00%), Postives = 187/300 (62.33%), Query Frame = 1
Query:  175 TISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSL---PENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQN 1062
            T +  DLE   E+G+G FG V +M  K  + V AVK++R + D+K+Q ++L DL + M+S +C Y+V  YGA+ + GD WICME++D+SLDKFYK +     +  IPE +LA IT   V AL YL + L++IHRDVKPSN+L+ + G +K+CDFGISG LV+S+A+T + G + Y+APERI  E +  G+ +RSDVWSLG++++E+A   FPY    S++  +  V +G PP L        +S    +F++ CL+    DR  Y  LL+   ++        E    + A YV  IL++
Sbjct:  116 TFTSDDLEDEGEIGRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIVQFYGALFKEGDCWICMELMDTSLDKFYKYIYE-KQQRHIPESILAKITVATVNALNYLKEELKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYMAPERIDPERA-KGYDVRSDVWSLGITLMEVATGNFPYRKWDSVFEQLCQVVQGEPPRLLTSYNGMEFSKEFVDFVNTCLIKKESDRPKYSRLLEMPFIRRG------ETSHTDVAVYVADILES 407          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Fly
Match: Mkk4 (gene:FBgn0024326 transcript:FBtr0081892)

HSP 1 Score: 242.662 bits (618), Expect = 1.110e-74
Identity = 126/300 (42.00%), Postives = 187/300 (62.33%), Query Frame = 1
Query:  175 TISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSL---PENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQN 1062
            T +  DLE   E+G+G FG V +M  K  + V AVK++R + D+K+Q ++L DL + M+S +C Y+V  YGA+ + GD WICME++D+SLDKFYK +     +  IPE +LA IT   V AL YL + L++IHRDVKPSN+L+ + G +K+CDFGISG LV+S+A+T + G + Y+APERI  E +  G+ +RSDVWSLG++++E+A   FPY    S++  +  V +G PP L        +S    +F++ CL+    DR  Y  LL+   ++        E    + A YV  IL++
Sbjct:  116 TFTSDDLEDEGEIGRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIVQFYGALFKEGDCWICMELMDTSLDKFYKYIYE-KQQRHIPESILAKITVATVNALNYLKEELKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYMAPERIDPERA-KGYDVRSDVWSLGITLMEVATGNFPYRKWDSVFEQLCQVVQGEPPRLLTSYNGMEFSKEFVDFVNTCLIKKESDRPKYSRLLEMPFIRRG------ETSHTDVAVYVADILES 407          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Fly
Match: Mkk4 (gene:FBgn0024326 transcript:FBtr0300443)

HSP 1 Score: 242.662 bits (618), Expect = 1.110e-74
Identity = 126/300 (42.00%), Postives = 187/300 (62.33%), Query Frame = 1
Query:  175 TISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSL---PENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQN 1062
            T +  DLE   E+G+G FG V +M  K  + V AVK++R + D+K+Q ++L DL + M+S +C Y+V  YGA+ + GD WICME++D+SLDKFYK +     +  IPE +LA IT   V AL YL + L++IHRDVKPSN+L+ + G +K+CDFGISG LV+S+A+T + G + Y+APERI  E +  G+ +RSDVWSLG++++E+A   FPY    S++  +  V +G PP L        +S    +F++ CL+    DR  Y  LL+   ++        E    + A YV  IL++
Sbjct:  116 TFTSDDLEDEGEIGRGAFGAVNKMTFKKLDKVMAVKRIRSTVDEKEQKQLLMDLEVVMKSNECIYIVQFYGALFKEGDCWICMELMDTSLDKFYKYIYE-KQQRHIPESILAKITVATVNALNYLKEELKIIHRDVKPSNILLHRRGDIKLCDFGISGQLVDSIAKTKDAGCRPYMAPERIDPERA-KGYDVRSDVWSLGITLMEVATGNFPYRKWDSVFEQLCQVVQGEPPRLLTSYNGMEFSKEFVDFVNTCLIKKESDRPKYSRLLEMPFIRRG------ETSHTDVAVYVADILES 407          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Fly
Match: hep (gene:FBgn0010303 transcript:FBtr0330397)

HSP 1 Score: 220.32 bits (560), Expect = 2.150e-65
Identity = 119/308 (38.64%), Postives = 181/308 (58.77%), Query Frame = 1
Query:  148 EVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLP--ENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQN 1062
            ++ +NG +    ++DL+ L +LG G  G V +M+H  SN + AVKQ+R + + ++  RIL DL++ ++S  C Y+V   G   R  DVWICME++    DK  KL     ++  +PE +L  +T   V AL YL     VIHRDVKPSN+LID+ G +K+CDFGISG LV+S A T + G  +Y+APERI  +     + IR+DVWSLG++++ELA  + PY    + + ++T V +  PP LP  E  ++S   R+F+ +CL    +DR  Y ELL    ++ +      E+ + +  N+   I  N
Sbjct:  182 KLNINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTIIAVKQMRRTGNAEENKRILMDLDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKL-----SKKPVPEQILGKVTVATVNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAPERI--DPKKPKYDIRADVWSLGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPYGEGYNFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRIY------ESAKVDVPNWFQSIKDN 476          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Zebrafish
Match: map2k6 (mitogen-activated protein kinase kinase 6 [Source:NCBI gene;Acc:65239])

HSP 1 Score: 276.174 bits (705), Expect = 3.187e-88
Identity = 142/315 (45.08%), Postives = 205/315 (65.08%), Query Frame = 1
Query:  121 PVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQN 1062
            P + L     V +  +   +   DLE + ELG+G +G+V++M H PS ++ AVK++R + + ++Q R+L DL+ISMR+  C Y V  YGA+ R GDVWICME++D+SLDKFYK V   G    IPE +L  IT  IV ALE+LH  L VIHRDVKPSNVLI+  G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G+ ++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP +  +S    +F S+CL     +R +Y EL++H     F+T    ++   + A++V  IL +
Sbjct:   56 PPRDLDSKAYVTIGEKNFVVKADDLEQIGELGRGAYGVVDKMRHVPSGVIMAVKRIRATVNTQEQKRLLMDLDISMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYKQVHEKGKT--IPEDILGKITVSIVKALEHLHSNLSVIHRDVKPSNVLINMQGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPETNQKGYNVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD-RFSADFVDFTSQCLRKNSTERPTYTELMQH----PFFT--LHDSKDTDVASFVKTILGD 361          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Zebrafish
Match: map2k6 (mitogen-activated protein kinase kinase 6 [Source:NCBI gene;Acc:65239])

HSP 1 Score: 276.174 bits (705), Expect = 3.426e-88
Identity = 142/315 (45.08%), Postives = 205/315 (65.08%), Query Frame = 1
Query:  121 PVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQN 1062
            P + L     V +  +   +   DLE + ELG+G +G+V++M H PS ++ AVK++R + + ++Q R+L DL+ISMR+  C Y V  YGA+ R GDVWICME++D+SLDKFYK V   G    IPE +L  IT  IV ALE+LH  L VIHRDVKPSNVLI+  G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G+ ++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP +  +S    +F S+CL     +R +Y EL++H     F+T    ++   + A++V  IL +
Sbjct:   58 PPRDLDSKAYVTIGEKNFVVKADDLEQIGELGRGAYGVVDKMRHVPSGVIMAVKRIRATVNTQEQKRLLMDLDISMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYKQVHEKGKT--IPEDILGKITVSIVKALEHLHSNLSVIHRDVKPSNVLINMQGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPETNQKGYNVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD-RFSADFVDFTSQCLRKNSTERPTYTELMQH----PFFT--LHDSKDTDVASFVKTILGD 363          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Zebrafish
Match: map2k4a (mitogen-activated protein kinase kinase 4a [Source:ZFIN;Acc:ZDB-GENE-060512-98])

HSP 1 Score: 271.166 bits (692), Expect = 5.190e-86
Identity = 143/344 (41.57%), Postives = 215/344 (62.50%), Query Frame = 1
Query:   55 PPNFKTFNLKSGIIEPVLINDNP-VQQLTDHT-----EVQVNGEK-ITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSL--PENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
            PP   T  + SG     L   NP +++L  H+     +++++ E+    +  DL+ L E+G+G +G V +M HKPS  + AVK++R + D+++Q ++L DL++ MRS+ CPY+V  YGA+ R GD WICME++ +S DKFYK V +   +  IPE +L  IT   V AL +L + L++IHRD+KPSN+L+D+ G +K+CDFGISG LV+S+A+T + G + Y+APERI    S  G+ +RSDVWSLG+++ ELA  +FPYP   S+++ +T V +G PP L   E   +S    NF++ CL      R  Y ELLKH  ++ +  +S       + A YV  IL
Sbjct:   33 PPIKTTSRITSG-----LPFQNPHIERLRTHSIESSGKLKISAEQHCDFTAEDLKDLGEIGRGAYGSVNKMAHKPSGQIMAVKRIRSTVDEREQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYS-SLDEVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRKGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSSSEERQFSPKFINFVNLCLTKDESKRPKYKELLKHAFIQMYEERSV------DVATYVCRIL 364          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Zebrafish
Match: map2k4a (mitogen-activated protein kinase kinase 4a [Source:ZFIN;Acc:ZDB-GENE-060512-98])

HSP 1 Score: 271.552 bits (693), Expect = 7.764e-86
Identity = 143/344 (41.57%), Postives = 215/344 (62.50%), Query Frame = 1
Query:   55 PPNFKTFNLKSGIIEPVLINDNP-VQQLTDHT-----EVQVNGEK-ITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSL--PENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
            PP   T  + SG     L   NP +++L  H+     +++++ E+    +  DL+ L E+G+G +G V +M HKPS  + AVK++R + D+++Q ++L DL++ MRS+ CPY+V  YGA+ R GD WICME++ +S DKFYK V +   +  IPE +L  IT   V AL +L + L++IHRD+KPSN+L+D+ G +K+CDFGISG LV+S+A+T + G + Y+APERI    S  G+ +RSDVWSLG+++ ELA  +FPYP   S+++ +T V +G PP L   E   +S    NF++ CL      R  Y ELLKH  ++ +  +S       + A YV  IL
Sbjct:   59 PPIKTTSRITSG-----LPFQNPHIERLRTHSIESSGKLKISAEQHCDFTAEDLKDLGEIGRGAYGSVNKMAHKPSGQIMAVKRIRSTVDEREQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYS-SLDEVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRKGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSSSEERQFSPKFINFVNLCLTKDESKRPKYKELLKHAFIQMYEERSV------DVATYVCRIL 390          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Zebrafish
Match: map2k4b (mitogen-activated protein kinase kinase 4b [Source:ZFIN;Acc:ZDB-GENE-080721-13])

HSP 1 Score: 268.855 bits (686), Expect = 1.211e-84
Identity = 127/272 (46.69%), Postives = 186/272 (68.38%), Query Frame = 1
Query:  178 ISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSL--PENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLL 984
             +  DL+ L E+G+G +G V  M+HKPS  + AVK++R + D+K+Q ++L DL++ MRS+ CPY+V  YGA+ R GD WICME++ +SLDKFYK V    ++  IPE +L  IT   V AL +L + L++IHRD+KPSN+L+D++G +K+CDFGISG LV+S+A+T + G + Y+APERI    S  G+ +RSDVWSLG+++ ELA  +FPYP   S+++ +T V +G PP L   E+  +S+    F++ CL      R  Y ELLKH  +
Sbjct:  115 FTAEDLKDLGEIGRGAYGSVNNMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMATSLDKFYKYVYC-ASDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPRWNSVFDQLTQVVKGEPPQLCSSEDRQFSHKFIQFVNLCLTKDESKRPKYRELLKHPFI 385          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Xenopus
Match: map2k6 (mitogen-activated protein kinase kinase 6 [Source:NCBI gene;Acc:448132])

HSP 1 Score: 279.641 bits (714), Expect = 8.807e-90
Identity = 149/342 (43.57%), Postives = 216/342 (63.16%), Query Frame = 1
Query:   40 SSKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQN 1062
            + KKK P  K    K    +P + +  P + L     + +  +   +   DLE + ELG+G +G+VE+M H PS  + AVK++R + + ++Q R+L DL+ISMR+  C + V  YGA+ R GDVWICME++D+SLDKFYK V   G    IPE +L  I   IV ALE+LH  L VIHRDVKPSNVLI+K G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G++++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP +  +S    +F S+CL    K+R +Y EL++H     F+     E+   + A++V  IL +
Sbjct:    4 AGKKKNPGLKI--PKEAFDQPQVSSPTPPRDLDSKACILIGEKNFEVKADDLEPIEELGRGAYGVVEKMRHVPSEQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCHFTVTFYGALFREGDVWICMELMDTSLDKFYKNVIDKGLT--IPEDILGKIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITLIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD-KFSAEFVDFTSKCLKKNSKERPTYPELMQH----HFFV--LHESKNTDVASFVKRILGD 334          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Xenopus
Match: map2k6 (mitogen-activated protein kinase kinase 6 [Source:NCBI gene;Acc:448132])

HSP 1 Score: 278.1 bits (710), Expect = 6.469e-89
Identity = 143/315 (45.40%), Postives = 203/315 (64.44%), Query Frame = 1
Query:   43 SKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLL 984
             KKK P  K    K    +P + +  P + L     + +  +   +   DLE + ELG+G +G+VE+M H PS  + AVK++R + + ++Q R+L DL+ISMR+  C + V  YGA+ R GDVWICME++D+SLDKFYK V   G    IPE +L  I   IV ALE+LH  L VIHRDVKPSNVLI+K G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G++++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP +  +S    +F S+CL    K+R +Y EL++H   
Sbjct:   26 GKKKNPGLKI--PKEAFDQPQVSSPTPPRDLDSKACILIGEKNFEVKADDLEPIEELGRGAYGVVEKMRHVPSEQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCHFTVTFYGALFREGDVWICMELMDTSLDKFYKNVIDKGLT--IPEDILGKIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITLIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD-KFSAEFVDFTSKCLKKNSKERPTYPELMQHHFF 335          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Xenopus
Match: map2k6 (mitogen-activated protein kinase kinase 6 [Source:NCBI gene;Acc:448132])

HSP 1 Score: 277.33 bits (708), Expect = 7.097e-89
Identity = 149/344 (43.31%), Postives = 215/344 (62.50%), Query Frame = 1
Query:   34 MASSKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQN 1062
            M    KK P  K    K    +P + +  P + L     + +  +   +   DLE + ELG+G +G+VE+M H PS  + AVK++R + + ++Q R+L DL+ISMR+  C + V  YGA+ R GDVWICME++D+SLDKFYK V   G    IPE +L  I   IV ALE+LH  L VIHRDVKPSNVLI+K G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G++++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP +  +S    +F S+CL    K+R +Y EL++H     F+     E+   + A++V  IL +
Sbjct:    3 MPRPYKKNPGLKI--PKEAFDQPQVSSPTPPRDLDSKACILIGEKNFEVKADDLEPIEELGRGAYGVVEKMRHVPSEQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCHFTVTFYGALFREGDVWICMELMDTSLDKFYKNVIDKGLT--IPEDILGKIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITLIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD-KFSAEFVDFTSKCLKKNSKERPTYPELMQH----HFFV--LHESKNTDVASFVKRILGD 335          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Xenopus
Match: map2k6 (mitogen-activated protein kinase kinase 6 [Source:NCBI gene;Acc:448132])

HSP 1 Score: 278.87 bits (712), Expect = 4.212e-88
Identity = 148/339 (43.66%), Postives = 212/339 (62.54%), Query Frame = 1
Query:   43 SKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
             KKK P  K    K    +P + +  P + L     + +  +   +   DLE + ELG+G +G+VE+M H PS  + AVK++R + + ++Q R+L DL+ISMR+  C + V  YGA+ R GDVWICME++D+SLDKFYK V   G    IPE +L  I   IV ALE+LH  L VIHRDVKPSNVLI+K G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G++++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP +  +S    +F S+CL    K+R +Y EL++H            E+   + A++V  IL
Sbjct:  106 GKKKNPGLKI--PKEAFDQPQVSSPTPPRDLDSKACILIGEKNFEVKADDLEPIEELGRGAYGVVEKMRHVPSEQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCHFTVTFYGALFREGDVWICMELMDTSLDKFYKNVIDKGLT--IPEDILGKIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITLIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD-KFSAEFVDFTSKCLKKNSKERPTYPELMQHHFF------VLHESKNTDVASFVKRIL 433          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Xenopus
Match: map2k6 (mitogen-activated protein kinase kinase 6 [Source:NCBI gene;Acc:448132])

HSP 1 Score: 272.322 bits (695), Expect = 1.812e-87
Identity = 134/270 (49.63%), Postives = 187/270 (69.26%), Query Frame = 1
Query:  178 ISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLL 984
            +   DLE + ELG+G +G+VE+M H PS  + AVK++R + + ++Q R+L DL+ISMR+  C + V  YGA+ R GDVWICME++D+SLDKFYK V   G    IPE +L  I   IV ALE+LH  L VIHRDVKPSNVLI+K G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G++++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP +  +S    +F S+CL    K+R +Y EL++H   
Sbjct:   11 VKADDLEPIEELGRGAYGVVEKMRHVPSEQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCHFTVTFYGALFREGDVWICMELMDTSLDKFYKNVIDKGLT--IPEDILGKIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITLIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD-KFSAEFVDFTSKCLKKNSKERPTYPELMQHHFF 277          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Mouse
Match: Map2k6 (mitogen-activated protein kinase kinase 6 [Source:MGI Symbol;Acc:MGI:1346870])

HSP 1 Score: 279.256 bits (713), Expect = 1.071e-89
Identity = 147/343 (42.86%), Postives = 215/343 (62.68%), Query Frame = 1
Query:   37 ASSKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQN 1062
            +  KK+ P  K   +     E    +  P + L     + +  +   +   DLE + ELG+G +G+VE+M H PS  + AVK++R + + ++Q R+L DL++SMR+  CP+ V  YGA+ R GDVWICME++D+SLDKFYK V  I     IPE +L  I   IV ALE+LH  L VIHRDVKPSNVLI+  G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G++++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP +  +S    +F S+CL    K+R +Y EL++H     F+T    E+   + A++V  IL +
Sbjct:    4 SKGKKRNPGLK---IPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIVELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDVSMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQV--IDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD-KFSADFVDFTSQCLKKNSKERPTYPELMQH----PFFT--VHESKAADVASFVKLILGD 334          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Mouse
Match: Map2k3 (mitogen-activated protein kinase kinase 3 [Source:MGI Symbol;Acc:MGI:1346868])

HSP 1 Score: 272.707 bits (696), Expect = 4.708e-87
Identity = 143/325 (44.00%), Postives = 208/325 (64.00%), Query Frame = 1
Query:   85 SGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
            S + +P + N  P + L   T + +      +   DL T++ELG+G +G+VE++ H  S  + AVK++R + + ++Q R+L DL+I+MR+  C Y V  YGA+ R GDVWICME++D+SLDKFY+ V  +     IPE +L  I   IV ALE+LH  L VIHRDVKPSNVLI+K G VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G+ ++SDVWSLG++++E+AIL+FPY    + +  +  V E P P LP +  +S    +F S+CL     +R SYLEL++H     F+T    +  + + A +V  IL
Sbjct:   28 SCVSKPPVSNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNTQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKV--LEKNMKIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPAD-QFSPEFVDFTSQCLRKNPAERMSYLELMEH----PFFT--LHKTKKTDIAAFVKEIL 343          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Mouse
Match: Map2k4 (mitogen-activated protein kinase kinase 4 [Source:MGI Symbol;Acc:MGI:1346869])

HSP 1 Score: 272.322 bits (695), Expect = 2.951e-86
Identity = 134/296 (45.27%), Postives = 196/296 (66.22%), Query Frame = 1
Query:  178 ISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSL--PENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
             +  DL+ L E+G+G +G V +M+HKPS  + AVK++R + D+K+Q ++L DL++ MRS+ CPY+V  YGA+ R GD WICME++ +S DKFYK V ++  +  IPE +L  IT   V AL +L + L++IHRD+KPSN+L+D+SG +K+CDFGISG LV+S+A+T + G + Y+APERI    S  G+ +RSDVWSLG+++ ELA  +FPYP   S+++ +T V +G PP L   E   +S +  NF++ CL      R  Y ELLKH  +  +  ++       E A YV  IL
Sbjct:   95 FTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSV-LDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERTV------EVACYVCKIL 383          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Mouse
Match: Map2k6 (mitogen-activated protein kinase kinase 6 [Source:MGI Symbol;Acc:MGI:1346870])

HSP 1 Score: 259.61 bits (662), Expect = 1.225e-82
Identity = 132/296 (44.59%), Postives = 190/296 (64.19%), Query Frame = 1
Query:   37 ASSKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISR 921
            +  KK+ P  K   +     E    +  P + L     + +  +   +   DLE + ELG+G +G+VE+M H PS  + AVK++R + + ++Q R+L DL++SMR+  CP+ V  YGA+ R GDVWICME++D+SLDKFYK V  I     IPE +L  I   IV ALE+LH  L VIHRDVKPSNVLI+  G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G++++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP +  +S    +F S+
Sbjct:    4 SKGKKRNPGLK---IPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIVELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDVSMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQV--IDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD-KFSADFVDFTSQ 293          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Mouse
Match: Map2k7 (mitogen-activated protein kinase kinase 7 [Source:MGI Symbol;Acc:MGI:1346871])

HSP 1 Score: 216.083 bits (549), Expect = 2.860e-65
Identity = 114/296 (38.51%), Postives = 181/296 (61.15%), Query Frame = 1
Query:  115 DNPVQQLTDHTE-VQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTS-GFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSF 993
            D  +Q++   T  + + G++    ++DLE L E+G G  G V +M  + +  + AVKQ+R S + ++  RIL DL++ ++S  CPY+V  +G      DV+I ME++ +  +K  K +     +  IPE +L  +T  IV AL YL +   VIHRDVKPSN+L+D+ G++K+CDFGISG LV+S A+T + G  +Y+APERI   + T   + IR+DVWSLG+S++ELA  +FPY    + + ++T V +  PP LP +  +S   ++F+  CL    + R  Y +LL+H  +K +
Sbjct:   20 DQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRM-----QGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHY 310          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. UniProt/SwissProt
Match: sp|P52564|MP2K6_HUMAN (Dual specificity mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6 PE=1 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 1.752e-89
Identity = 148/343 (43.15%), Postives = 215/343 (62.68%), Query Frame = 1
Query:   37 ASSKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQN 1062
            +  KK+ P  K   +     E    +  P + L     + +  +   +   DLE + ELG+G +G+VE+M H PS  + AVK++R + + ++Q R+L DL+ISMR+  CP+ V  YGA+ R GDVWICME++D+SLDKFYK V  I     IPE +L  I   IV ALE+LH  L VIHRDVKPSNVLI+  G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G++++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP +  +S    +F S+CL    K+R +Y EL++H     F+T    E+   + A++V  IL +
Sbjct:    4 SKGKKRNPGLK---IPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQV--IDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD-KFSAEFVDFTSQCLKKNSKERPTYPELMQH----PFFT--LHESKGTDVASFVKLILGD 334          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. UniProt/SwissProt
Match: sp|Q5E9X2|MP2K6_BOVIN (Dual specificity mitogen-activated protein kinase kinase 6 OS=Bos taurus OX=9913 GN=MAP2K6 PE=2 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 2.499e-89
Identity = 148/341 (43.40%), Postives = 214/341 (62.76%), Query Frame = 1
Query:   37 ASSKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
            +  KK+ P  K   +     E    +  P + L     + +  +   +   DLE + ELG+G +G+VE+M H PS  + AVK++R + + ++Q R+L DL+ISMR+  CP+ V  YGA+ R GDVWICME++D+SLDKFYK V  I     IPE +L  I   IV ALE+LH  L VIHRDVKPSNVLI+  G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G++++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP +  +S    +F S+CL    K+R +Y EL++H     F+T    E+   + A++V  IL
Sbjct:    4 SKGKKRNPGLK---IPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIVELGRGAYGVVEKMRHVPSEQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQV--IDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD-KFSEEFVDFTSQCLKKNSKERPTYPELMQH----PFFT--LHESKATDVASFVKSIL 332          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. UniProt/SwissProt
Match: sp|P70236|MP2K6_MOUSE (Dual specificity mitogen-activated protein kinase kinase 6 OS=Mus musculus OX=10090 GN=Map2k6 PE=1 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 7.491e-89
Identity = 147/343 (42.86%), Postives = 215/343 (62.68%), Query Frame = 1
Query:   37 ASSKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQN 1062
            +  KK+ P  K   +     E    +  P + L     + +  +   +   DLE + ELG+G +G+VE+M H PS  + AVK++R + + ++Q R+L DL++SMR+  CP+ V  YGA+ R GDVWICME++D+SLDKFYK V  I     IPE +L  I   IV ALE+LH  L VIHRDVKPSNVLI+  G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G++++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP +  +S    +F S+CL    K+R +Y EL++H     F+T    E+   + A++V  IL +
Sbjct:    4 SKGKKRNPGLK---IPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIVELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDVSMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQV--IDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD-KFSADFVDFTSQCLKKNSKERPTYPELMQH----PFFT--VHESKAADVASFVKLILGD 334          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. UniProt/SwissProt
Match: sp|Q9DGE0|MP2K6_DANRE (Dual specificity mitogen-activated protein kinase kinase 6 OS=Danio rerio OX=7955 GN=map2k6 PE=1 SV=2)

HSP 1 Score: 276.174 bits (705), Expect = 2.406e-87
Identity = 142/315 (45.08%), Postives = 205/315 (65.08%), Query Frame = 1
Query:  121 PVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQN 1062
            P + L     V +  +   +   DLE + ELG+G +G+V++M H PS ++ AVK++R + + ++Q R+L DL+ISMR+  C Y V  YGA+ R GDVWICME++D+SLDKFYK V   G    IPE +L  IT  IV ALE+LH  L VIHRDVKPSNVLI+  G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G+ ++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP +  +S    +F S+CL     +R +Y EL++H     F+T    ++   + A++V  IL +
Sbjct:   56 PPRDLDSKAYVTIGEKNFVVKADDLEQIGELGRGAYGVVDKMRHVPSGVIMAVKRIRATVNTQEQKRLLMDLDISMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYKQVHEKGKT--IPEDILGKITVSIVKALEHLHSNLSVIHRDVKPSNVLINMQGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPETNQKGYNVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD-RFSADFVDFTSQCLRKNSTERPTYTELMQH----PFFT--LHDSKDTDVASFVKTILGD 361          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. UniProt/SwissProt
Match: sp|O09110|MP2K3_MOUSE (Dual specificity mitogen-activated protein kinase kinase 3 OS=Mus musculus OX=10090 GN=Map2k3 PE=1 SV=2)

HSP 1 Score: 272.707 bits (696), Expect = 3.293e-86
Identity = 143/325 (44.00%), Postives = 208/325 (64.00%), Query Frame = 1
Query:   85 SGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
            S + +P + N  P + L   T + +      +   DL T++ELG+G +G+VE++ H  S  + AVK++R + + ++Q R+L DL+I+MR+  C Y V  YGA+ R GDVWICME++D+SLDKFY+ V  +     IPE +L  I   IV ALE+LH  L VIHRDVKPSNVLI+K G VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G+ ++SDVWSLG++++E+AIL+FPY    + +  +  V E P P LP +  +S    +F S+CL     +R SYLEL++H     F+T    +  + + A +V  IL
Sbjct:   28 SCVSKPPVSNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNTQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKV--LEKNMKIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPAD-QFSPEFVDFTSQCLRKNPAERMSYLELMEH----PFFT--LHKTKKTDIAAFVKEIL 343          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. TrEMBL
Match: A0A0X3PTZ8 (Dual specificity mitogen-activated protein kinase kinase 6 OS=Schistocephalus solidus OX=70667 GN=MP2K6 PE=3 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 5.005e-106
Identity = 168/343 (48.98%), Postives = 235/343 (68.51%), Query Frame = 1
Query:   40 SSKKKPPNFKTFNL---KSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQ 1059
            S+KK+PP  K F +     GII PV I   P  +LT+ T+V V  +++TI  +++  ++ELG+GQF  V++M+H PS  VFAVK+L    +   + RILND NISMR+++CPY ++SYGA+   G++WI ME++D+SLDKF + V     E  IPE +LAYITFC+VTALEYLH+ L VIHRDVKPSN+L+D+ GRVKVCDFGISG L NS+A++N+GT +YLAPERI     T GF I+SDVWSLGL++LELA  +FPY    ++++ +  V +  PP LP +S YS  +R+FI+ CLV     RA+Y+ LL+   ++S        +V+ E  N   F ++
Sbjct:    9 SAKKRPPALKNFAIGHHAPGIILPVEIA--PGTKLTNETDVIVGEKQVTIRANEMRLVSELGQGQFAYVQKMVHDPSGCVFAVKRLPFHSETPDRSRILNDYNISMRTSKCPYAIMSYGALSYVGEIWIVMELMDASLDKFLEKVYE--KEEIIPENLLAYITFCVVTALEYLHKDLHVIHRDVKPSNILVDRLGRVKVCDFGISGELTNSLAKSNIGTHNYLAPERIDPLQGTQGFRIQSDVWSLGLTLLELATGEFPYGNFPNVFSQLQQVVKQEPPKLPSDSPYSEDLRSFIADCLVKDETQRANYVTLLESKFIRSV-------DVEREAINLADFFVR 340          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. TrEMBL
Match: A0A158QT70 (Protein kinase domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS2233 PE=4 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 2.533e-97
Identity = 153/302 (50.66%), Postives = 207/302 (68.54%), Query Frame = 1
Query:   88 GIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNLGTQSYLAPERI-ITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKS 990
            G+I PV I   P  QL++ T+V +NG+K+TI   DLE   ELG+G++  V +M H PSN  FAVK+L    +   + RILND N+SMR++ CPY V+SYGA+  G + W+ ME++D SLDKF + V A G    IPE +LAYI FC+VTALEYL + L  +HRDVKPSN+LID++G VKVCD+G+SG L NS+AQ+N GT  Y+APERI  T ++  GF I++DVWSLGL++LELA  K PY   ++ + L+ +V    PP +PE   YS   R+ +S+CLV     RA+YL LL+   L+S
Sbjct:   20 GVILPVEIG--PSTQLSNRTDVIINGQKVTIDARDLEVKEELGRGEYARVHKMFHPPSNCEFAVKRLPFEIETSDRSRILNDWNVSMRTSTCPYAVLSYGALSVGCEFWVVMELMDDSLDKFLQKVYAQG--KVIPENLLAYIAFCVVTALEYLRKDLVTMHRDVKPSNILIDRAGHVKVCDYGVSGELKNSMAQSNTGTCRYMAPERIDPTRSAGGGFRIQADVWSLGLTLLELATGKHPYEGFVNQFELLKHVVHEAPPHVPETVPYSQDFRDLVSQCLVKEESARANYLRLLESPFLRS 317          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. TrEMBL
Match: G9I624 (EgMKK1 OS=Echinococcus granulosus OX=6210 GN=MKK1 PE=4 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 1.658e-96
Identity = 155/319 (48.59%), Postives = 209/319 (65.52%), Query Frame = 1
Query:   37 ASSKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNLGTQSYLAPERIITENST-SGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKS 990
            A  +  P N        G+I PV I   P  QL++ T+V +NG+K+TI   DLE   ELG+G++  V +M H PS   FAVK+L    +   + RILND N+SMR++ CPY V+SYGA+  G + W+ ME++D SLDKF + V A G    IPE +LAYI FC+VTALEYL + L  +HRDVKPSN+LID++G VKVCD+G+SG L NS+AQ+N GT  Y+APERI    S   GF I++DVWSLGL++LELA  K PY   ++ + L+ +V    PP++PE+  YS   R+ +S+CLV     RA+YL LL    L+S
Sbjct:    3 AVRRPLPLNLGETRRIPGVILPVEIG--PSTQLSNRTDVIINGQKVTIDARDLEVKEELGRGEYARVHRMYHAPSKCEFAVKRLPFEVETSDRSRILNDWNVSMRTSTCPYAVLSYGALSVGCEFWVVMELMDDSLDKFLQKVYAQG--KIIPENLLAYIAFCVVTALEYLRKDLVTMHRDVKPSNILIDRAGHVKVCDYGVSGELKNSMAQSNTGTCRYMAPERIDPSRSAGGGFRIQADVWSLGLTLLELATGKHPYESFVNRFELLKHVVHEAPPNVPESVPYSQDFRDIVSQCLVKEESARANYLRLLDSPFLRS 317          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. TrEMBL
Match: A0A068WTA2 (Dual specificity mitogen activated protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000121500 PE=4 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 1.676e-96
Identity = 155/319 (48.59%), Postives = 209/319 (65.52%), Query Frame = 1
Query:   37 ASSKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNLGTQSYLAPERIITENST-SGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKS 990
            A  +  P N        G+I PV I   P  QL++ T+V +NG+K+TI   DLE   ELG+G++  V +M H PS   FAVK+L    +   + RILND N+SMR++ CPY V+SYGA+  G + W+ ME++D SLDKF + V A G    IPE +LAYI FC+VTALEYL + L  +HRDVKPSN+LID++G VKVCD+G+SG L NS+AQ+N GT  Y+APERI    S   GF I++DVWSLGL++LELA  K PY   ++ + L+ +V    PP++PE+  YS   R+ +S+CLV     RA+YL LL    L+S
Sbjct:    3 AVRRPLPLNLGETRRIPGVILPVEIG--PSTQLSNRTDVIINGQKVTIDARDLEVKEELGRGEYARVHRMYHAPSKCEFAVKRLPFEVETSDRSRILNDWNVSMRTSTCPYAVLSYGALSVGCEFWVVMELMDDSLDKFLQKVYAQG--KIIPENLLAYIAFCVVTALEYLRKDLVTMHRDVKPSNILIDRAGHVKVCDYGVSGELKNSMAQSNTGTCRYMAPERIDPSRSAGGGFRIQADVWSLGLTLLELATGKHPYESFVNQFELLKHVVHEAPPNVPESVPYSQDFRDIVSQCLVKEESARANYLRLLDSPFLRS 317          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. TrEMBL
Match: A0A0R3WCQ2 (Protein kinase domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS8497 PE=4 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 2.695e-96
Identity = 155/319 (48.59%), Postives = 209/319 (65.52%), Query Frame = 1
Query:   37 ASSKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNLGTQSYLAPERIITENST-SGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKS 990
            A  +  P N        G+I PV I   P  QL++ T+V +NG+K+TI   DLE   ELG+G++  V +M H PS   FAVK+L    +   + RILND N+SMR++ CPY V+SYGA+  G + W+ ME++D SLDKF + V A   +  IPE +LAYI FC+VTALEYL + L  +HRDVKPSN+LID+SG VKVCD+G+SG L NS+AQ+N GT  Y+APERI    S   GF I++DVWSLGL++LELA  K PY   ++ + L+ +V    PP++PE+  YS   R+ +S+CLV     RA+YL LL    L+S
Sbjct:    3 AVRRPLPLNLGETRRIPGVILPVEIG--PSTQLSNRTDVIINGQKVTIDARDLEVKEELGRGEYARVHRMYHAPSKCEFAVKRLPFEVETSDRSRILNDWNVSMRTSTCPYAVLSYGALSVGCEFWVVMELMDDSLDKFLQKVYA--QDKIIPENLLAYIAFCVVTALEYLRKDLVTMHRDVKPSNILIDRSGHVKVCDYGVSGELKNSMAQSNTGTCRYMAPERIDPSRSAGGGFRIQADVWSLGLTLLELATGKHPYESFVNQFELLKHVVHEAPPNVPESVPYSQDFRDIVSQCLVKEESARANYLRLLDSPFLRS 317          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Cavefish
Match: map2k4a (mitogen-activated protein kinase kinase 4 [Source:NCBI gene;Acc:103045018])

HSP 1 Score: 271.937 bits (694), Expect = 8.355e-86
Identity = 135/296 (45.61%), Postives = 195/296 (65.88%), Query Frame = 1
Query:  178 ISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSL--PENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
             +  DL+ L E+G+G +G V +M HKPS  + AVK++R + D+K+Q ++L DL++ MRS+ CPY+V  YGA+ R GD WICME++ +SLDKFYK V +   E  IPE +L  IT   V AL +L + L++IHRD+KPSN+L+D++G +K+CDFGISG LV+S+A+T + G + Y+APERI    S  G+ +RSDVWSLG+++ ELA  +FPYP   S+++ +T V +G PP L   E   +S    NF++ CL      R  Y ELLKH  +  +  +S       + A+YV  IL
Sbjct:  120 FTAEDLKDLGEIGRGAYGSVNKMAHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVEFYGALFREGDCWICMELMSTSLDKFYKYVYST-LEDVIPEEILGKITLVTVKALNHLKENLKIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEERQFSPKFINFVNLCLTKDESKRPKYRELLKHPFILMYEERSV------DVASYVCRIL 408          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Cavefish
Match: map2k4b (dual specificity mitogen-activated protein kinase kinase 4 [Source:NCBI gene;Acc:103042940])

HSP 1 Score: 269.24 bits (687), Expect = 1.361e-85
Identity = 135/296 (45.61%), Postives = 195/296 (65.88%), Query Frame = 1
Query:  178 ISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSL--PENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
             +  DL+ L E+G+G +G V +M+HKPS  + AVK++R + D+K+Q ++L DL++ MRS+ CPY+V  YGA+ R GD WICME++ +S DKFYK V     +  IPE +L  IT   V AL +L + L++IHRD+KPSN+L+D++G +K+CDFGISG LV+S+A+T + G + Y+APERI    S  G+ +RSDVWSLG+++ ELA  +FPYP   S+++ +T V +G PP L   E   +S    NF++ CL      R  Y ELLKH  +     Q + E V +  A+YV  IL
Sbjct:   62 FTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYC-SLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLINSEERQFSPKFINFVNLCLTKDESKRPKYKELLKHPFI-----QMYEERVVD-VASYVCKIL 350          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Cavefish
Match: map2k4b (dual specificity mitogen-activated protein kinase kinase 4 [Source:NCBI gene;Acc:103042940])

HSP 1 Score: 269.24 bits (687), Expect = 6.466e-85
Identity = 135/296 (45.61%), Postives = 195/296 (65.88%), Query Frame = 1
Query:  178 ISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSL--PENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
             +  DL+ L E+G+G +G V +M+HKPS  + AVK++R + D+K+Q ++L DL++ MRS+ CPY+V  YGA+ R GD WICME++ +S DKFYK V     +  IPE +L  IT   V AL +L + L++IHRD+KPSN+L+D++G +K+CDFGISG LV+S+A+T + G + Y+APERI    S  G+ +RSDVWSLG+++ ELA  +FPYP   S+++ +T V +G PP L   E   +S    NF++ CL      R  Y ELLKH  +     Q + E V  + A+YV  IL
Sbjct:  112 FTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYC-SLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLINSEERQFSPKFINFVNLCLTKDESKRPKYKELLKHPFI-----QMYEERVV-DVASYVCKIL 400          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Cavefish
Match: map2k4b (dual specificity mitogen-activated protein kinase kinase 4 [Source:NCBI gene;Acc:103042940])

HSP 1 Score: 269.626 bits (688), Expect = 7.341e-85
Identity = 135/296 (45.61%), Postives = 195/296 (65.88%), Query Frame = 1
Query:  178 ISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSL--PENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
             +  DL+ L E+G+G +G V +M+HKPS  + AVK++R + D+K+Q ++L DL++ MRS+ CPY+V  YGA+ R GD WICME++ +S DKFYK V     +  IPE +L  IT   V AL +L + L++IHRD+KPSN+L+D++G +K+CDFGISG LV+S+A+T + G + Y+APERI    S  G+ +RSDVWSLG+++ ELA  +FPYP   S+++ +T V +G PP L   E   +S    NF++ CL      R  Y ELLKH  +     Q + E V  + A+YV  IL
Sbjct:  123 FTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYC-SLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLINSEERQFSPKFINFVNLCLTKDESKRPKYKELLKHPFI-----QMYEERVV-DVASYVCKIL 411          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Cavefish
Match: map2k6 (mitogen-activated protein kinase kinase 6 [Source:NCBI gene;Acc:65239])

HSP 1 Score: 248.054 bits (632), Expect = 1.175e-77
Identity = 135/302 (44.70%), Postives = 193/302 (63.91%), Query Frame = 1
Query:  178 ISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFC--------IVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
            +   DLE + ELG+G +G+V++M H PS ++ AVK++R + + ++Q R+L DL+ISMR+  C Y V  YGA+ R GDVWICME++D+SLDKFYK V   G    IPE +L              IV ALE+LH  L VIHRDVKPSNVLI+  G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G+ ++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP +  +S    +F S+  V       S+L+L     L  F+T    ++ + + A++V  IL
Sbjct:   48 VKADDLEQIGELGRGAYGVVDKMRHVPSGVIMAVKRIRATVNTQEQKRLLMDLDISMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYKQVHEKGKT--IPEDILGRCVISVTVLLNVQIVKALEHLHSRLSVIHRDVKPSNVLINMQGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPETNQKGYNVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPAD-RFSPEFVDFTSKWWVTPPN---SHLQLT---FLHPFFTCH--DSKETDVASFVKGIL 338          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Sea Lamprey
Match: map2k6 (mitogen-activated protein kinase kinase 6 [Source:NCBI gene;Acc:65239])

HSP 1 Score: 269.626 bits (688), Expect = 1.433e-86
Identity = 140/316 (44.30%), Postives = 205/316 (64.87%), Query Frame = 1
Query:  121 PVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQN-EFANYVTFILQN 1062
            P + L     + ++ +   +   DLE++ ELG+G +G+VE++ H PS  + AVK++R + + ++Q R+L DL+ISMR+  CPY V  YGA+ R GDVWICME++D+SLDKFYK V   G    IPE +L  I+  IV ALE+LH  L VIHRDVKPSNVLI+  G VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G+ ++SD+WSLG++++ELAILKFPY    + +  +  V E P P LP   ++S    +F + CL     +R +Y EL+ +    +F+    + N ++ + A +V  IL +
Sbjct:   42 PPRDLDSKACITIDDKNFEVKADDLESICELGRGAYGVVERVRHTPSGTIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPYTVTFYGALFREGDVWICMELMDTSLDKFYKKVIEKGLT--IPEDILGKISVAIVKALEHLHSKLSVIHRDVKPSNVLINTQGHVKMCDFGISGYLVDSVAKTLDAGCKPYMAPERINPEINQKGYNVKSDIWSLGITMIELAILKFPYESWGTPFQQLKQVVEEPSPQLPP-ENFSPEFVDFSTLCLKKNPNERPTYAELMDN----TFFG---IHNAKDTDVATFVKLILGD 347          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Sea Lamprey
Match: map2k4b (mitogen-activated protein kinase kinase 4b [Source:ZFIN;Acc:ZDB-GENE-080721-13])

HSP 1 Score: 261.922 bits (668), Expect = 2.225e-83
Identity = 127/277 (45.85%), Postives = 185/277 (66.79%), Query Frame = 1
Query:  163 GEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSL--PENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLL 984
            G++   +  DL+ L E+G+G +G V +M H  S  + AVK++R + D+K+Q ++L DL++ M S+ CPY+V  +GA+ R GD WICME++ +S DKFYK V    ++  IPE +L  IT   V AL YL + L++IHRDVKPSN+L+D+ G +K+CDFGISG LV+S+A+T + G + Y+APERI    S  G+ +RSDVWSLG++++ELA  KFPYP   S+++ +T V +G PP L   E   +S +  NF++ CL      R  Y ELLKH  +
Sbjct:   57 GQQYDFTADDLKDLGEIGRGAYGSVNKMQHNHSAHIMAVKRIRSTVDEKEQKQLLMDLDVVM-SSDCPYIVQFFGALFREGDCWICMELMSTSFDKFYKFVYCT-SDDVIPEEILGKITLATVKALNYLKENLKIIHRDVKPSNILLDRRGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLIELATGKFPYPKWNSVFDQLTQVVKGDPPQLSNSEERQFSASFINFVNSCLTKDESRRPKYRELLKHPFI 331          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Sea Lamprey
Match: map2k7 (mitogen-activated protein kinase kinase 7 [Source:ZFIN;Acc:ZDB-GENE-090312-186])

HSP 1 Score: 222.631 bits (566), Expect = 3.732e-68
Identity = 121/317 (38.17%), Postives = 192/317 (60.57%), Query Frame = 1
Query:  115 DNPVQQLTDHTE-VQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENST-SGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
            D  +Q++ + T  + ++G++    +S+LETL E+G G  G V +M +KP++ + AVKQ+R S +  +  RIL DL++ ++S  CPY+V  +G+     DV+I ME++ +  +K  K +     +  IPE +L  +T  IV AL YL +   VIHRDVKPSN+L+D  GR+K+CDFGISG LV+S A+T   G  +Y+APERI   + T   + IR+DVWSLG+S++ELA  +FPY    + + ++T V +  PP LP +  +S   + F+  CL    + R  Y +LL+H  L+ +      E V+ + A +   ++
Sbjct:   49 DQKLQEIMNQTGFLTLDGKRYRADISELETLGEMGSGTCGQVWKMRYKPTSHILAVKQMRRSGNKDENKRILMDLDVVLKSHDCPYIVQCHGSFITNTDVFIAMELMGTCAEKLKKRI-----QGPIPENILGKMTVAIVKALSYLKEKHGVIHRDVKPSNILLDSRGRIKLCDFGISGRLVDSKAKTRGAGCAAYMAPERIDPPDPTHPDYDIRADVWSLGISLVELATGQFPYQNCKTDFEVLTKVLQEDPPLLPSDMGFSLDFQAFVKDCLTKDHRKRPKYNKLLEHAFLRRY------ERVEVDVATWFRDVM 354          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004725.1 (pep scaffold:Pmarinus_7.0:GL477683:141377:157028:-1 gene:ENSPMAG00000004255.1 transcript:ENSPMAT00000004725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.859 bits (429), Expect = 8.685e-49
Identity = 81/209 (38.76%), Postives = 135/209 (64.59%), Query Frame = 1
Query:  190 DLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDS-SLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYP 813
            D E L+ELG G  G+V ++LHKPS L+ A K +        +++I+ +L + +     PY+V  YGA +  G++ ICME +D  SLD   K    I      PE +L  ++  ++  L YL +  +++HRDVKPSN+L++  G +K+CDFG+SG L++S+A + +GT+SY++PER+      + ++++SD+WS+GLS++E+AI ++P P
Sbjct:   45 DFEKLSELGAGNGGVVTKVLHKPSALIMARKLIHLEIKPAIRNQIIRELQV-LHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDLVLKKAGRI------PEEILGKVSIAVIKGLAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERL----QGTHYSVQSDIWSMGLSLVEMAIGRYPIP 242          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 109.383 bits (272), Expect = 3.991e-26
Identity = 89/298 (29.87%), Postives = 153/298 (51.34%), Query Frame = 1
Query:  181 SMSDLETL----NELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILD--SSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVK--PSNVLIDKSGRVKVCDFGISGTLVNSVAQTN--LGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLL-KSFYTQSFLENVQNEFANY 1041
            S +D E L      +GKG FG V + +   +  V A+K +   + + + + I  ++ + +     PYV   +G+  +G  +WI ME L   S+LD    L+     E    E  +A I   I+  L+YLH + R IHRD+K   +NVL+ + G VK+ DFG++G L ++  + N  +GT  ++APE I      S +  ++D+WSLG++ +ELA  + P   ++    ++  + +  PP+L  N  YS   + F+  CL    + R +  ELLKH  + +S    S+L  + + +  +
Sbjct:   18 SCADPEELFTKQERIGKGSFGEVFKGIDNRTKEVVAIKIIDLEEAEDEIEDIQQEITV-LSQCDSPYVTHYFGSYLKGTKLWIIMEYLGGGSALD----LIKPGPLE----EHQIATILREILKGLDYLH-SERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVI----KQSAYDFKADIWSLGITAIELAKGEPPN-SELHPMRVLFLIPKNNPPTLEGN--YSKAFKEFVDSCLNKDPQFRPTAKELLKHKFIQRSAKKTSYLTELIDRYKRW 298          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Yeast
Match: PBS2 (MAP kinase kinase of the HOG signaling pathway; activated under severe osmotic stress; mitophagy-specific regulator; plays a role in regulating Ty1 transposition [Source:SGD;Acc:S000003664])

HSP 1 Score: 226.868 bits (577), Expect = 4.979e-67
Identity = 126/314 (40.13%), Postives = 195/314 (62.10%), Query Frame = 1
Query:  160 NGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILD-SSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKS-GRVKVCDFGISGTLVNSVAQTNLGTQSYLAPERIITEN-STSGFTIRSDVWSLGLSILELAILKFPYPLDI--SLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQ-NN*ILLKR 1083
            NG    I++ +LE L+ELG G +G V ++LHKP+N++ A K++R   D+ K  +IL +L + +     PY+V  YGA    G V++CME +D  SLDK Y   S IG    I E  LA+I   ++  L+ L +   +IHRDVKP+N+L   + G VK+CDFG+SG LV S+A+TN+G QSY+APERI + N   + +T++SD+WSLGLSILE+A+ ++PYP +   ++++ ++ + +GPPP LP +  +S+  ++F+S CL    + R +Y  L +H  L  +  Q          + Y+T  L+  N IL +R
Sbjct:  349 NGSSSRITLDELEFLDELGHGNYGNVSKVLHKPTNVIMATKEVRLELDEAKFRQILMELEV-LHKCNSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKIYDESSEIGG---IDEPQLAFIANAVIHGLKELKEQHNIIHRDVKPTNILCSANQGTVKLCDFGVSGNLVASLAKTNIGCQSYMAPERIKSLNPDRATYTVQSDIWSLGLSILEMALGRYPYPPETYDNIFSQLSAIVDGPPPRLPSD-KFSSDAQDFVSLCLQKIPERRPTYAALTEHPWLVKYRNQDV------HMSEYITERLERRNKILRER 651          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Yeast
Match: STE7 (Signal transducing MAP kinase kinase; involved in pheromone response where it phosphorylates Fus3p; involved in the pseudohyphal/invasive growth pathway where it phosphorylates of Kss1p; phosphorylated by Ste11p; degraded by ubiquitin pathway [Source:SGD;Acc:S000002318])

HSP 1 Score: 167.548 bits (423), Expect = 1.932e-46
Identity = 97/292 (33.22%), Postives = 167/292 (57.19%), Query Frame = 1
Query:  178 ISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQ-DRILNDLNISMRSTQCPYVVVSYGA---MHRGGDVWICMEILD-SSLDKF---YKLVSAIGT----ESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPY----PLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQS 1005
            I + DL  L ++G G  G V + LH P + + A K +   +++    ++++ +L+I         ++  YGA    H   ++ I ME  D  SLDK    YK     GT    +++  E+ ++ I + ++  L++L++  ++IHRD+KPSNVLI+  G++K+CDFG+S  L+NS+A T +GT +Y++PERI      + ++I+ DVWSLGL I+EL   +FP          + +L+  +   P P LP++  YS  + +F++RC +   ++R+S  ELL HDL+  + + S
Sbjct:  186 IQLQDLVQLGKIGAGNSGTVVKALHVPDSKIVAKKTIPVEQNNSTIINQLVRELSIVKNVKPHENIITFYGAYYNQHINNEIIILMEYSDCGSLDKILSVYKRFVQRGTVSSKKTWFNELTISKIAYGVLNGLDHLYRQYKIIHRDIKPSNVLINSKGQIKLCDFGVSKKLINSIADTFVGTSTYMSPERI----QGNVYSIKGDVWSLGLMIIELVTGEFPLGGHNDTPDGILDLLQRIVNEPSPRLPKDRIYSKEMTDFVNRCCIKNERERSSIHELLHHDLIMKYVSPS 473          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Yeast
Match: MKK1 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p; MKK1 has a paralog, MKK2, that arose from the whole genome duplication [Source:SGD;Acc:S000005757])

HSP 1 Score: 153.295 bits (386), Expect = 3.134e-41
Identity = 104/300 (34.67%), Postives = 163/300 (54.33%), Query Frame = 1
Query:  124 VQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRC-SKDDKKQDRILNDLNISMRSTQCPYVVVSYGAM--HRGGDVWICMEILDS-SLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFP-----YPLDISLYNLITYVTEGPPPSLPENSS---YSNTVRNFISRCLVIAVKDRASYLELLKHDLLK 987
            +  + D  ++  NG K       +ETL  LG+G  G V +   K  + +FA+K +   + D + Q +I  +L  + RS Q  Y+V  YG         ++I ME +   SLD  YK +   G    I E +L  I   ++  L YLH+  +VIHRD+KP N+L++++G+VK+CDFG+SG  VNS+A T  GT  Y+APERI  +     +++ SDVWSLGL+ILE+A  KFP        +I+ + L+ ++    P    E  S   +S + ++FI  CL    ++R S  +++ H  +K
Sbjct:  198 LNSVRDVDQLDENGWKYANLKDRIETLGILGEGAGGSVSKCKLKNGSKIFALKVINTLNTDPEYQKQIFRELQFN-RSFQSEYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLERGGR--ISEKVLGKIAEAVLRGLSYLHEK-KVIHRDIKPQNILLNENGQVKLCDFGVSGEAVNSLATTFTGTSFYMAPERIQGQ----PYSVTSDVWSLGLTILEVANGKFPCSSEKMAANIAPFELLMWILTFTPELKDEPESNIIWSPSFKSFIDYCLKKDSRERPSPRQMINHPWIK 489          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 146.747 bits (369), Expect = 5.185e-39
Identity = 97/274 (35.40%), Postives = 153/274 (55.84%), Query Frame = 1
Query:  190 DLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRC-SKDDKKQDRILNDLNISMRSTQCPYVVVSYGAM--HRGGDVWICMEILDS-SLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLD-----ISLYNLITYVTEGPP--PSLPE-NSSYSNTVRNFISRCLVIAVKDRASYLELLKH 975
            ++ TL  LG+G  G V +   K    VFA+K +   + D + Q +I  +L  + +S +  Y+V  YG     +   ++I ME +   SL+  YK +   G    I E ++  I   ++  L YLH+  +VIHRD+KP N+L+++ G +K+CDFG+SG  VNS+A T  GT  Y+APERI  +     +++  DVWSLGL++LE+A  +FP+  D     ++   L+T +    P     PE + S+S T R+FI  CL    ++R S  ++LKH
Sbjct:  213 EITTLGILGEGAGGSVAKCRLKNGKKVFALKTINTMNTDPEYQKQIFRELQFN-KSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGR--ISERVIGKIAESVLRGLSYLHER-KVIHRDIKPQNILLNEKGEIKLCDFGVSGEAVNSLAMTFTGTSFYMAPERIQGQ----PYSVTCDVWSLGLTLLEVAGGRFPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISWSKTFRSFIDYCLKKDARERPSPRQMLKH 478          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 110.923 bits (276), Expect = 3.734e-26
Identity = 80/266 (30.08%), Postives = 134/266 (50.38%), Query Frame = 1
Query:  211 LGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICME-ILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVA---QTNLGTQSYLAPERIITENSTSG--FTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKS 990
            +G+G+FG+V +  +  +  V+A+K L    D  + + +  ++       Q   +   YG+  +   +WI ME     SL    +          I E  +  I   ++ AL+ +H+   VIHRD+K +NVLI   G VK+CDFG++   VN  +   QT  GT  ++APE I+      G  +  + D+WSLG++  E+A    PY  D+     +  + +  PP L E+ SYS +++ FI+ CL    K+R S  +LLK   +++
Sbjct:   29 IGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLR-------PGKIDEKYIGVIMRELLVALKCIHKD-NVIHRDIKAANVLITNEGNVKLCDFGVAAQ-VNQTSLRRQTMAGTPYWMAPEVIM-----EGVYYDTKVDIWSLGITTYEIATGNPPY-CDVEALRAMQLIIKSKPPRL-EDRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIRA 278          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Nematostella
Match: EDO38062 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX6])

HSP 1 Score: 263.848 bits (673), Expect = 3.982e-84
Identity = 131/288 (45.49%), Postives = 191/288 (66.32%), Query Frame = 1
Query:  127 QQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLK 987
            + L+D T + V G++      DL+ + ELG G +G V +MLH P++ V AVK++R + +  +Q R+L DL+ISMR +  PY V  YGA+ R GDVWICME++ +SL   YK V +   +  IPE +L  I   +V+ALEYLH  L+VIHRDVKPSN+L+D+ G  K+CDFGISG LV+S+A+T + G + Y+APERI  +    G+ IRSD+WSLG++++ELA  KFPY    + +  +  V   P PSLPE   +S   R+F+++ L+   K+R +Y +LL+H  +K
Sbjct:   36 RNLSDKTTITVGGQEFDCQADDLQEIRELGHGAYGYVYEMLHVPTSTVMAVKKIRANVNSTEQKRLLMDLDISMRVSDYPYTVHFYGALFREGDVWICMELMKTSLYDLYKQVFS-KPDRRIPEEVLGKIAVSVVSALEYLHSNLKVIHRDVKPSNILVDERGNFKLCDFGISGQLVDSLAKTVDAGCKPYMAPERINPDRDMKGYDIRSDIWSLGITMIELATGKFPYTQWKTPFEQLKQVVHEPSPSLPE-GPFSLNFRDFVTKSLIKNYKERPNYNQLLEHPFIK 321          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Nematostella
Match: EDO48408 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJN6])

HSP 1 Score: 251.521 bits (641), Expect = 6.051e-80
Identity = 123/274 (44.89%), Postives = 181/274 (66.06%), Query Frame = 1
Query:  181 SMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSY--SNTVRNFISRCLVIAVKDRASYLELLKHDLLKSF 993
            S SDL    E+G+G +G V +MLH  SN   AVK++R + D K Q ++L DL++ MRS+ CP++V  YGA+   GD WICME+++ S DK YKLV     E  IPE +L+ + + +V AL+YL + L +IHRDVKPSN+L+D++G +K+CDFGISG LV+S+A+T + G + Y+APERI   +   G+ IRSDVWS G++++EL+   FPYP   S+++ ++ V +G PP L        S  + NF++ CL   V+ R  Y ELL H  ++ +
Sbjct:    5 SSSDLVDCGEIGRGAYGTVNKMLHPNSNTFMAVKRIRSTVDQKDQKQLLMDLDVVMRSSNCPFIVRFYGALFTEGDAWICMELMEISFDKCYKLVYG-SIEQIIPEEILSKVAYAVVKALDYLKRELNIIHRDVKPSNILLDRNGAIKLCDFGISGHLVDSIAKTRDAGCKPYMAPERIDPSSCRQGYDIRSDVWSFGITMIELSTGVFPYPKWNSVFDQLSQVVDGDPPQLSNTPEMMRSPELLNFVNICLSKEVEKRPKYNELLNHQFIQLY 277          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Nematostella
Match: EDO43384 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYU8])

HSP 1 Score: 214.157 bits (544), Expect = 2.411e-65
Identity = 116/283 (40.99%), Postives = 173/283 (61.13%), Query Frame = 1
Query:  151 VQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTS-GFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSF 993
            +++  +K   S+ DLE   E+G G  G V +M HK S  V AVK++  S + ++Q RIL DL + M+S  CPY+V   GA+    DV+ICME++ + LDK  K +     ++ IPE +L  +   IV AL YL +   V+HRDVKPSN+L+D +G VK+CDF ISG LV+S A+T + G  +Y+APERI   +  +  + +R+DVWSLG+S++ELA  +FPY    + + ++T V    PPSLP +  +S+   +F+  CL      R  Y +LL H  + S+
Sbjct:   29 LKLGDKKYDFSLDDLEMSGEIGYGTCGQVCKMKHKKSGQVLAVKRMARSHNKEEQKRILMDLEVVMKSHDCPYIVTCMGALISKSDVFICMELMATCLDKLLKRL-----QNPIPEHILGKMAVAIVKALHYLKEEHGVMHRDVKPSNMLLDSAGCVKLCDFSISGRLVDSKAKTKSAGCAAYMAPERIDPPDPMNPNYDVRADVWSLGISLVELATGEFPYRNCTTEFEVLTRVMGEDPPSLPGSKGFSHDFSSFVDECLTKDFHYRPKYNKLLVHPFITSY 306          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Nematostella
Match: EDO45553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSF4])

HSP 1 Score: 179.489 bits (454), Expect = 7.882e-52
Identity = 106/338 (31.36%), Postives = 175/338 (51.78%), Query Frame = 1
Query:  178 ISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDS-SLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYP-----------------------------------------LDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQNN 1065
            +S  D E + ELG G  G+V ++LHKP+ L+ A K +        + +I+ +L + +     PY+V  +GA +  G++ ICME +D  SLD   K    I      PE +L  I+  ++  L YL +  ++IHRDVKPSN+L++  G +K+CDFG+SG L++S+A + +GT+SY++PER+      + +TI+SD+WS GLS++E+AI ++P P                                           ++++ L+ Y+   PPP LP  + +S     F+ +CLV   K RA    L+ H     F  ++   NV  +FA +++  L  +
Sbjct:   34 LSNDDFEKITELGAGNGGVVTKVLHKPTGLIMARKLIHLEVKPAIRTQIIRELKV-LHDCNSPYIVGFFGAFYSDGEISICMEHMDGGSLDLILKKAGRI------PEDILGKISIAVLKGLCYLREIHQIIHRDVKPSNILVNSRGEIKMCDFGVSGQLIDSMANSFVGTRSYMSPERL----QGNQYTIQSDIWSFGLSLVEMAIGRYPIPPPDPQEIEKVLSREPSSMASPMSVGRLPPGVRPPSGVNNETRPMAIFELLDYIVNEPPPILP-GAHFSPEFCEFVQKCLVKNPKQRADLTYLMTH----KFIAKADKSNV--DFAKWISQFLSED 353          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 152.91 bits (385), Expect = 3.212e-42
Identity = 94/282 (33.33%), Postives = 157/282 (55.67%), Query Frame = 1
Query:  193 LETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDS-SLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTN--LGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNE 1029
             + L +LG+G +G V + +HK S  V A+KQ+    D ++   I+ ++++ M+    PYVV  YG+  +  D+WI ME   + S+    K+ +   TE  I + +L Y     +  LEYLH   R IHRD+K  N+L++  G  K+ DFG++G L +++A+ N  +GT  ++APE I       G+   +D+WSLG++ +E+A  K PY  DI     I  +   PPP+  +   +S   ++F+S+CLV   ++RA+  ELL+H  ++     S L ++  E
Sbjct:   24 FDVLEKLGEGSYGSVFKAMHKESGQVVAIKQVPVDTDLQE---IIKEISM-MQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEI-KCVLKYT----LKGLEYLH-LRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVI----QEVGYDCLADIWSLGITAMEMAEGKPPYA-DIHPMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQHSFIQGAKQISILSSMIQE 290          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Medaka
Match: MAP2K6 (dual specificity mitogen-activated protein kinase kinase 6 [Source:NCBI gene;Acc:101170843])

HSP 1 Score: 279.641 bits (714), Expect = 6.045e-90
Identity = 143/313 (45.69%), Postives = 209/313 (66.77%), Query Frame = 1
Query:  121 PVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
            P + L     V +  +   +   DLE + ELG+G +G+V++M H P+N++ AVK++R + +  +Q R+L DL+ISMR+  C Y V  YGA+ R GDVWICME++D+SLDKFYK V   G    IPE +L  I   IV ALE+LH+ L VIHRDVKPSNVLI+  G+VK+CDFGISG LV+SVA+T + G + Y+APERI  + +  G++++SD+WSLG++++ELAILKFPY    + +  +  V + P P LP +  +S    +FIS+CL  A ++R +Y EL+ H    SF+T    ++ + + A++V  IL
Sbjct:   31 PPRDLDSKACVTIGDQNFVVKADDLEQIEELGRGAYGVVDKMKHVPTNVIMAVKRIRATVNTLEQKRLLMDLDISMRTVDCHYTVTFYGALFREGDVWICMELMDTSLDKFYKNVIEKGKT--IPEDILGKIAVAIVKALEHLHRNLSVIHRDVKPSNVLINTLGQVKMCDFGISGHLVDSVAKTMDAGCKPYMAPERINPDLNQKGYSVKSDIWSLGITMIELAILKFPYDSWGTPFQQLKQVVDEPSPQLPAD-RFSPEFVDFISQCLRKAPRERPAYTELMNH----SFFT--LHDSKETDVASFVKVIL 334          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Medaka
Match: map2k6 (dual specificity mitogen-activated protein kinase kinase 6 [Source:NCBI gene;Acc:101163933])

HSP 1 Score: 280.411 bits (716), Expect = 6.329e-90
Identity = 149/342 (43.57%), Postives = 211/342 (61.70%), Query Frame = 1
Query:   40 SSKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQN 1062
              KKKP       L   + E       P + L     V +  +K  +   DLE + ELG+G +G+V++M H PS L+ AVK++R + + ++Q R+L DL+ISMR+  C Y V  YGA+ R GDVWICME++D+SLDKFYK V   G    IPE +L  I   IV ALE+LH  L+VIHRDVKPSNVLI+  G+VK+CDFGISG LV+SVA+T + G + Y+APERI  E +  G+ ++SD+WSLG++++ELAIL+FPY    + +  +  V E P P LP    +S    +F S+CL    K+R +Y EL++H    S   +      + + A++V  IL +
Sbjct:   30 GGKKKP----VLKLSKEVFEQPAPAAVPPRDLDSKACVTIGEKKCEVKADDLEQICELGRGAYGVVDKMRHVPSGLIMAVKRIRATVNTQEQKRLLMDLDISMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYKQVIEKGLT--IPEDILGKIAVSIVKALEHLHSNLQVIHRDVKPSNVLINTQGQVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPETNQKGYNVKSDIWSLGITMIELAILRFPYESWGTPFQQLKQVVEEPSPQLPAG-QFSPEFVDFTSQCLRKVSKERPTYTELMQHPFFTSHDAK------ETDVASFVKVILGD 358          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Medaka
Match: map2k4b (dual specificity mitogen-activated protein kinase kinase 4 [Source:NCBI gene;Acc:101161098])

HSP 1 Score: 264.233 bits (674), Expect = 5.990e-83
Identity = 132/296 (44.59%), Postives = 193/296 (65.20%), Query Frame = 1
Query:  178 ISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSL--PENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
             +  DL  L E+G+G +G V +M+HKP+  + AVK++R + ++K+Q ++L DL++ MRS+ C Y+V  YGA+ R GD WICME++ +SLDKFYK V     +  IPE +L  IT   V AL +L + L++IHRD+KPSN+L+D+ G +K+CDFGISG LV+S+A+T + G + Y+APERI    S  G+ +RSDVWSLG+++ ELA  +FPYP   S+++ +T V +G PP L   E   +S    NF++ CL      R  Y ELLKH  +   Y + F+     + A+YV  IL
Sbjct:  105 FTAEDLRDLGEIGRGAYGSVNKMVHKPTGQIMAVKRIRSTVEEKEQKQLLMDLDVVMRSSDCLYIVQFYGALFREGDCWICMELMSTSLDKFYKYVYC-ALDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILMDRRGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGEPPQLSNSEERQFSPKFINFVNLCLTKDESKRPKYRELLKHSFI-LMYEERFV-----DVASYVCRIL 393          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Medaka
Match: map2k4a (mitogen-activated protein kinase kinase 4 [Source:NCBI gene;Acc:101174917])

HSP 1 Score: 264.233 bits (674), Expect = 6.532e-83
Identity = 134/323 (41.49%), Postives = 208/323 (64.40%), Query Frame = 1
Query:  118 NP-VQQLTDHT-----EVQVNGEK-ITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSL--PENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
            NP +++L  H+     +++++ E+    +  DL+ L E+G+G +G V +M+HKPSN + AVK++R + D+K+Q ++L DL++ +RS+ CPY+V  YGA+ R GD WICME++ +SLDKFYK V     +  IPE +L  IT   V AL +L + L++IHRD+KPSN+L+D+ G +K+CDFGISG LV+S+A+T + G + Y+APERI    S  G+ +RSDVWSLG+++ ELA  +FPYP   S+++ +T V  G PP L   +   +S    +F++ CL      R  Y ELL+   ++ +  +S       + A YV  I+
Sbjct:   88 NPHIERLRTHSIESSGKLKISAEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSNQIMAVKRIRSTVDEKEQKQLLMDLDVVVRSSDCPYIVQFYGALFREGDCWICMELMATSLDKFYKFVYC-SLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRKGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVRGDPPQLSNSDERRFSPKFISFVNVCLTKEESKRPKYRELLRDPFIQMYEERSV------DVAGYVCRIM 403          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Medaka
Match: map2k4a (mitogen-activated protein kinase kinase 4 [Source:NCBI gene;Acc:101174917])

HSP 1 Score: 263.848 bits (673), Expect = 8.069e-83
Identity = 134/323 (41.49%), Postives = 208/323 (64.40%), Query Frame = 1
Query:  118 NP-VQQLTDHT-----EVQVNGEK-ITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSL--PENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
            NP +++L  H+     +++++ E+    +  DL+ L E+G+G +G V +M+HKPSN + AVK++R + D+K+Q ++L DL++ +RS+ CPY+V  YGA+ R GD WICME++ +SLDKFYK V     +  IPE +L  IT   V AL +L + L++IHRD+KPSN+L+D+ G +K+CDFGISG LV+S+A+T + G + Y+APERI    S  G+ +RSDVWSLG+++ ELA  +FPYP   S+++ +T V  G PP L   +   +S    +F++ CL      R  Y ELL+   ++ +  +S       + A YV  I+
Sbjct:   82 NPHIERLRTHSIESSGKLKISAEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSNQIMAVKRIRSTVDEKEQKQLLMDLDVVVRSSDCPYIVQFYGALFREGDCWICMELMATSLDKFYKFVYC-SLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRKGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVRGDPPQLSNSDERRFSPKFISFVNVCLTKEESKRPKYRELLRDPFIQMYEERSV------DVAGYVCRIM 397          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Planmine SMEST
Match: SMESG000040748.1 (SMESG000040748.1)

HSP 1 Score: 710.679 bits (1833), Expect = 0.000e+0
Identity = 344/344 (100.00%), Postives = 344/344 (100.00%), Query Frame = 1
Query:   34 MASSKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQNN 1065
            MASSKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQNN
Sbjct:    1 MASSKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQNN 344          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Planmine SMEST
Match: SMESG000041446.1 (SMESG000041446.1)

HSP 1 Score: 422.935 bits (1086), Expect = 7.788e-146
Identity = 204/348 (58.62%), Postives = 262/348 (75.29%), Query Frame = 1
Query:   46 KKKPPNFKTFNLKSGI----------IEPVLINDNPVQQLTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYN-LITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFIL 1056
            K +PP F+    + G           I+PV +    V  L+DHTEVQVNG KIT+++ D+E+     +GQ+G+VE+M HKPS+L+FAVK++RCS +DK+Q R+LNDLNISMRST+CPYVV+SYGAM +GGDVWICME+LDSSLDKFY  +     ++FIPE +LAYITFC+VTALEYLH+ L VIHRDVKPSN LIDK GRVKVCDFGISG L+NS+A+TN+G+Q YLAPERI  + S SG++IRSDVWSLGLS+LELAI KFPY    SL++ L   V    PP+LP +S+YSNTVR+FIS+CL+    DRASY  L++H++L  F  + +L+  +  FA Y T +L
Sbjct:   13 KNRPPAFRNLISEPGTDSPTTPQTESIQPVALTGKAVASLSDHTEVQVNGNKITVAIKDMES-----EGQYGVVEKMRHKPSSLIFAVKKIRCSMNDKEQRRLLNDLNISMRSTKCPYVVISYGAMFQGGDVWICMELLDSSLDKFYHKIKDKDPKAFIPERLLAYITFCLVTALEYLHRELHVIHRDVKPSNTLIDKRGRVKVCDFGISGDLINSMAKTNIGSQPYLAPERINPDPSGSGYSIRSDVWSLGLSVLELAICKFPYSRWNSLFDQLKDVVASDTPPALPNDSTYSNTVRHFISQCLIKKDSDRASYDVLIEHEMLTPFKNEKYLQESKTRFAEYATDVL 355          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Planmine SMEST
Match: SMESG000057661.1 (SMESG000057661.1)

HSP 1 Score: 260.381 bits (664), Expect = 1.864e-82
Identity = 125/263 (47.53%), Postives = 179/263 (68.06%), Query Frame = 1
Query:  190 DLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQT-NLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKH 975
            DL+ L E+G+G +G V +M+H+ ++ + AVK++R + D+ +Q   LNDL++ M+S  CP++V  YGA+ R GD WICME++ +SLDKFY+ V     E  IPE +L  +    V AL+YL   LRVIHRDVKPSNVLID+ G +K+CDFGISG L++S+A++ + G + Y+APERI  + S  G+ IRSDVWSLG++++EL   KFPYP   S++  +T V  G PPS+ ++  +S   +NFI RCL      R  Y EL +H
Sbjct:   53 DLQDLGEIGRGAYGSVNRMIHRKTDQLMAVKRIRSTLDESQQYSTLNDLDVIMKSANCPFIVRFYGALFREGDCWICMELMSTSLDKFYRYVYVHLKEK-IPEKILGKVAVGTVKALDYLKVELRVIHRDVKPSNVLIDRDGNIKLCDFGISGQLIDSIAKSRDAGCKPYMAPERIHPKLSAKGYDIRSDVWSLGITMIELGTGKFPYPAWESVFEQLTCVLHGDPPSVNDSMGFSRQFQNFIERCLEKDYSKRPRYDELKQH 314          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Planmine SMEST
Match: SMESG000035167.1 (SMESG000035167.1)

HSP 1 Score: 193.741 bits (491), Expect = 2.990e-57
Identity = 114/300 (38.00%), Postives = 174/300 (58.00%), Query Frame = 1
Query:  133 LTDHTEVQVNGEKITISMSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFIS--RC-LVIAVKDRASYLELLKHDLLKSFYTQSFLENVQ 1023
            L++  + +   E   I M +L  +  LG+G F  V+ M    + + FAVK      D+  +D I+ND+ +  +S   P+ +  YG +     +WI ME +D S+  FY+ + +   +   P ++L Y ++C V  LE LH   +VIHRDVKPSN+LI++SG+ K+CDFGISG L +S+ Q+ +GT +YLAPE+I  ++    ++I SDVWSLGLSILE+A +KFP+    +L + +  + +  PP+LP +S Y     + I   +C LV   K R  Y +L K  LL+SF  QS     Q
Sbjct:   11 LSNRLQCRYKNEDSYIEMDNLLFIKHLGEGNFSTVQLMKDPVTEIEFAVKMFNNVADNVMKD-IMNDIEVG-KSISSPFKIDYYGGLKDPYRIWILMEPMDLSVRLFYEKIISKDKDYRFPGIILGYFSYCSVYVLEDLHLK-QVIHRDVKPSNMLINRSGKFKLCDFGISGKLKDSLVQSAVGTNAYLAPEKIDPKSHGDKYSIISDVWSLGLSILEIADMKFPFSNCKTLMSQLYNIVQSSPPTLPLDSPYHKQYPDLIKFFQCTLVKDPKQRYRYDKLKKLPLLQSFSDQSKFNEAQ 307          
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Planmine SMEST
Match: SMESG000007331.1 (SMESG000007331.1)

HSP 1 Score: 195.282 bits (495), Expect = 4.580e-55
Identity = 107/282 (37.94%), Postives = 163/282 (57.80%), Query Frame = 1
Query:  151 VQVNGEKITISMSDLETLNELGKGQFGIVEQM-LHKPSNLVFAVKQLRCSKDDKKQD-RILNDLNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTESFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCDFGISGTLVNSVAQTNL-GTQSYLAPERIITENSTSGFTIRSDVWSLGLSILELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVIAVKDRASYLELLKHDLLK 987
            + +N EKIT  M + E  + LG G  G V +M L +  ++  AVKQ+R S    +++ RI  DL++  R   CP++V  YG      +VWICME + + LDK  K ++        PE ++  ++  I+ AL+YL     ++HRD+KPSN+L+   G VK+CDFGIS  L +S+A +   G   Y+APER+    ++S + +R+DVWSLG+S++ELAI KFP     S + ++  + +G PPSLPE   YS     F+S CL     +R  Y +L+  D  +
Sbjct:   59 LTINNEKITTKMDEFEIESSLGHGTCGNVYRMRLKRLPSIPMAVKQMRRSSHSVEENKRIFRDLDVVTRCHDCPFIVTCYGIFISPSEVWICMEEMSTCLDKLLKFLNCP-----FPEYVIGKVSCAIIKALQYLKTKHDIMHRDIKPSNMLLSDRGEVKLCDFGISAKLKDSIANSRQPGCIGYMAPERL----NSSTYDVRADVWSLGMSLVELAIGKFPIDGLKSEFEIMARIIDGKPPSLPE-GVYSEAFNKFVSSCLQKDFNNRPKYDKLVSADFYR 330          
The following BLAST results are available for this feature:
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP2K63.649e-9043.15mitogen-activated protein kinase kinase 6 [Source:... [more]
MAP2K69.900e-8748.25mitogen-activated protein kinase kinase 6 [Source:... [more]
MAP2K69.900e-8748.25mitogen-activated protein kinase kinase 6 [Source:... [more]
MAP2K42.585e-8641.98mitogen-activated protein kinase kinase 4 [Source:... [more]
MAP2K43.659e-8642.86mitogen-activated protein kinase kinase 4 [Source:... [more]
back to top
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sek-18.488e-8140.81Dual specificity mitogen-activated protein kinase ... [more]
sek-18.488e-8140.81Dual specificity mitogen-activated protein kinase ... [more]
mkk-47.226e-6543.17MAP kinase kinase mkk-4 [Source:UniProtKB/Swiss-P... [more]
sek-32.085e-5638.04SAPK/ERK kinase [Source:UniProtKB/TrEMBL;Acc:Q8MP... [more]
sek-32.085e-5638.04SAPK/ERK kinase [Source:UniProtKB/TrEMBL;Acc:Q8MP... [more]
back to top
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lic1.673e-8142.49gene:FBgn0261524 transcript:FBtr0073720[more]
Mkk41.110e-7442.00gene:FBgn0024326 transcript:FBtr0334320[more]
Mkk41.110e-7442.00gene:FBgn0024326 transcript:FBtr0081892[more]
Mkk41.110e-7442.00gene:FBgn0024326 transcript:FBtr0300443[more]
hep2.150e-6538.64gene:FBgn0010303 transcript:FBtr0330397[more]
back to top
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map2k63.187e-8845.08mitogen-activated protein kinase kinase 6 [Source:... [more]
map2k63.426e-8845.08mitogen-activated protein kinase kinase 6 [Source:... [more]
map2k4a5.190e-8641.57mitogen-activated protein kinase kinase 4a [Source... [more]
map2k4a7.764e-8641.57mitogen-activated protein kinase kinase 4a [Source... [more]
map2k4b1.211e-8446.69mitogen-activated protein kinase kinase 4b [Source... [more]
back to top
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map2k68.807e-9043.57mitogen-activated protein kinase kinase 6 [Source:... [more]
map2k66.469e-8945.40mitogen-activated protein kinase kinase 6 [Source:... [more]
map2k67.097e-8943.31mitogen-activated protein kinase kinase 6 [Source:... [more]
map2k64.212e-8843.66mitogen-activated protein kinase kinase 6 [Source:... [more]
map2k61.812e-8749.63mitogen-activated protein kinase kinase 6 [Source:... [more]
back to top
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map2k61.071e-8942.86mitogen-activated protein kinase kinase 6 [Source:... [more]
Map2k34.708e-8744.00mitogen-activated protein kinase kinase 3 [Source:... [more]
Map2k42.951e-8645.27mitogen-activated protein kinase kinase 4 [Source:... [more]
Map2k61.225e-8244.59mitogen-activated protein kinase kinase 6 [Source:... [more]
Map2k72.860e-6538.51mitogen-activated protein kinase kinase 7 [Source:... [more]
back to top
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P52564|MP2K6_HUMAN1.752e-8943.15Dual specificity mitogen-activated protein kinase ... [more]
sp|Q5E9X2|MP2K6_BOVIN2.499e-8943.40Dual specificity mitogen-activated protein kinase ... [more]
sp|P70236|MP2K6_MOUSE7.491e-8942.86Dual specificity mitogen-activated protein kinase ... [more]
sp|Q9DGE0|MP2K6_DANRE2.406e-8745.08Dual specificity mitogen-activated protein kinase ... [more]
sp|O09110|MP2K3_MOUSE3.293e-8644.00Dual specificity mitogen-activated protein kinase ... [more]
back to top
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PTZ85.005e-10648.98Dual specificity mitogen-activated protein kinase ... [more]
A0A158QT702.533e-9750.66Protein kinase domain-containing protein OS=Mesoce... [more]
G9I6241.658e-9648.59EgMKK1 OS=Echinococcus granulosus OX=6210 GN=MKK1 ... [more]
A0A068WTA21.676e-9648.59Dual specificity mitogen activated protein OS=Echi... [more]
A0A0R3WCQ22.695e-9648.59Protein kinase domain-containing protein OS=Taenia... [more]
back to top
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map2k4a8.355e-8645.61mitogen-activated protein kinase kinase 4 [Source:... [more]
map2k4b1.361e-8545.61dual specificity mitogen-activated protein kinase ... [more]
map2k4b6.466e-8545.61dual specificity mitogen-activated protein kinase ... [more]
map2k4b7.341e-8545.61dual specificity mitogen-activated protein kinase ... [more]
map2k61.175e-7744.70mitogen-activated protein kinase kinase 6 [Source:... [more]
back to top
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map2k61.433e-8644.30mitogen-activated protein kinase kinase 6 [Source:... [more]
map2k4b2.225e-8345.85mitogen-activated protein kinase kinase 4b [Source... [more]
map2k73.732e-6838.17mitogen-activated protein kinase kinase 7 [Source:... [more]
ENSPMAT00000004725.18.685e-4938.76pep scaffold:Pmarinus_7.0:GL477683:141377:157028:-... [more]
stk25a3.991e-2629.87serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PBS24.979e-6740.13MAP kinase kinase of the HOG signaling pathway; ac... [more]
STE71.932e-4633.22Signal transducing MAP kinase kinase; involved in ... [more]
MKK13.134e-4134.67MAPKK involved in the protein kinase C signaling p... [more]
MKK25.185e-3935.40MAPKK involved in the protein kinase C signaling p... [more]
KIC13.734e-2630.08Protein kinase of the PAK/Ste20 family, required f... [more]
back to top
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO380623.982e-8445.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484086.051e-8044.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433842.411e-6540.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455537.882e-5231.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428453.212e-4233.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP2K66.045e-9045.69dual specificity mitogen-activated protein kinase ... [more]
map2k66.329e-9043.57dual specificity mitogen-activated protein kinase ... [more]
map2k4b5.990e-8344.59dual specificity mitogen-activated protein kinase ... [more]
map2k4a6.532e-8341.49mitogen-activated protein kinase kinase 4 [Source:... [more]
map2k4a8.069e-8341.49mitogen-activated protein kinase kinase 4 [Source:... [more]
back to top
BLAST of Dual specificity mitogen-activated protein kinase kinase 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040748.10.000e+0100.00SMESG000040748.1[more]
SMESG000041446.17.788e-14658.62SMESG000041446.1[more]
SMESG000057661.11.864e-8247.53SMESG000057661.1[more]
SMESG000035167.12.990e-5738.00SMESG000035167.1[more]
SMESG000007331.14.580e-5537.94SMESG000007331.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017135 ID=SMED30017135|Name=Dual specificity mitogen-activated protein kinase kinase 6|organism=Schmidtea mediterranea sexual|type=transcript|length=1539bp
AATCAAAAAGTTACGATTTGATTTTATATTTAGATGGCATCCTCAAAAAA
GAAACCGCCTAATTTTAAAACCTTTAATTTAAAATCCGGAATAATTGAAC
CAGTTCTTATAAATGATAACCCTGTGCAGCAACTGACCGATCATACGGAA
GTTCAAGTTAATGGTGAGAAAATAACAATCTCGATGAGTGATTTGGAAAC
ACTAAACGAACTTGGAAAAGGCCAATTTGGAATTGTTGAACAAATGTTGC
ATAAACCATCCAATCTTGTATTCGCAGTAAAACAGTTACGATGTTCAAAG
GATGATAAAAAACAGGATAGAATTCTAAATGACCTCAACATAAGCATGAG
AAGTACCCAATGTCCTTACGTTGTTGTAAGCTATGGAGCAATGCATCGTG
GAGGTGACGTATGGATTTGCATGGAGATATTGGATTCCAGTTTAGACAAA
TTTTATAAACTAGTGAGTGCTATTGGTACTGAATCTTTCATTCCAGAAAT
GATGTTAGCATACATTACATTTTGCATTGTCACTGCTCTTGAATATTTGC
ATCAAGCTCTTCGTGTCATACACAGGGATGTCAAACCGAGTAATGTTTTA
ATAGACAAATCGGGTAGAGTGAAAGTTTGCGATTTTGGAATATCCGGAAC
TCTTGTCAATTCAGTTGCTCAAACAAATTTGGGAACTCAGTCATATCTTG
CTCCTGAACGAATCATTACAGAAAATAGTACCTCTGGTTTTACAATTCGC
TCTGATGTTTGGTCACTCGGACTGTCAATTCTTGAATTAGCAATTTTAAA
ATTTCCTTATCCTCTGGATATTTCTCTATACAATCTAATTACATATGTTA
CAGAAGGACCGCCTCCTTCTCTGCCAGAAAATTCAAGCTATTCCAATACG
GTCCGAAATTTTATTTCTCGATGTCTTGTTATTGCTGTTAAAGATCGTGC
TTCATATTTGGAACTTCTTAAGCATGACCTTCTAAAGTCTTTCTATACTC
AGTCATTTTTAGAAAATGTCCAGAATGAATTCGCAAATTACGTGACCTTT
ATTTTACAGAATAATTGAATACTTTTAAAAAGACAATTATTTTAAACATT
TAAAATTAACTTTAAAATGTACAATCATCGCTTTTTAAATCGTTTTTGAT
TGTCATTTAAATTTTTCACGTGCATAGACACCAACGGCTGAGTAGCGAAT
AATATTTCACAATATTCTAGAATTTAGTGTTTATTCTCTGGGGCAAGTAT
GCACAAAAGAAGTGCTCTTTCCTGAACCGGAAAAAACATCTGGTTATTCA
ATGTGCTCATCCGTCACCGCTTTCGGCACATGCTGGATTTTTCGGGTCAA
GGTGCTTCTCAAGAGCAAACGAGTATCTGAAATCTAAAGATATCAAAGAA
ATCGACTGGAGCGACCTTTGAGAGTTCATATTTAGATAGATTTTATGTAT
TTTATGTGCTATTTTATGTTTAAATGTGAATTTTGATAAATTTGTAACGT
AAAAATATTTTTAATCTAAATATAAATTAAAAAGTGTTC
back to top

protein sequence of SMED30017135-orf-1

>SMED30017135-orf-1 ID=SMED30017135-orf-1|Name=SMED30017135-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=345bp
MASSKKKPPNFKTFNLKSGIIEPVLINDNPVQQLTDHTEVQVNGEKITIS
MSDLETLNELGKGQFGIVEQMLHKPSNLVFAVKQLRCSKDDKKQDRILND
LNISMRSTQCPYVVVSYGAMHRGGDVWICMEILDSSLDKFYKLVSAIGTE
SFIPEMMLAYITFCIVTALEYLHQALRVIHRDVKPSNVLIDKSGRVKVCD
FGISGTLVNSVAQTNLGTQSYLAPERIITENSTSGFTIRSDVWSLGLSIL
ELAILKFPYPLDISLYNLITYVTEGPPPSLPENSSYSNTVRNFISRCLVI
AVKDRASYLELLKHDLLKSFYTQSFLENVQNEFANYVTFILQNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005122Uracil-DNA_glycosylase-like
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 54..317
e-value: 2.9E-58
score: 209.5
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 55..316
e-value: 1.9E-51
score: 174.9
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 54..317
score: 40.612
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 33..133
e-value: 9.1E-31
score: 107.9
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 136..334
e-value: 4.5E-45
score: 155.4
NoneNo IPR availablePANTHERPTHR44305:SF4coord: 22..318
NoneNo IPR availablePANTHERPTHR44305FAMILY NOT NAMEDcoord: 22..318
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 60..83
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 178..190
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 47..324