Tektin 3

Overview
NameTektin 3
Smed IDSMED30017127
Length (bp)1690
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tektin 3 (SMED30017127) t-SNE clustered cells

Violin plots show distribution of expression levels for Tektin 3 (SMED30017127) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tektin 3 (SMED30017127) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tektin 3 (SMED30017127) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017127

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30017127SMESG000062615.1 dd_Smed_v4_6883_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017127SMESG000062615.1 dd_Smed_v4_6883_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017127SMESG000062615.1 dd_Smed_v4_6883_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017127SMESG000062615.1 dd_Smed_v4_6883_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30017127SMESG000062615.1 dd_Smed_v4_6883_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30017127SMESG000062615.1 dd_Smed_v4_6883_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30017127SMESG000062615.1 dd_Smed_v4_6883_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017127SMESG000062615.1 Contig39185newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017127SMESG000062615.1 Contig39185uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30017127SMESG000062615.1 dd_Smed_v6_6883_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30017127SMESG000062615.1 OX_Smed_1.0.13591ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30017127SMESG000062615.1 dd_Smed_v4_6883_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30017127SMESG000062615.1 dd_Smed_v4_6883_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tektin 3 vs. Ensembl Human
Match: TEKT3 (tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293])

HSP 1 Score: 346.28 bits (887), Expect = 6.387e-113
Identity = 196/420 (46.67%), Postives = 272/420 (64.76%), Query Frame = 2
Query:  296 PDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
            P C++S R S    E   +P  + SNR   +TR+T +DW +S    Y  SN  R  SEK+R D+ RL++    +T +TQ D+T  LG RV DI   KS +  E+ E+I ETN L + K   E+ L E+E PL +++ECL++REKR GIDLVHD+ E +LL E+DTI  CQ+++   + KA  Q+  NR  QHELEKD  DK  A +ID   H   N+S  + Y  GVE ++  VS PE+W KFT  N+ RS SER AS KLR++IE  L    ++MW ++ +V+ S + RI ET+DA+NK Q HL   LQEIF  E  IE +KKAI DK A LKVAQ+RL  R  RPN+E C D+ + R++ EV E+ ++ ++L+ +LR AE TLQ+L+  K+ +E DL +K NSL+ID+EKC+ +RK+Y
Sbjct:   67 PYCTRSQRVS----ENTMLP--FVSNRTTFFTRYTPDDWYRSNLTNYQESNTSRHNSEKLRVDTSRLIQDKYQQTRKTQADTTQNLGERVNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTIQTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQEKCMSMRKSY 480          
BLAST of Tektin 3 vs. Ensembl Human
Match: TEKT3 (tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293])

HSP 1 Score: 346.28 bits (887), Expect = 6.387e-113
Identity = 196/420 (46.67%), Postives = 272/420 (64.76%), Query Frame = 2
Query:  296 PDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
            P C++S R S    E   +P  + SNR   +TR+T +DW +S    Y  SN  R  SEK+R D+ RL++    +T +TQ D+T  LG RV DI   KS +  E+ E+I ETN L + K   E+ L E+E PL +++ECL++REKR GIDLVHD+ E +LL E+DTI  CQ+++   + KA  Q+  NR  QHELEKD  DK  A +ID   H   N+S  + Y  GVE ++  VS PE+W KFT  N+ RS SER AS KLR++IE  L    ++MW ++ +V+ S + RI ET+DA+NK Q HL   LQEIF  E  IE +KKAI DK A LKVAQ+RL  R  RPN+E C D+ + R++ EV E+ ++ ++L+ +LR AE TLQ+L+  K+ +E DL +K NSL+ID+EKC+ +RK+Y
Sbjct:   67 PYCTRSQRVS----ENTMLP--FVSNRTTFFTRYTPDDWYRSNLTNYQESNTSRHNSEKLRVDTSRLIQDKYQQTRKTQADTTQNLGERVNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTIQTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQEKCMSMRKSY 480          
BLAST of Tektin 3 vs. Ensembl Human
Match: TEKT5 (tektin 5 [Source:HGNC Symbol;Acc:HGNC:26554])

HSP 1 Score: 295.049 bits (754), Expect = 4.653e-93
Identity = 173/459 (37.69%), Postives = 269/459 (58.61%), Query Frame = 2
Query:  215 SYTTVASTQNYSTNDKIKPIIIPLYKNPDCSQSLRSSL---------CEFEG---LKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
              T++ + Q     +  +P  +P Y+  +   S R SL         C  E    L+ P I  + R+AL++R++ +DW +S Q     +   R  + ++  DS+RL++  D  T Q Q+ +   LG R++DI   KS L  E+  ++ E   L   K   E    E   PL ++ ECLY+REKR GIDLVHD+ EK L++E+D +K CQ+++  + Q+ + Q+R NR+ QH LE+D  DK  A  ID+   +  N+S  +S+ +G+E I+  +S PETW KF+  N++ S + R  S +LREE E       D MW+++ + + + + RI E +D +NK Q  L   LQEIF  E  I  L+++I+ KE PLKVAQ+RL  R  RPNME C D+P+ +++ EV  I ++ ++LK +LR  + TLQ L+M K  +E +L +K N+L ID+EKC+G+RKT+
Sbjct:   20 GLTSLPAVQAPVIQECYQPYYLPGYRYLN---SWRPSLFYKIANVQTCPDESTSTLRPPTILPTLRSALFSRYSPHDWDQSNQLQVRGAEASRLWASRLTDDSMRLLQDKDQLTHQMQEGTCRNLGQRLSDIGFWKSELSYELDRLLTENQNLETVKRRLECAANEVNCPLQVALECLYHREKRIGIDLVHDNVEKNLIREVDLLKCCQEQMRKLAQRIDIQMRDNRDAQHVLERDLEDKSSAQCIDEKCFNLRNTSDCISFFHGMEKIDGTISVPETWAKFSNDNIKHSQNMRANSIQLREEAEHLFETLSDQMWRQFTDTNLAFNARISEVTDVKNKLQTQLAKTLQEIFQAENTIMLLERSIMAKEGPLKVAQTRLECRTRRPNMELCRDIPQLKLVNEVFTIDDTLQTLKLRLRETQDTLQLLVMTKCRLEHELAIKANTLCIDKEKCMGMRKTF 475          
BLAST of Tektin 3 vs. Ensembl Human
Match: TEKT1 (tektin 1 [Source:HGNC Symbol;Acc:HGNC:15534])

HSP 1 Score: 233.417 bits (594), Expect = 2.429e-70
Identity = 139/387 (35.92%), Postives = 236/387 (60.98%), Query Frame = 2
Query:  404 NDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSY-HNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSM 1561
            ++W  + +N Y  ++  R  SE++  +S RLV + +  T ++Q D   KL  R+ ++   K  LD ++ +++  T+ L+  KI  EK L   + PLHI++ CL  REKR GIDLVHD  E EL+KE + I+     ++  +++A+EQIR+NR+ ++ LEKD +DK+ AL ID +  S NN+S ++ Y  N V    N VS  E W+ F+++N++++  +R  S  L+  ++  L+Q  +D+ K+   V  +    +++T DAR+K   HL  +++EI   EKNI  L+KAI+D+E P KVA +RL  R  RPN+E C DV + R+++EV+EI ++   LK  L  A++ L+ L   +  ++ ++ +K N+++ID   C+ +RK+  +
Sbjct:   14 SEWHIANKNQYHRADAQRSRSERLVAESQRLVDEIEKTTRKSQSDVNKKLEQRLEEVQFWKKELDDKLEQLVNVTDDLLIYKIRLEKALETLKEPLHITETCLAYREKRIGIDLVHDTVEHELIKEAEIIQGIMALLTRTLEEASEQIRMNRSAKYNLEKDLKDKFVALTIDDICFSLNNNSPNIRYSENAVRIEPNSVSL-EDWLDFSSTNVEKADKQRNNSLMLKALVDRILSQTANDLRKQCDVVDTAFKNGLKDTKDARDKLADHLAKVMEEIASQEKNITALEKAILDQEGPAKVAHTRLETRTHRPNVELCRDVAQYRLMKEVQEITHNVARLKETLAQAQAELKGLHRRQLALQEEIQVKENTIYIDEVLCMQMRKSIPL 399          
BLAST of Tektin 3 vs. Ensembl Human
Match: TEKT4 (tektin 4 [Source:HGNC Symbol;Acc:HGNC:31012])

HSP 1 Score: 221.476 bits (563), Expect = 1.393e-65
Identity = 147/389 (37.79%), Postives = 210/389 (53.98%), Query Frame = 2
Query:  389 TRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
            +++ + +W ++    Y  +   R  SE+ R +S +L  +      +TQ DST  +G R+ D +  KS L  E+  +  ETNLL+  K   E+ L  +E P  I+ + L  RE+R   +LV D  E ELLKE + I+  Q+ +   I +A  QIRLNR  +   E D  DK  A  ID+     ++ S  +  H          STPET  KFT  NL R+  ER AS  LR  ++  L    +D+  +   V+ +  +R +E  DAR K   HL   L+EI D E N+  LK+AI DKEAPL VAQ+RL +R  RPNME C D  + R++ EVEE+  S  +L+ +L  AE +L+NL      +E D+   TNSLFIDR+KC+  R  Y
Sbjct:   37 SKYLLEEWFQNCYARYHQAFADRDQSERQRHESQQLATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEALAAETNLLLAQKQRLERALDATEVPFSITTDNLQCRERREHPNLVRDHVETELLKEAELIRNIQELLKRTIMQAVSQIRLNREHKETCEMDWSDKMEAYNIDETCGRHHSQSTEVQAHPYSTTFQESASTPETRAKFTQDNLCRAQRERLASANLRVLVDCILRDTSEDLRLQCDAVNLAFGRRCEELEDARYKLHHHLHKTLREITDQEHNVAALKQAIKDKEAPLHVAQTRLYLRSHRPNMELCRDAAQFRLLSEVEELNMSLTALREKLLEAEQSLRNLEDIHMSLEKDIAAMTNSLFIDRQKCMAHRTRY 425          
BLAST of Tektin 3 vs. Ensembl Celegans
Match: R02E12.4 (pep chromosome:WBcel235:X:4005314:4007634:1 gene:WBGene00019828.1 transcript:R02E12.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R02E12.4)

HSP 1 Score: 67.781 bits (164), Expect = 6.349e-12
Identity = 77/346 (22.25%), Postives = 163/346 (47.11%), Query Frame = 2
Query:  545 HKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGI-DLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQ--LAHSFNNSSASLSYHNG--VEFINNC----VSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
             +L  RV D+ +    +D E+ ++ +E + L+      +  L  +      ++ CL  R K+  + D   D  + EL KE + +     ++  + ++   Q+ +N++ +  L +D   K  A+ +D   +A   + +   +   +G  ++F        +S    W++ T +NL  +   R  SRK+ +++   + +    +  + I V   L   ++   + ++   + +    +EI + +  IE +  ++  K  PL+VA SR   R  RP +E CND  ++ + QE+  +K +  SL+NQL  A+ + + L  ++  ++  L++  ++L ID E    IR +Y
Sbjct:   37 QQLMQRVKDLKYWSGEIDRELADVKEEHDDLLRCYRRLQLCLDITGRSSRCNESCLAVRRKKVQVGDHTSDRVDMELHKEKELMTDTMKQMKEIGERVERQLEVNQSARKNLLRDLTLKQEAISLDHKSVAIGADGTKTVIRTPDGDRLDFREGAPLQRMSEYSEWIENTGNNLNYAARARVHSRKIGQKLCQSIREMAHQLRTEAIAVEALLKDSVRNWQEWKDNLHSQVNGKDKEIKNADGAIEEISFSLRQKSGPLQVALSRQNQRGLRPGIELCNDKAQHALHQELMMLKGTFLSLENQLDKAKESRKKLDNDRDKLQRKLDICDHNLTIDNEILRQIRTSY 382          
BLAST of Tektin 3 vs. Ensembl Fly
Match: CG32819 (gene:FBgn0052819 transcript:FBtr0070051)

HSP 1 Score: 290.812 bits (743), Expect = 2.320e-91
Identity = 157/421 (37.29%), Postives = 262/421 (62.23%), Query Frame = 2
Query:  338 EGLKVPDIYS--------SNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSMNTAIK 1576
            +G+  P++ +        + R ALYTR+T N+W  +    Y  SN  R +SE++R D++RL+R+ D++ +  Q D+  +LG R+TD+   ++ L++E+ ++I E + +   +    K L + E PLHI+QECL++RE R G + VHD  EK LL EI+ ++  +D++  + +K ++Q    R  QH LE D   K  +L ID + H  NN S  ++Y+ G+E  +  VST E+W + ++ +++RS +ER    +LR + +  +N     +W  W   +N+  +R QE ++A+N+ Q HL+ + QE+FDMEK++  L+KAI DK  PLKVAQ+RL  R  R  +E C D  ++R++QEV++I+ + E+L ++L  AE+T Q LL  +  +E DL  K N+LFIDREKC+ +R+++ ++  IK
Sbjct:   99 DGMIFPNLVTGFDRNPQHAARAALYTRYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFPVSNLIK 519          
BLAST of Tektin 3 vs. Ensembl Fly
Match: CG32820 (gene:FBgn0052820 transcript:FBtr0070054)

HSP 1 Score: 290.812 bits (743), Expect = 2.320e-91
Identity = 157/421 (37.29%), Postives = 262/421 (62.23%), Query Frame = 2
Query:  338 EGLKVPDIYS--------SNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSMNTAIK 1576
            +G+  P++ +        + R ALYTR+T N+W  +    Y  SN  R +SE++R D++RL+R+ D++ +  Q D+  +LG R+TD+   ++ L++E+ ++I E + +   +    K L + E PLHI+QECL++RE R G + VHD  EK LL EI+ ++  +D++  + +K ++Q    R  QH LE D   K  +L ID + H  NN S  ++Y+ G+E  +  VST E+W + ++ +++RS +ER    +LR + +  +N     +W  W   +N+  +R QE ++A+N+ Q HL+ + QE+FDMEK++  L+KAI DK  PLKVAQ+RL  R  R  +E C D  ++R++QEV++I+ + E+L ++L  AE+T Q LL  +  +E DL  K N+LFIDREKC+ +R+++ ++  IK
Sbjct:   99 DGMIFPNLVTGFDRNPQHAARAALYTRYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFPVSNLIK 519          
BLAST of Tektin 3 vs. Ensembl Fly
Match: CG17450 (gene:FBgn0040028 transcript:FBtr0345920)

HSP 1 Score: 290.812 bits (743), Expect = 2.320e-91
Identity = 157/421 (37.29%), Postives = 262/421 (62.23%), Query Frame = 2
Query:  338 EGLKVPDIYS--------SNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSMNTAIK 1576
            +G+  P++ +        + R ALYTR+T N+W  +    Y  SN  R +SE++R D++RL+R+ D++ +  Q D+  +LG R+TD+   ++ L++E+ ++I E + +   +    K L + E PLHI+QECL++RE R G + VHD  EK LL EI+ ++  +D++  + +K ++Q    R  QH LE D   K  +L ID + H  NN S  ++Y+ G+E  +  VST E+W + ++ +++RS +ER    +LR + +  +N     +W  W   +N+  +R QE ++A+N+ Q HL+ + QE+FDMEK++  L+KAI DK  PLKVAQ+RL  R  R  +E C D  ++R++QEV++I+ + E+L ++L  AE+T Q LL  +  +E DL  K N+LFIDREKC+ +R+++ ++  IK
Sbjct:   99 DGMIFPNLVTGFDRNPQHAARAALYTRYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFPVSNLIK 519          
BLAST of Tektin 3 vs. Ensembl Fly
Match: CG17450 (gene:FBgn0040028 transcript:FBtr0070056)

HSP 1 Score: 290.812 bits (743), Expect = 2.320e-91
Identity = 157/421 (37.29%), Postives = 262/421 (62.23%), Query Frame = 2
Query:  338 EGLKVPDIYS--------SNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSMNTAIK 1576
            +G+  P++ +        + R ALYTR+T N+W  +    Y  SN  R +SE++R D++RL+R+ D++ +  Q D+  +LG R+TD+   ++ L++E+ ++I E + +   +    K L + E PLHI+QECL++RE R G + VHD  EK LL EI+ ++  +D++  + +K ++Q    R  QH LE D   K  +L ID + H  NN S  ++Y+ G+E  +  VST E+W + ++ +++RS +ER    +LR + +  +N     +W  W   +N+  +R QE ++A+N+ Q HL+ + QE+FDMEK++  L+KAI DK  PLKVAQ+RL  R  R  +E C D  ++R++QEV++I+ + E+L ++L  AE+T Q LL  +  +E DL  K N+LFIDREKC+ +R+++ ++  IK
Sbjct:   99 DGMIFPNLVTGFDRNPQHAARAALYTRYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFPVSNLIK 519          
BLAST of Tektin 3 vs. Ensembl Fly
Match: CG32819 (gene:FBgn0052819 transcript:FBtr0070050)

HSP 1 Score: 290.041 bits (741), Expect = 3.540e-90
Identity = 157/421 (37.29%), Postives = 262/421 (62.23%), Query Frame = 2
Query:  338 EGLKVPDIYS--------SNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSMNTAIK 1576
            +G+  P++ +        + R ALYTR+T N+W  +    Y  SN  R +SE++R D++RL+R+ D++ +  Q D+  +LG R+TD+   ++ L++E+ ++I E + +   +    K L + E PLHI+QECL++RE R G + VHD  EK LL EI+ ++  +D++  + +K ++Q    R  QH LE D   K  +L ID + H  NN S  ++Y+ G+E  +  VST E+W + ++ +++RS +ER    +LR + +  +N     +W  W   +N+  +R QE ++A+N+ Q HL+ + QE+FDMEK++  L+KAI DK  PLKVAQ+RL  R  R  +E C D  ++R++QEV++I+ + E+L ++L  AE+T Q LL  +  +E DL  K N+LFIDREKC+ +R+++ ++  IK
Sbjct:  180 DGMIFPNLVTGFDRNPQHAARAALYTRYTSNEWYNNNMTKYSESNMNRNLSERMRNDAVRLMRETDEKATSGQRDAGRRLGERITDLTFWRNELNAELEKLIAEMSDINELQRQCGKALLDLEIPLHIAQECLFHRESRQGTEKVHDIVEKALLVEINNLRNSRDRLGGLHEKISKQALDCRGAQHLLEDDVSHKESSLGIDSMCHQLNNHSRGITYYGGIEKFDPSVSTQESWAQASSEHVRRSQAERAKLSQLRSDAQSVVNSVATTVWDFWSNTNNAFDRRSQEMAEAKNRVQLHLQKVQQELFDMEKHLFLLQKAIQDKSGPLKVAQTRLEARSHREGVELCKDHAQDRLVQEVQDIQGAVETLHHKLMEAEATHQGLLKTRCTLEVDLRNKVNALFIDREKCMSLRRSFPVSNLIK 600          
BLAST of Tektin 3 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 340.887 bits (873), Expect = 3.683e-111
Identity = 180/399 (45.11%), Postives = 264/399 (66.17%), Query Frame = 2
Query:  359 IYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
             Y SNR AL TR+   DW KS Q+ Y  S   R  +E++R D++RL++  +  T +TQD ++  +G R+ DI+  +S ++ EI  ++ E + L + K   E+ L E+E PL ++QECL++REKR  IDLVHDD E +L+KE+D IK CQ+++   +++A  Q+  NR  QHELE+D  DK  A +ID   H   N+S  +SY+ G++ ++  +S P++W KFT  N+  S SER AS KLR+EIE+ LN   ++MW ++  V+ S + RI ET+D +N  Q HL   LQEI+  E  IE LKKAI DKE PLKVAQ+RL  R  RPN+E C D P +R+I EV EI+++   L+++L  AE+TLQ L+  K  +E DL++K NSLF+D+EKC+ +RK++
Sbjct:   65 FYPSNRTALSTRYMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLRNTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMRKSF 463          
BLAST of Tektin 3 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 340.887 bits (873), Expect = 4.544e-111
Identity = 180/399 (45.11%), Postives = 264/399 (66.17%), Query Frame = 2
Query:  359 IYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
             Y SNR AL TR+   DW KS Q+ Y  S   R  +E++R D++RL++  +  T +TQD ++  +G R+ DI+  +S ++ EI  ++ E + L + K   E+ L E+E PL ++QECL++REKR  IDLVHDD E +L+KE+D IK CQ+++   +++A  Q+  NR  QHELE+D  DK  A +ID   H   N+S  +SY+ G++ ++  +S P++W KFT  N+  S SER AS KLR+EIE+ LN   ++MW ++  V+ S + RI ET+D +N  Q HL   LQEI+  E  IE LKKAI DKE PLKVAQ+RL  R  RPN+E C D P +R+I EV EI+++   L+++L  AE+TLQ L+  K  +E DL++K NSLF+D+EKC+ +RK++
Sbjct:   80 FYPSNRTALSTRYMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLRNTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMRKSF 478          
BLAST of Tektin 3 vs. Ensembl Zebrafish
Match: tekt3 (tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2])

HSP 1 Score: 340.887 bits (873), Expect = 4.544e-111
Identity = 180/399 (45.11%), Postives = 264/399 (66.17%), Query Frame = 2
Query:  359 IYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
             Y SNR AL TR+   DW KS Q+ Y  S   R  +E++R D++RL++  +  T +TQD ++  +G R+ DI+  +S ++ EI  ++ E + L + K   E+ L E+E PL ++QECL++REKR  IDLVHDD E +L+KE+D IK CQ+++   +++A  Q+  NR  QHELE+D  DK  A +ID   H   N+S  +SY+ G++ ++  +S P++W KFT  N+  S SER AS KLR+EIE+ LN   ++MW ++  V+ S + RI ET+D +N  Q HL   LQEI+  E  IE LKKAI DKE PLKVAQ+RL  R  RPN+E C D P +R+I EV EI+++   L+++L  AE+TLQ L+  K  +E DL++K NSLF+D+EKC+ +RK++
Sbjct:   80 FYPSNRTALSTRYMPEDWYKSNQSNYRESESSRNSAERLRRDTIRLIQDKEQLTRRTQDTTSKNIGERLNDISFWRSEINHEIDNMVTEISALSDVKRRLERALAETEGPLQVAQECLFHREKRMSIDLVHDDVEIDLIKEVDVIKSCQERMRRHLERAVAQLAANRAAQHELERDLSDKVTAQRIDDRCHHLRNTSDGISYYRGIDRLDPSISLPDSWSKFTDDNILHSQSERAASHKLRDEIEILLNATSNEMWNQFNSVNVSFTNRISETADTKNNLQTHLAKTLQEIYQTEMLIEALKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLITEVREIEDTIHKLRDRLMEAENTLQTLVKTKITLEHDLSIKANSLFLDQEKCMSMRKSF 478          
BLAST of Tektin 3 vs. Ensembl Zebrafish
Match: tekt4 (tektin 4 [Source:ZFIN;Acc:ZDB-GENE-070410-98])

HSP 1 Score: 202.601 bits (514), Expect = 1.549e-58
Identity = 144/412 (34.95%), Postives = 223/412 (54.13%), Query Frame = 2
Query:  356 DIYSSNRNALYT------RHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSMNTAI 1573
            ++Y+     L T      ++T ++W  +   +   +   R  +E +  +S  L  + D  T +TQ + T  LG R+ DI+  +S L+  I  +  ET+L I+++   EK L  +E P  I+ + L  RE+R G DLV D  E+ELLKE++ I+  Q  +   + +   QIRLNR V+H LE D  DK  A  +D     F+N S     H     + + V   E W KFT  NL+ +  E  AS+ LR   E  L +  +D+  +   V  + ++R  E S A+ + + HL  IL++I   E+NI  L++A+ DKEAPL+VAQSRL  R  RPNME C D P+  ++ E  ++ N+  +L+ QL  A+ +L +L  ++ ++E D+  KTNSL IDREKC+  R  Y   T +
Sbjct:   37 NVYAGTSTGLTTAGYRSAKYTPDEWFDNNSALLNRAAADRNQAENICHESRALKAETDAATLRTQTEGTTHLGARLQDIHLWRSELERLIERLSAETDLQISSRRRLEKALDATEIPFAIATDNLTCRERRFGPDLVKDAVEEELLKEVELIRSIQTLLKKTLDQTINQIRLNREVKHTLELDWSDKQQAYSLDDHCGRFSNRSTDTQRHPSSAVLQDQVCDEEVWRKFTVDNLRLAEREETASQALRRLTERVLQETTEDLRAQCDAVDRAFTQRCVEMSQAKTQLELHLAQILEQIGAQERNISQLQEAVHDKEAPLRVAQSRLHYRTLRPNMEQCRDQPQLSLLGEASKLSNTVSALQQQLYEAQKSLSDLEESRLNLEKDIACKTNSLLIDREKCMTHRTRYPTVTVL 448          
BLAST of Tektin 3 vs. Ensembl Zebrafish
Match: tekt1 (tektin 1 [Source:ZFIN;Acc:ZDB-GENE-041114-99])

HSP 1 Score: 194.512 bits (493), Expect = 5.702e-56
Identity = 130/392 (33.16%), Postives = 215/392 (54.85%), Query Frame = 2
Query:  392 RHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSMNT 1567
            R   ++W  + Q  Y +S   R  SEK+  +  RL+ + +    + Q D+  +L  R+ DI   +  L  +  ++++E   LI  K   EK L     P  ++ +CL  R+KR  IDLVHD+ E+ELLKE + ++     +   +++ NEQIRL R+V++ LEKD +DK+ A  ID       N+S  L+  N     +    TPE W      N+ ++  E+  S  LR  ++  L Q   DM +++     +   RI+ET  A+ + +  L  +L EI + EKN + L+ A+ +KEAPLKVAQ+RL  R  RPN+E C+D P+ +++ +++E+ N  + L   L L+ES L+ L  N+  +E ++ +KTNSL+ID   C  +R+  ++ +
Sbjct:   10 RFLPSEWKHANQEHYRSSEAGRKHSEKLTAECERLIEECNKSNKRMQHDTQKRLERRIQDIKFWRQELVQKFEQMVQEIETLIIYKSRVEKALESCSEPFQVTLQCLAERQKRVAIDLVHDEVEEELLKEKEVVEGVMVLLQRTLEQINEQIRLIRSVKYYLEKDLQDKFQAEHIDDFCSLLTNTSPDLNEGNSSFKYSGAAVTPEEWESLCNLNISKAEKEKNNSLSLRALVDSLLEQTARDMRRQYETTGRAFDLRIEETKTAKEQLENQLNELLAEIANQEKNQDALRLAVAEKEAPLKVAQTRLSTRSQRPNVELCHDPPQIQLLAQIKELTNHVQRLSEALELSESELKALAYNQLRLEEEIQVKTNSLYIDEVICHQLRQHITIQS 401          
BLAST of Tektin 3 vs. Ensembl Xenopus
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:549229])

HSP 1 Score: 362.844 bits (930), Expect = 2.177e-119
Identity = 218/492 (44.31%), Postives = 296/492 (60.16%), Query Frame = 2
Query:   89 LDTKYSSHLTGSTQF-PQISTKHNDLIRNNLLNFYPQQGSMRRSYTTVASTQNYSTNDKIKPIIIPLYKNPDCSQSLRSSLCEFEGLKVPDI--YSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
            L + Y  H    T F P IST     +  +  N +P   +M  S T       Y       P + PL K+               GL    I  + SNR AL+TR+T +DW KS Q  Y +S   R  +E++R D+ RL+++ D +T + Q D+   LG RV DI+  KS +  EI ++I ETN L   K   E+ L E+E PL +SQECLY+REKR  IDLVHDD EK+L++E+D IK CQ+K+   +QK + Q+  NR  QHELE+D  DK  AL+ID    +  NSS  + Y  GVE ++  VS PETW K++  N+ RS S+R AS KLRE+ E  L    +DMW ++  V+ + + RI ET+DA+NK Q HL   LQEIF  E  IE +KKAI DK APLKVAQ+RL  R  RPN+E C D  + R+IQEV++I N+ ++L+ +LR AE  LQ L+  KS +E DL +K NSLFID+EKC+G+RK++
Sbjct:    8 LTSTYGRHRPTPTNFLPAIST-----MSASYRNRFPHY-TMSHSLTLPWRPSTYYKVASANPSLAPLSKSS-------------PGLNPSQILSFPSNRTALFTRYTPDDWYKSNQVNYRDSESSRRSAERLRVDTSRLIQEKDQKTRKVQSDTNKDLGERVNDISFWKSEIIHEIDQMIGETNALSEMKRRMERALMETEGPLQVSQECLYHREKRMSIDLVHDDVEKQLIQEVDCIKSCQEKMRRHLQKISAQLASNRAAQHELERDISDKQTALRIDDKCQNLRNSSDGIGYFRGVERMDATVSIPETWAKYSDDNILRSQSDRVASTKLREDAETILASTSNDMWGQFNAVNVNFTSRISETADAKNKLQNHLAKTLQEIFQTEMTIEAIKKAIKDKSAPLKVAQTRLDERTRRPNVELCRDSVQMRLIQEVQDIDNTIQALQLRLREAEDALQMLIHTKSILEHDLAIKANSLFIDQEKCMGMRKSF 480          
BLAST of Tektin 3 vs. Ensembl Xenopus
Match: gdf10 (growth differentiation factor 10 [Source:Xenbase;Acc:XB-GENE-5998698])

HSP 1 Score: 245.743 bits (626), Expect = 2.944e-75
Identity = 148/388 (38.14%), Postives = 228/388 (58.76%), Query Frame = 2
Query:  407 DWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYH-NGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSMNT 1567
            +W  + +  Y  +   R  SE++  +S RLV + +  T  +Q D   KL  R+ +I   K  LDS++ + + +   L+  KI  EK L   + PL I+Q+CL  REKR GIDLVHD+ E+EL+KE++ I+     +   I++  EQIR++R+ ++ LEKD +DK+ ALKID       N+S  + Y  N V    N V TP  W  +T +N+ ++  +R  +  LR  I+  L++   D+ K+    + +L  RIQET DA+NK + HL  ++ EI   EKNIE LKKA+ DKE P+K+AQ+RL  R  RPN+E C D  + R+I EV+EI  + E L+  L  AE+ L+ L  N+  +E ++ +K NS++ID   C+ +R+  S+N 
Sbjct:   15 EWNIANKTCYARAESQRSRSERLVAESQRLVDEIEKTTQNSQKDVNKKLDQRLEEIQFWKKELDSKLEDTVNDIAQLLAYKIRLEKALESCKEPLSIAQQCLIEREKRVGIDLVHDEAERELIKEVEVIQGVMTLLERTIEQITEQIRMSRSAKYSLEKDLKDKFQALKIDNHCAGLTNNSPDIDYSANTVRIEANSV-TPIEWENYTNTNILKAEKQRNNAIALRSLIDGILSETASDICKQCDTATYALKNRIQETKDAKNKLEEHLAKVMDEISSQEKNIEILKKALADKEGPMKMAQTRLDTRTLRPNVELCRDPVQYRLINEVQEITTNVERLRETLAQAEAELKALNRNQLSLEEEIQVKENSIYIDEVICMQMREAISINA 401          
BLAST of Tektin 3 vs. Ensembl Xenopus
Match: plcd1 (phospholipase C delta 1 [Source:Xenbase;Acc:XB-GENE-1013054])

HSP 1 Score: 222.246 bits (565), Expect = 1.187e-65
Identity = 140/367 (38.15%), Postives = 211/367 (57.49%), Query Frame = 2
Query:  455 RGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
            R  SE  R ++ +LV + + R  ++Q D T  LG R+ DI+  KS L  EI ++  ET LL+  K   E+ L  ++ P  I+ + L  R++R G +LV D+ E ELLKE+D I+  Q+ +   + +  +QIR NR+ +  LE D  DK  A + D     +NN S  + +H       +  STPE+W ++T  N+ ++  ER AS  LR  I+  L    +D+  +   ++    KR +E  DA+ K + HLK  L+EI   EKNI  LK+AI DK  PLKVAQ+RL  R  RPN+E C D  + R++ EV E+ +S ++LK +L  +E +L+NL   +  +E D+  K NS+FIDREKC+ +R  Y
Sbjct:   84 RDQSETGRHEAKQLVTETEARAQRSQADCTKSLGERLLDIHFWKSELAREIRDVEAETQLLVQQKGRLERALDATDIPFSIATDNLKCRDRRRGSELVRDEVELELLKEVDLIRNVQELLKRTLDQTVQQIRQNRDAKENLEMDYSDKVEAYEFDDKCGRYNNQSTDIQFHRNSSKYEDNTSTPESWAQYTHENIYKAERERMASINLRSLIDSILQDISEDLEAQSAAIAVDFEKRCREVEDAKQKLEMHLKKTLEEIGGQEKNIAALKQAINDKSPPLKVAQTRLHDRSYRPNVELCRDHVQIRLVSEVGELTDSLDALKLKLEDSEQSLRNLEDTRMSLEKDIANKANSIFIDREKCMTLRTRY 450          
BLAST of Tektin 3 vs. Ensembl Xenopus
Match: tekt2 (tektin 2 (testicular) [Source:NCBI gene;Acc:493269])

HSP 1 Score: 159.073 bits (401), Expect = 1.782e-42
Identity = 118/391 (30.18%), Postives = 198/391 (50.64%), Query Frame = 2
Query:  389 TRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSM 1561
            +R +V DW  +A  +  N+ R R  S ++R ++  L      R   +      +  N   ++   +  LD  + E+  E N L   K  AE+ L     PL ++ EC  +RE R  IDLV D  E EL KE++ I+  +  +   I +A EQ+ L +  +H+L  D R K   ++IDQ   S   +S ++S       + N  +TP+ W +F+  + +R+ +E   S +LRE I L + Q  ++   + + V  +  KRI E   A  +     KN  +EI +ME +I +L + + +K+  LK+A +RL  RL RPN+E C D  +  +  EV +I+ +  +LK +L  +++ L  L  + + +E D   K NSL +D  KCL  R+  ++
Sbjct:   10 SRFSVTDWQTNAALISTNAERQRISSHQIRQEARAL------RNETSNQTKWDEQDNSTREVEKWRQVLDKCLSEVDAEINALTQIKDEAEQALQAKNIPLDVAIECFTHRESRREIDLVKDPVEDELHKEVEVIEGVRRALQQKISEAFEQLCLLQEARHQLNFDQRSKTDTVEIDQTCLSLTKNSPNISLKVDPARVLNGTTTPQEWEQFSRYSKERAEAEVRTSGRLRESIALTIAQTNNECEAQRVAVEFAFRKRIHEFERALAELNWQEKNTKEEIEEMEGDIRHLDEDLREKKGSLKLAHTRLETRLHRPNVELCRDQVQYGLTDEVRQIEGTIAALKEKLSQSQNALDALYKHLARIEEDTKWKQNSLILDN-KCLDTRRKLTL 393          
BLAST of Tektin 3 vs. Ensembl Xenopus
Match: fam168a (family with sequence similarity 168 member A [Source:Xenbase;Acc:XB-GENE-5856038])

HSP 1 Score: 151.754 bits (382), Expect = 6.452e-41
Identity = 114/336 (33.93%), Postives = 175/336 (52.08%), Query Frame = 2
Query:  413 IKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNR-NVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYH-NGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTES 1414
            +K+ + +  N + +R V+E     S RLV + +  T ++Q D   KL  R+ +I   K  LDS++ + + +   L+  K   EK L   + PL ++Q+CL  +EKR GIDLVHD+ E+EL+K +D I+     + Y           NR N ++ LEKD +DK+ ALKID       N+S  + Y  N V    N V TP  W  FT +N+ ++   R  +  LR  I+  L++   D++                   A+NK + HL  ++ EI   EKNIE LKKA+ DKE P+K+ Q RL  R  RPN+E   ++  N +I ++E +  + ES
Sbjct:    5 VKAPEKILNNPD-LRLVAE-----SQRLVDESEKTTQKSQKDFNKKLDQRLEEIQFWKE-LDSKLEDTVNDIAQLLACKFRLEKSLERCKEPLSLAQQCLIKQEKRVGIDLVHDEAEQELIKAVDVIQGVMTLLEY-----------NRTNSKYSLEKDLKDKFQALKIDNHCAGLTNNSPDIGYSANTVRIEANSV-TPIEWEDFTNTNIVKAEKRRNNAVALRSLIDGILSETASDIY-------------------AKNKLEEHLAKVISEISSQEKNIEILKKALADKEGPMKMEQIRLDTRTLRPNVELFQEITTNALISDLEVVLGNWES 302          
BLAST of Tektin 3 vs. Ensembl Mouse
Match: Tekt3 (tektin 3 [Source:MGI Symbol;Acc:MGI:1918312])

HSP 1 Score: 338.191 bits (866), Expect = 6.524e-110
Identity = 192/420 (45.71%), Postives = 268/420 (63.81%), Query Frame = 2
Query:  296 PDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
            P  S+S R  +CE   L     + SNR   +TR+T +DW +S    +  SN  R  SE++R D+ RL++    +  +TQ  ST  LG RV D+   KS +  E+ E+I ETN L + K   E+ L E+E PL +S+ECL++REKR GIDLVHD+ EKELL E+DTI  CQ+++   + KAN Q+  +R+ QHELEKD  DK  AL+ID       N+S  +SY  GVE ++  VS PETW KFT  N+ RS SER AS KLREE E  L    ++MW ++ +V+ + + RI ET DA+NK   HL   LQEIF +E  IE +KKAI +K A LKVAQ+RL  R  RPN+E C D+ + R++ EV E+  + ++L+ +LR +E TLQ+L   K+ +E DL +K N+L+ID+EKC+ +R +Y
Sbjct:   67 PYSSRSQR--VCESTMLP----FVSNRTTFFTRYTPDDWYRSNLVSFQESNSSRHNSERLRVDTSRLIQDKYQQIRKTQAHSTQNLGERVNDLAFWKSEITHELDEMIGETNALTDIKRRLERGLIETEGPLQVSRECLFHREKRMGIDLVHDEAEKELLAEVDTILCCQERMRQHLDKANAQLASDRSAQHELEKDLSDKQAALRIDDKCQHLRNTSEGVSYFRGVERVDATVSVPETWAKFTDDNVLRSQSERAASAKLREETENLLIVTANEMWNQFNKVNLAFTNRIAETVDAKNKIHTHLTKTLQEIFQIEMTIESIKKAIKEKSAFLKVAQTRLDERTRRPNVELCRDMAQLRLVNEVYEVDETIQTLQQRLRDSEDTLQSLAHTKATLEHDLAVKANTLYIDQEKCMSMRNSY 480          
BLAST of Tektin 3 vs. Ensembl Mouse
Match: Tekt5 (tektin 5 [Source:MGI Symbol;Acc:MGI:1917676])

HSP 1 Score: 293.893 bits (751), Expect = 6.027e-92
Identity = 163/403 (40.45%), Postives = 248/403 (61.54%), Query Frame = 2
Query:  347 KVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
            + P I  S R+AL+ R+T  DW +S      N+   R  + ++ GDSLR+++  D    Q Q+ ++  LG R++D+   KS L  E+  ++ E + +   K   E    E   PL ++ ECLYNREKR GIDLVHD+ EK L++E+D +K CQD++  + ++ + QIR NR+ QH LE+D  DK  A  ID+   +  ++S S+S+ +GVE  +  VS PETW KF+  N++ + + R  S +LREE E       D MWK++   + + + RI E +D +NK Q  L  ILQEIF  E  I  L++AI+ KE PLK+AQ+ L  R  RPN+E C DVP+ R++ EV  I ++ ++LK +LR  + TLQ L+M KS +E +L +K N+L ID++KC+ +RK++
Sbjct:   74 RPPTILPSLRSALFCRYTPRDWDRSNDLQIRNAEASRLWASRLTGDSLRIMQDKDQLIHQMQEGTSRNLGQRLSDLGFWKSELCYELDRLLTENSSMDTLKRRLECAAEEVNCPLQVALECLYNREKRIGIDLVHDNVEKNLIREVDLLKCCQDQMRKLAKRIDFQIRDNRDAQHSLERDIEDKSSAQYIDENCFNLRSTSDSISFFHGVEKFDGTVSIPETWAKFSNDNIRHAQNMRANSIRLREEAEHLFETLSDQMWKQFTNTNLAFNARISEETDVKNKLQTQLAKILQEIFQAENTIMLLERAIVAKEYPLKMAQTMLACRTRRPNVELCRDVPQFRLVNEVFTIDDTLQTLKLRLRETQDTLQLLVMTKSRLEHELAIKANTLCIDKDKCMSMRKSF 476          
BLAST of Tektin 3 vs. Ensembl Mouse
Match: Tekt5 (tektin 5 [Source:MGI Symbol;Acc:MGI:1917676])

HSP 1 Score: 243.817 bits (621), Expect = 1.642e-74
Identity = 138/342 (40.35%), Postives = 204/342 (59.65%), Query Frame = 2
Query:  347 KVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNR 1372
            + P I  S R+AL+ R+T  DW +S      N+   R  + ++ GDSLR+++  D    Q Q+ ++  LG R++D+   KS L  E+  ++ E + +   K   E    E   PL ++ ECLYNREKR GIDLVHD+ EK L++E+D +K CQD++  + ++ + QIR NR+ QH LE+D  DK  A  ID+   +  ++S S+S+ +GVE  +  VS PETW KF+  N++ + + R  S +LREE E       D MWK++   + + + RI E +D +NK Q  L  ILQEIF  E  I  L++AI+ KE PLK+AQ+ L  R  RPN+E C DVP+ R
Sbjct:   74 RPPTILPSLRSALFCRYTPRDWDRSNDLQIRNAEASRLWASRLTGDSLRIMQDKDQLIHQMQEGTSRNLGQRLSDLGFWKSELCYELDRLLTENSSMDTLKRRLECAAEEVNCPLQVALECLYNREKRIGIDLVHDNVEKNLIREVDLLKCCQDQMRKLAKRIDFQIRDNRDAQHSLERDIEDKSSAQYIDENCFNLRSTSDSISFFHGVEKFDGTVSIPETWAKFSNDNIRHAQNMRANSIRLREEAEHLFETLSDQMWKQFTNTNLAFNARISEETDVKNKLQTQLAKILQEIFQAENTIMLLERAIVAKEYPLKMAQTMLACRTRRPNVELCRDVPQFR 415          
BLAST of Tektin 3 vs. Ensembl Mouse
Match: Tekt4 (tektin 4 [Source:MGI Symbol;Acc:MGI:1919090])

HSP 1 Score: 229.565 bits (584), Expect = 1.248e-68
Identity = 153/394 (38.83%), Postives = 221/394 (56.09%), Query Frame = 2
Query:  374 RNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
            R A Y R   ++W +++   Y  +   R  SE+ R +S +LV +      +TQ DST K+G R+ D++  KS L  EI E+  ET+L++  K+  ++ L  +  P  I+ + L  RE+R   DLV D  E ELLKE + I+  Q+ +   I +A +QIRLNR  +   E +  DK     ID     + N S  + ++          STPETW KF   NL R+  ER AS  LR+ I+  L    +D+  +   V+++ S R QE  D+  K Q HL+  L EI D E  I  LK+AI DKEAPL+VAQ+RL  R  RPN+E C D  + R++ EVEE+  S  +LK +L+ AE  L+NL  ++  +E D+ +KTNSLFIDR+KC+  R  Y
Sbjct:   47 RTAKYLR---DEWFQNSYARYHQAFADRDYSERQRHESGQLVAETGALAQRTQLDSTRKVGERLEDMHCWKSELQREIDELSSETDLMMAQKLRLQRALDATSVPYSIATDNLQCRERRQHPDLVRDYVEVELLKETELIRNIQELLKRTIGQAVDQIRLNREHKESCEMNWSDKVEVYNIDDTCSRYTNESTQVQFYPHSSKFEESASTPETWAKFNHDNLLRAERERLASVNLRKLIDCILRDTAEDLRLQCDAVNSAFSSRCQELDDSLQKLQYHLRKTLTEITDQEHQIAALKQAIKDKEAPLRVAQTRLYQRSHRPNVELCRDNAQFRLLSEVEELNMSLRALKEKLQDAEQALRNLEDSRMSLEKDIAVKTNSLFIDRQKCMTHRNRY 437          
BLAST of Tektin 3 vs. Ensembl Mouse
Match: Tekt1 (tektin 1 [Source:MGI Symbol;Acc:MGI:1333819])

HSP 1 Score: 220.705 bits (561), Expect = 1.193e-65
Identity = 131/387 (33.85%), Postives = 228/387 (58.91%), Query Frame = 2
Query:  392 RHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKT 1552
            R    +W  + ++ Y  +   R  SE++  +S RLV + +  T ++Q D   KL  R+ ++   K  LD ++ +++ +T+ L+  K   E+ L   + PLHI+++CL  REKR GIDLVHD  E+EL KE D I    + +   ++++ EQIRLNR+ ++ LEKD RDK+ A+ ID +  S NN+S ++++   V  I     + E W+ F+ +N++++  +   S  L+  ++  L+Q  +D+ ++   V  +    ++ET DARNK   HL  +++EI   EKNI  L+ AI  +E P KVA +RL  R  RPN+E C D+ + R+I+E++EI ++   LK  L  A++ L+ L   +  ++ ++ +K N+++ID+  C+ +RK+
Sbjct:   10 RFLPEEWYIANKSQYHRAEAQRSQSERLVAESQRLVEEIEKTTRKSQSDVNKKLEQRLEEVRFWKKELDDKLEQLVNQTDDLLTYKTRLERSLESYKEPLHITEKCLEYREKRVGIDLVHDVVEQELQKEADIIHGVMNLLIRTLEESTEQIRLNRSAKYNLEKDLRDKFTAITIDDVCFSLNNNSPNINFSEKVVRIEPNSVSLEDWLDFSNANVEKADKQLNNSTALKTLVDQILSQTANDLRRQCEVVDEAFINGLKETKDARNKLADHLAKVMEEIASQEKNIMALENAITQQEGPAKVAHTRLETRTHRPNVELCRDIAQYRLIKEIQEINHNVARLKETLAQAQTQLKALYRRQLALQEEIQVKENTIYIDQVLCMEMRKS 396          
BLAST of Tektin 3 vs. UniProt/SwissProt
Match: sp|Q9BXF9|TEKT3_HUMAN (Tektin-3 OS=Homo sapiens OX=9606 GN=TEKT3 PE=1 SV=1)

HSP 1 Score: 346.28 bits (887), Expect = 3.067e-112
Identity = 196/420 (46.67%), Postives = 272/420 (64.76%), Query Frame = 2
Query:  296 PDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
            P C++S R S    E   +P  + SNR   +TR+T +DW +S    Y  SN  R  SEK+R D+ RL++    +T +TQ D+T  LG RV DI   KS +  E+ E+I ETN L + K   E+ L E+E PL +++ECL++REKR GIDLVHD+ E +LL E+DTI  CQ+++   + KA  Q+  NR  QHELEKD  DK  A +ID   H   N+S  + Y  GVE ++  VS PE+W KFT  N+ RS SER AS KLR++IE  L    ++MW ++ +V+ S + RI ET+DA+NK Q HL   LQEIF  E  IE +KKAI DK A LKVAQ+RL  R  RPN+E C D+ + R++ EV E+ ++ ++L+ +LR AE TLQ+L+  K+ +E DL +K NSL+ID+EKC+ +RK+Y
Sbjct:   67 PYCTRSQRVS----ENTMLP--FVSNRTTFFTRYTPDDWYRSNLTNYQESNTSRHNSEKLRVDTSRLIQDKYQQTRKTQADTTQNLGERVNDIGFWKSEIIHELDEMIGETNALTDVKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEAQLLTEVDTILCCQERMKLHLDKAIAQLAANRASQHELEKDLSDKQTAYRIDDKCHHLRNTSDGVGYFRGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIENLLVVTANEMWNQFNKVNLSFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIKDKTAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVHEVDDTIQTLQQRLRDAEDTLQSLVHIKATLEYDLAVKANSLYIDQEKCMSMRKSY 480          
BLAST of Tektin 3 vs. UniProt/SwissProt
Match: sp|A6H782|TEKT3_BOVIN (Tektin-3 OS=Bos taurus OX=9913 GN=TEKT3 PE=1 SV=1)

HSP 1 Score: 344.354 bits (882), Expect = 2.061e-111
Identity = 192/421 (45.61%), Postives = 276/421 (65.56%), Query Frame = 2
Query:  293 NPDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
            +P C++S R S    E   +P  + SNR  L+TR+T +DW +S    +  SN  R  SE++R D+ RL++    +T +TQ DST  LG RV DI   KS +  E+  +I ETN L + K   E+ L E+E PL +++ECL++REKR GIDLVHD+ EKELL E+DTI  CQ+++   + KA  Q+  NR  QHELEKD  DK  A +ID   H   N+S  +SY +GVE ++  VS PE+W KFT  N+ RS SER AS KLR++I+  L    ++MW ++ +V+ + + RI ET+DA+NK Q HL   LQEIF  E  IE +KKAI++K A LKVAQ+RL  R  RPN+E C D+ + R++ EV E+ ++ ++L+ +LR AE TLQ+L   K+ +E DL +K NSL+ID++KC+ +R+++
Sbjct:   66 DPYCTRSQRVS----ESTMLP--FVSNRTTLFTRYTPDDWYRSNLTNFQESNTSRHNSERLRVDTSRLIQDKYQQTRKTQADSTQNLGERVNDIGFWKSEIIHELDAMIGETNELTDIKKRLERALMETEAPLQVARECLFHREKRMGIDLVHDEVEKELLTEVDTILCCQERMKLYLDKAIAQLAANRAAQHELEKDLSDKQSAYRIDDKCHHLRNTSDGVSYFHGVERVDATVSVPESWAKFTDDNILRSQSERAASAKLRDDIQNVLVVTANEMWNQFNKVNLAFTNRIAETADAKNKIQTHLAKTLQEIFQTEMTIESIKKAIVEKSAFLKVAQTRLDERTRRPNIELCRDMAQLRLVNEVYEVDDTIQTLQQRLRDAEDTLQSLAHTKATLEHDLAVKANSLYIDQDKCMSMRRSF 480          
BLAST of Tektin 3 vs. UniProt/SwissProt
Match: sp|Q6X6Z7|TEKT3_MOUSE (Tektin-3 OS=Mus musculus OX=10090 GN=Tekt3 PE=2 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 4.563e-109
Identity = 192/420 (45.71%), Postives = 268/420 (63.81%), Query Frame = 2
Query:  296 PDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
            P  S+S R  +CE   L     + SNR   +TR+T +DW +S    +  SN  R  SE++R D+ RL++    +  +TQ  ST  LG RV D+   KS +  E+ E+I ETN L + K   E+ L E+E PL +S+ECL++REKR GIDLVHD+ EKELL E+DTI  CQ+++   + KAN Q+  +R+ QHELEKD  DK  AL+ID       N+S  +SY  GVE ++  VS PETW KFT  N+ RS SER AS KLREE E  L    ++MW ++ +V+ + + RI ET DA+NK   HL   LQEIF +E  IE +KKAI +K A LKVAQ+RL  R  RPN+E C D+ + R++ EV E+  + ++L+ +LR +E TLQ+L   K+ +E DL +K N+L+ID+EKC+ +R +Y
Sbjct:   67 PYSSRSQR--VCESTMLP----FVSNRTTFFTRYTPDDWYRSNLVSFQESNSSRHNSERLRVDTSRLIQDKYQQIRKTQAHSTQNLGERVNDLAFWKSEITHELDEMIGETNALTDIKRRLERGLIETEGPLQVSRECLFHREKRMGIDLVHDEAEKELLAEVDTILCCQERMRQHLDKANAQLASDRSAQHELEKDLSDKQAALRIDDKCQHLRNTSEGVSYFRGVERVDATVSVPETWAKFTDDNVLRSQSERAASAKLREETENLLIVTANEMWNQFNKVNLAFTNRIAETVDAKNKIHTHLTKTLQEIFQIEMTIESIKKAIKEKSAFLKVAQTRLDERTRRPNVELCRDMAQLRLVNEVYEVDETIQTLQQRLRDSEDTLQSLAHTKATLEHDLAVKANTLYIDQEKCMSMRNSY 480          
BLAST of Tektin 3 vs. UniProt/SwissProt
Match: sp|Q4V8G8|TEKT3_RAT (Tektin-3 OS=Rattus norvegicus OX=10116 GN=Tekt3 PE=1 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 3.483e-105
Identity = 200/497 (40.24%), Postives = 289/497 (58.15%), Query Frame = 2
Query:  104 SSHLTGSTQFPQISTKHNDLIRNNLLNFYPQQGSMRRSYTTVASTQNYSTNDKIK-------------PIIIPLYKNPDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
             S LT +   PQ +            NF P  G++  SY      +N + +  +              P + PL        S   S+CE   L     + SNR  L+TR+T +DW +S    +  SN  R  SE++R D+ RL++    +  +TQ DST  LG RV DI   KS +  E+ E+I ETN L + K   E+ L E++ PL +++ECL++REKR GIDLVHD+ EKELL E++T+  CQ+++   + KA  Q+  +R+ QHELEKD  DK  AL+ID       N+S  +SY  GVE ++  VS PE+W KFT  N+ RS SER AS KLRE+ E  L    ++MW ++ +V+ + + RI ET DA+NK   HL   LQEIF  E  IE ++KAI +K A LKVAQ+RL  R  RPN+E C D+ + R++ EV E+  + ++L+ +LR +E TLQ+L   K+ +E DL +K N+L+ID+EKC+ +R +Y
Sbjct:    5 GSTLTATYAHPQPAAT----------NFLPAIGTLTSSYRNRFPHRNLTHSLSLPWRPSTYYKTAYNYPTLAPL-------SSTSQSVCESTMLP----FVSNRTTLFTRYTPDDWYRSTLVGFQESNCSRHNSERLRVDTSRLIQDKYQQIRKTQADSTQNLGERVNDIAFWKSEIIHELDEMIGETNALTDIKRRLERGLIETDAPLQVARECLFHREKRMGIDLVHDEAEKELLTEVETVLCCQERMRRHLDKAIAQLASDRSAQHELEKDLSDKQAALRIDDKCKHLRNTSQGVSYFRGVENVDATVSVPESWAKFTDDNVLRSQSERAASAKLREDTENLLIVIANEMWNQFNKVNVAFTNRIAETVDAKNKIHIHLSKTLQEIFQTEMAIESIRKAIKEKSAFLKVAQTRLDERTRRPNIELCRDIAQLRLVNEVYEVDETIQTLQQRLRDSEDTLQSLAHTKATLEHDLAVKANTLYIDQEKCMSMRNSY 480          
BLAST of Tektin 3 vs. UniProt/SwissProt
Match: sp|Q96M29|TEKT5_HUMAN (Tektin-5 OS=Homo sapiens OX=9606 GN=TEKT5 PE=1 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 2.234e-92
Identity = 173/459 (37.69%), Postives = 269/459 (58.61%), Query Frame = 2
Query:  215 SYTTVASTQNYSTNDKIKPIIIPLYKNPDCSQSLRSSL---------CEFEG---LKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
              T++ + Q     +  +P  +P Y+  +   S R SL         C  E    L+ P I  + R+AL++R++ +DW +S Q     +   R  + ++  DS+RL++  D  T Q Q+ +   LG R++DI   KS L  E+  ++ E   L   K   E    E   PL ++ ECLY+REKR GIDLVHD+ EK L++E+D +K CQ+++  + Q+ + Q+R NR+ QH LE+D  DK  A  ID+   +  N+S  +S+ +G+E I+  +S PETW KF+  N++ S + R  S +LREE E       D MW+++ + + + + RI E +D +NK Q  L   LQEIF  E  I  L+++I+ KE PLKVAQ+RL  R  RPNME C D+P+ +++ EV  I ++ ++LK +LR  + TLQ L+M K  +E +L +K N+L ID+EKC+G+RKT+
Sbjct:   20 GLTSLPAVQAPVIQECYQPYYLPGYRYLN---SWRPSLFYKIANVQTCPDESTSTLRPPTILPTLRSALFSRYSPHDWDQSNQLQVRGAEASRLWASRLTDDSMRLLQDKDQLTHQMQEGTCRNLGQRLSDIGFWKSELSYELDRLLTENQNLETVKRRLECAANEVNCPLQVALECLYHREKRIGIDLVHDNVEKNLIREVDLLKCCQEQMRKLAQRIDIQMRDNRDAQHVLERDLEDKSSAQCIDEKCFNLRNTSDCISFFHGMEKIDGTISVPETWAKFSNDNIKHSQNMRANSIQLREEAEHLFETLSDQMWRQFTDTNLAFNARISEVTDVKNKLQTQLAKTLQEIFQAENTIMLLERSIMAKEGPLKVAQTRLECRTRRPNMELCRDIPQLKLVNEVFTIDDTLQTLKLRLRETQDTLQLLVMTKCRLEHELAIKANTLCIDKEKCMGMRKTF 475          
BLAST of Tektin 3 vs. TrEMBL
Match: A0A267GV76 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003606g3 PE=4 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 6.609e-158
Identity = 244/505 (48.32%), Postives = 343/505 (67.92%), Query Frame = 2
Query:   50 MDFLTHSRNFSVDLDTKYSSHLTGSTQFPQISTKHNDLIRNNLLNFYPQQGSMRRSYTTVA-STQNYSTNDKIKPIIIPLYKNPDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSM 1561
            M++L H++  S     + +     +   P +  +          +  P    +RRS T++      Y    K+ P    L ++     S R++L E EG+KVP ++S+ RNALYTR+T NDW+ +  + Y  S+R+RG +E++R D+LRL R+ +DRT + Q++S  +LG RVTDIN  K+ L  E   ++ E + L  AK +AEK L E+ENPLH++QECLYNREKR GIDLVHD  EK+LL+E+D IK+CQDKI  VI KAN Q+ LNR  QHELEKDT DK+ A  +D+  H   N+S  +++HNG+E ++  +S PETW KF+  N+QRS +ER AS+ LR E++  LN C +DMWK++  V+ +LS+R+QE +DARNK Q HL  +LQE+FDMEKNIE+LKK+I DKEAP +VAQ+RL  R+ RPN+E C D  ++R++ EV+EI+ + E L+ +LR AE+ LQ+LL  KS +E DL++K NSLFIDREKCLGIRKT+ M
Sbjct:    1 MEYLGHTQTASYTTGPRTAQ---SACFLPAVGAQKT-------FDTMPGPSPLRRSLTSLPWRPSTYYQTAKVSPTTA-LMQSQSGPLSARANLAELEGIKVPPVFSAARNALYTRYTPNDWMSANLSNYSVSDRVRGNAERIRYDTLRLCREGEDRTKRAQEESGKRLGERVTDINFWKTELQHETDNMVTEISSLQEAKRIAEKALGETENPLHVAQECLYNREKRQGIDLVHDLVEKDLLREVDVIKQCQDKIRAVIDKANVQLNLNRAAQHELEKDTADKFSAQHLDEKCHGLRNASGGIAFHNGIEQLDRTLSVPETWAKFSNENIQRSQAERAASKNLRAELDKVLNDCANDMWKQFNCVNTALSERVQECTDARNKLQTHLGKVLQEVFDMEKNIEFLKKSIKDKEAPYQVAQTRLETRIHRPNVELCRDPAQHRLVSEVQEIRETVEQLQAKLREAENALQHLLKTKSALEHDLSVKNNSLFIDREKCLGIRKTFPM 494          
BLAST of Tektin 3 vs. TrEMBL
Match: A0A1I8GB64 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007106g1 PE=4 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 7.612e-158
Identity = 244/505 (48.32%), Postives = 343/505 (67.92%), Query Frame = 2
Query:   50 MDFLTHSRNFSVDLDTKYSSHLTGSTQFPQISTKHNDLIRNNLLNFYPQQGSMRRSYTTVA-STQNYSTNDKIKPIIIPLYKNPDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSM 1561
            M++L H++  S     + +     +   P +  +          +  P    +RRS T++      Y    K+ P    L ++     S R++L E EG+KVP ++S+ RNALYTR+T NDW+ +  + Y  S+R+RG +E++R D+LRL R+ +DRT + Q++S  +LG RVTDIN  K+ L  E   ++ E + L  AK +AEK L E+ENPLH++QECLYNREKR GIDLVHD  EK+LL+E+D IK+CQDKI  VI KAN Q+ LNR  QHELEKDT DK+ A  +D+  H   N+S  +++HNG+E ++  +S PETW KF+  N+QRS +ER AS+ LR E++  LN C +DMWK++  V+ +LS+R+QE +DARNK Q HL  +LQE+FDMEKNIE+LKK+I DKEAP +VAQ+RL  R+ RPN+E C D  ++R++ EV+EI+ + E L+ +LR AE+ LQ+LL  KS +E DL++K NSLFIDREKCLGIRKT+ M
Sbjct:    1 MEYLGHTQTASYTTGPRTAQ---SACFLPAVGAQKT-------FDTMPGPSPLRRSLTSLPWRPSTYYQTAKVSPTTA-LMQSQSGPLSARANLAELEGIKVPPVFSAARNALYTRYTPNDWMSANLSNYSVSDRVRGNAERIRYDTLRLCREGEDRTKRAQEESGKRLGERVTDINFWKTELQHETDNMVSEISSLQEAKRIAEKALGETENPLHVAQECLYNREKRQGIDLVHDLVEKDLLREVDVIKQCQDKIRAVIDKANVQLNLNRAAQHELEKDTADKFSAQHLDEKCHGLRNTSGGIAFHNGIEQLDRTLSVPETWAKFSNENIQRSQAERAASKNLRAELDKVLNDCANDMWKQFNCVNTALSERVQECTDARNKLQTHLDKVLQEVFDMEKNIEFLKKSIKDKEAPYQVAQTRLETRIHRPNVELCRDPAQHRLVSEVQEIRETVEQLQAKLREAENALQHLLKTKSALEHDLSVKNNSLFIDREKCLGIRKTFPM 494          
BLAST of Tektin 3 vs. TrEMBL
Match: A0A2C9JWU5 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106071165 PE=4 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 7.037e-157
Identity = 245/496 (49.40%), Postives = 335/496 (67.54%), Query Frame = 2
Query:   95 TKYSSHLTGS------TQFPQISTKHNDLIRNNLLNFYPQQGSMRRSYTTVA-STQNYSTNDKIKPIIIPLYKNPDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSM 1561
            T  SS++TG       TQ P I T  N        + YP    MRRS TT+      Y  + K+ P        PD   S R+ L E + LKVP ++++ RNALYTR T NDW+ S Q  Y  S+R+RG SE++R D++RL +++DD+T +TQ D   +LG R+ DIN  K+ L+ E+ ++I ETN L  AK + EK L E+ENPLHISQECLYNREKR  IDLVHD+PEKEL++E+D IKRCQ+++   + +AN Q+ LNR  QHELE+D+ DK+ A  +D   H   N+S  ++YH+GV  I+N +S PETW K+T  N+QRS SER AS+ +R EIE  +N C ++MW +W  V+ +L+ RIQET+D+RNK Q HL   LQE+FDMEKNIE LKK+I DKEAP++VAQ+RL  RL RPN+E C D   NR+++EV EI ++ + L+++LR +E+ LQ LL  K  +E DL++K  +LFIDREKC+ +RKT+ M
Sbjct:   27 TATSSYMTGPRQAVQFTQLPTIGTMQNQY---KTYDTYPAPSPMRRSLTTLPWRPSTYYQSAKVNPCTAITRSMPD-PMSARTQLSELDSLKVPPVFAAARNALYTRFTPNDWMASNQGNYLASDRVRGGSERLRMDTMRLCKEYDDKTKRTQADVGKRLGERIGDINFWKTELNHELDQMITETNALNEAKRILEKNLAETENPLHISQECLYNREKRQSIDLVHDNPEKELIREVDLIKRCQERMRNTVDRANVQLGLNRAAQHELERDSGDKFIAENLDTTTHMLRNTSRGIAYHDGVHRIDNTISVPETWAKYTNDNIQRSQSERLASKNMRNEIENVINACNNEMWMQWNAVNTALNSRIQETTDSRNKIQLHLNKTLQEVFDMEKNIELLKKSIQDKEAPMQVAQTRLDTRLRRPNVELCRDPAHNRLVEEVNEITDTVDHLQHKLRESENALQALLRTKGALEQDLSIKNTTLFIDREKCMAMRKTFPM 518          
BLAST of Tektin 3 vs. TrEMBL
Match: A0A1S3HLM8 (tektin-3-like OS=Lingula unguis OX=7574 GN=LOC106156343 PE=4 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 4.092e-156
Identity = 244/511 (47.75%), Postives = 343/511 (67.12%), Query Frame = 2
Query:   47 QMDFLTHSRNFSVDLDTKYSSHLTGSTQF-PQISTKHNDLIRNNLLNFYPQQGSMRRSYTTVA-STQNYSTNDKIKPIIIPLYKNPDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSMNTAI 1573
            QM+ + H++  S     K     +G+  F P IST  +        + YP    +RRS TT+      Y    K+ P +      P+   S+++ L + + +KVP ++++ RNALYTR+T NDW +S  + Y  S+R+R  +E++R D++RL R+ DD+T +TQ D   +LG R+ DI   K+ +  E  ++I E N L+  K V EK L E+ENPLHI+QECLYNREKR  IDLVHD  EKEL+KE+D IKRCQ+K+   I++AN Q+ LNR  QHELEKDT DK+ AL +D   H   N+S  +++HNG+E I+N VS PETW KF+  N+QRS SER AS+++R EIE  L QC ++MW++W  V+N+ ++RIQE+++ARN+ Q HL  +LQEIFDMEKNIE LKKAI DK AP++VAQ+RL  R  RPN+E C D  ++R+++EV EI  + E L+ +LR AE+ LQ+LL  K+ +E DL++K NSLFIDREKC+G+RKT+ M   I
Sbjct:    3 QMEIMGHTQTASYMTGPKLGG--SGAPTFLPSISTMQSSY---KAYDTYPAPSPLRRSLTTLPWRPSTYYQTAKVNPSMAVTRSLPE-PLSMQNQLSQLDAIKVPPVFAAARNALYTRYTPNDWSQSNNSNYMASDRVRSSAERLRLDTVRLCRETDDKTKRTQTDVGKRLGERIGDIQFWKTEVQHETDQMITEINALVEHKRVLEKALQETENPLHIAQECLYNREKRQAIDLVHDHVEKELIKEVDIIKRCQEKMRQTIERANMQLSLNRAAQHELEKDTGDKFMALNLDTNCHGMKNTSRGMAFHNGIERIDNTVSVPETWAKFSNDNIQRSQSERAASKQMRNEIESVLTQCSNEMWQQWNAVNNAFTQRIQESTEARNRLQTHLSKVLQEIFDMEKNIELLKKAISDKTAPMQVAQTRLETRTHRPNVELCRDPVQHRLVEEVYEITETVEQLQAKLRQAENALQHLLRTKATLEQDLSVKNNSLFIDREKCMGMRKTFPMTPRI 507          
BLAST of Tektin 3 vs. TrEMBL
Match: A0A2C9K274 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106078627 PE=4 SV=1)

HSP 1 Score: 464.922 bits (1195), Expect = 7.491e-156
Identity = 247/493 (50.10%), Postives = 344/493 (69.78%), Query Frame = 2
Query:   95 TKYSSHLTGS---TQFPQISTKHNDLIRNNLLNFYPQQGSMRRSYTTVA-STQNYSTNDKIKPIIIPLYKNPDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSM 1561
            T+ +++LTG    TQ+PQ+ T  N    +   + YP    +RRS TT+      Y  + K  P I PL ++     S ++ L E + LKVP +++S RNALYTR T NDW+ S Q  Y  S+R+R  +E++R D++RL R+ DD+T +TQ+D   +LG R+ DIN  K+ L+ E   +I ETN L  AK V EK L E+ENPLH++QECLY+REKR  IDLVHD+PEK L++E+D IKRCQDK+  ++ KAN Q+ LNR  QHELEKD+ DK+ A  +D   H   N+S  L+YH+GV  I+N +S PETW KF+ +N+QRS +ER AS+ +R EIE  +N C ++MW++W  V+ +L++R QET+DARNK Q HL  +LQE+F+MEKNIE LKKAI DKEAP++VAQ+RL  RL RPN+E C D  ++R+++EV EI ++ +SL+ +LR AE+ LQ LL  K+ +E DL++K NSLFIDR+KCL +RKT+ M
Sbjct:    7 TQTATYLTGPRQFTQYPQLPTIGNLQNVSKTTDTYPAPSPLRRSLTTLPWRPSAYYQSTKTNPTI-PLTRSMPDPFSQKTHLSELDALKVPPVFASARNALYTRFTPNDWMASNQGNYLASDRVRSGAERLRLDTVRLCREADDKTKRTQNDVGKRLGERIGDINFWKNELNLETDNMISETNQLQEAKRVLEKFLAETENPLHLAQECLYHREKRQSIDLVHDNPEKALIREVDVIKRCQDKMRGLVDKANVQLSLNRASQHELEKDSIDKFVAEHLDNACHGMRNTSRGLAYHDGVHRIDNSLSVPETWAKFSNNNIQRSQAERAASKNMRNEIESVINACNNEMWQEWNAVNVALNQRAQETTDARNKIQTHLSKVLQEVFEMEKNIELLKKAIQDKEAPMQVAQTRLDTRLRRPNVELCRDPVQHRLVEEVYEITDTVDSLQQKLREAENALQALLRTKAALEQDLSIKNNSLFIDRDKCLAMRKTFPM 498          
BLAST of Tektin 3 vs. Ensembl Cavefish
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:103037718])

HSP 1 Score: 332.798 bits (852), Expect = 6.544e-108
Identity = 180/399 (45.11%), Postives = 255/399 (63.91%), Query Frame = 2
Query:  359 IYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
             Y SNR A+ TR+  +DW KS  N Y  S   R  +E++R D+LRL++  D  T  TQ+ ++  LG R+ DI   +S L  EI  ++ E   L   K   E+ L E+E PL  SQECL++REKR  IDLVHD  EK+L+KE++ IK CQ+++   + KA  Q+  NR  QHELE+D  DK  A +ID   H   N+S  +SY+ G++ ++  +S P++W KFT  N+  S SER  S KLR+EIE+ LN   ++MW ++   + S + RI E ++A+N  Q HL   LQEIF  E  IE LKKAI DKE PLKVAQ+RL  R  RPN+E C D P +R++ EV EI++S   L+ +L  AE+TLQNL+  K  +E D+++K NSLF+D+EKC+ +R+++
Sbjct:   81 FYPSNRAAMSTRYMPDDWFKSNYNNYRESESSRNSAERLRRDTLRLIQDRDQITRWTQESTSKNLGERLNDITFWRSELHHEIDNMVSEIAALTEVKRRLERALAETEGPLQTSQECLFHREKRMSIDLVHDGVEKDLIKEVEVIKSCQERMRRSLDKAIAQLASNRAAQHELERDLNDKVTAQRIDDRCHQMRNTSDGISYYRGIDRLDPSLSLPDSWSKFTDDNILLSQSERSTSHKLRDEIEVLLNTTANEMWNQFNSANVSFTNRISEMAEAKNSLQTHLAKTLQEIFQTEMLIETLKKAIRDKENPLKVAQTRLEERTRRPNVELCRDNPHHRLVGEVREIEDSIYKLRERLAEAENTLQNLVKTKVTLEHDISVKANSLFLDQEKCMSMRRSF 479          
BLAST of Tektin 3 vs. Ensembl Cavefish
Match: tekt4 (tektin 4 [Source:NCBI gene;Acc:103034475])

HSP 1 Score: 190.274 bits (482), Expect = 4.364e-54
Identity = 126/335 (37.61%), Postives = 186/335 (55.52%), Query Frame = 2
Query:  551 LGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
            LG R+ D++  ++ L      +  ET LL + K   EK L  ++ PL IS + L  RE R G DLV D  E+ELLKE++ I+  Q  +   +Q+A +QIRLNR  +  LE D  DK+ A  +D     + N S    +H     +++ V     W+KFT  NL+ +  +   S  LRE  +  L +  +D+  +   V  S ++R  E S A+N+ +  L+ +L EI   E+NI  L++A+ DK+ PL+VAQSRL  R  RPNME C D P+  +  EVE+I  S   L+ QL  A  +L  L  ++  +E +++ KTNSLFIDR+KCL  R  Y
Sbjct:   90 LGARLQDVHSRRTELQRGAERLQAETELLQDHKRRLEKALLTTDLPLTISTDNLTCRENRFGPDLVQDPVEEELLKEVELIRNVQALLKKTLQQAVDQIRLNREAKQTLELDWSDKHEAYILDDQCGRYGNRSTDTQHHPSSARLHDQVCDERAWLKFTQVNLEEAERQYRCSVSLRELCDRVLQETAEDLRAQCAVVDQSFNQRCLELSQAKNQLELQLQRVLDEIGSQERNISTLQQAVYDKDTPLRVAQSRLHYRAQRPNMELCRDQPQISLESEVEQISGSVGVLQQQLSEARQSLAQLEESRLMLEKNISCKTNSLFIDRDKCLTHRTRY 424          
BLAST of Tektin 3 vs. Ensembl Cavefish
Match: tekt2 (tektin 2 [Source:NCBI gene;Acc:103026688])

HSP 1 Score: 148.288 bits (373), Expect = 8.517e-39
Identity = 109/375 (29.07%), Postives = 198/375 (52.80%), Query Frame = 2
Query:  401 VNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDR 1525
            V DW  S + +   +   R VS ++R +   L  +  ++TS  + DS+ +L +R++D+   K +L++ + ++  E + L  AK   E+ L  +  PL ++ EC   RE R G +LV D  E EL KE+D I   Q  +  +I ++ EQ+ L +   H+L  D + K  AL +D    S   +S  +S       +    +TP+ W +F+  N+ R+  E + S +LRE I +   Q Q+++  + I    +L KR      A  + Q  LK    EI +ME++I  L++ +  K APLK+  +RL  R  RP ++ C D  +  +++E +++ ++ ++LK +L  A  +LQ+L  +++ +  DL+ K  +L +++
Sbjct:   14 VPDWENSNKLISDTAEHRRHVSHEIRQEGRALRNETANKTSWDEYDSSRRLNDRISDVTRWKKSLEACVQDVNAEIDALTLAKEETERALAATVLPLEVTAECQTLREGRRGSELVSDPVEAELKKEVDVIDGAQRVLQQLIDQSFEQLCLLQEAHHQLTLDLQHKTEALDVDMSCLSLTVTSPEISLKPNPIRVPPGSTTPQQWEQFSHHNVIRAKEEMQTSLQLRENISITRAQVQNELEAQRIATEFALRKRTHHMEQALQEVQWQLKTTQDEITEMERDIRGLERDMQAKMAPLKLVHTRLENRTKRPGVDLCRDEVQFGLVEEAKQLDSTIQTLKQKLAQALDSLQSLQHHEAQMLEDLSRKQEALALEQ 388          
BLAST of Tektin 3 vs. Ensembl Sea Lamprey
Match: TEKT2 (tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725])

HSP 1 Score: 92.4337 bits (228), Expect = 9.436e-22
Identity = 63/190 (33.16%), Postives = 100/190 (52.63%), Query Frame = 2
Query:  392 RHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLS 961
            R TV +W  S + V   +   R VS  VR ++  L  Q +++T   Q DS  +L  R++ +      L   + +   E N L   K  AE+ L     PL ++ ECL+ R+ R G+DLVHD  E EL +E+  I+R ++ ++  I  A  Q+   +  + +L+ D RDK  AL+ID    + NN+SA++S
Sbjct:   11 RFTVGEWHDSGERVSSGAQSRRDVSRSVRQEARHLRDQSNNQTKWDQHDSNTRLEERMSSVQRWVERLQHTLDDTDAEINALAKTKDDAERALQAKAVPLQVATECLFLRDARRGVDLVHDPVEDELHREVKAIERAKEALTRSINDAFLQVCQLQEARQQLQGDVRDKEEALEIDSTCRALNNASATIS 200          
BLAST of Tektin 3 vs. Ensembl Sea Lamprey
Match: TEKT2 (tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725])

HSP 1 Score: 84.3445 bits (207), Expect = 7.383e-19
Identity = 58/190 (30.53%), Postives = 100/190 (52.63%), Query Frame = 2
Query:  998 STPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSMNT 1567
            S+P TW +F+  N++R+ +E  AS  LRE I   + Q  +++  +      +  KR  E    + + +   KN  QEI  +E +I +L+  +  K  PLKVA +RL  R  R  +E C D P+  I  EV +I+ +  +LK +L  + + L  L  +   VE DL  K  +L ++R +C+ +R+  +++ 
Sbjct:    2 SSPRTWDEFSRRNVERAMAEMRASSALREAITATIAQTTNELEAQKNSTDFAFRKRSHELDKVKAELEWQKKNNKQEISVLEGDIAHLEADVRAKMLPLKVAHTRLETRTYRSGVELCRDEPQYGITTEVHQIEATIATLKKKLSDSYNALTGLRCSLERVERDLASKALALGLER-RCVDVRRKLTVSA 190          
BLAST of Tektin 3 vs. Ensembl Nematostella
Match: EDO39292 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAK1])

HSP 1 Score: 249.595 bits (636), Expect = 2.213e-77
Identity = 157/387 (40.57%), Postives = 237/387 (61.24%), Query Frame = 2
Query:  392 RHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSY-HNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRK 1549
            ++   +W  S    Y  + + R  +E++R +S RL  + + RT +TQ+D   KL  R+TDIN  KS LD    E  +E N+++N K   E+ L ++E PL I+Q+CL NREKR  IDLVHD+ E +LLKE++ I+  Q  +   I++A EQIRL R+ ++ LEKD +DK+HA KID    +  N S  L Y  + V+   N V TP+ W  F+  N+ ++  E+ +S  LR  I+  L Q  +D+  +   V+ +  KRI+ET  A+ K + HL  + +EI  ME+NI  L++AI  K AP+KVAQ+R+  R  RPN+E C D  + R+I EV EI  + E L+ +L  AES+L+ L+  +  +E D+ +K NSLFIDR++C+ +RK
Sbjct:   10 KYVPEEWHASNHLQYFTAEKERAAAERLRDESERLRVEIEVRTVETQEDVNKKLDQRITDINFWKSELDRNQSETEEEINMMLNFKARLERALADTELPLMIAQQCLMNREKRIKIDLVHDNVEMQLLKEVEVIEGVQALLKRTIEQATEQIRLLRSARYYLEKDRKDKFHANKIDNTCAALKNDSPGLVYARDAVKIEKNSV-TPDEWEDFSNKNMLKAEREKNSSTSLRSIIDGLLVQTLNDLMNQCRAVNLAFEKRIEETLKAKTKLEDHLMKVKEEIAAMEENIATLQRAIALKIAPMKVAQTRVENRTFRPNIELCRDRVQYRLIDEVVEISTNIERLQEKLYEAESSLKALIRRQLSLEEDIEVKENSLFIDRDQCMELRK 395          
BLAST of Tektin 3 vs. Ensembl Nematostella
Match: EDO40681 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6M2])

HSP 1 Score: 228.024 bits (580), Expect = 1.990e-69
Identity = 141/365 (38.63%), Postives = 214/365 (58.63%), Query Frame = 2
Query:  455 RGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRK 1549
            R  +E++R +  RL  +    T +TQ D   KL +R+ DIN+ K+ L+ +  E + E   L       EK L  +E PL+ISQ+CL  RE+R  IDLVHD+ E  L KE++ I+  Q  +   + +A+EQ+ L R+ + +LEKD  DKY AL ID    + NN S  + +      I     TP+ W  +++ N+ ++  ER+AS  LR EI   L Q   D+   +  V+N   KRI++T  A+   +  L  ++ E+  M+ NI  L +AI DKEAPLKVA +RL  R  RPN+E C D  + R++ EV EI  S + L+ +L  A++++Q LL NK ++E D+ +KTNSLFIDR++C+ +R+
Sbjct:   11 RATAERLRDECSRLRTETSLLTHRTQMDVNKKLDHRLHDINYWKAELEKQHSETVAEIKALQAFIGRLEKALAATEKPLNISQQCLGYRERRVKIDLVHDNVETHLSKEVEMIENVQALLKKTMDQAHEQLWLLRSAKTQLEKDLGDKYGALGIDGKCSTLNNHSKDIHFAPHAVTIQQHSFTPDEWEAYSSENIAKAERERKASVALRSEINGILMQTYVDLRNIYETVNNEFHKRIEDTVGAKKSLEKELSRVMDELASMDNNIRTLTQAIADKEAPLKVAHTRLDKRSIRPNVELCRDPVQYRLVGEVGEINTSIDRLRMRLAEAQASMQALLRNKENLEDDIEVKTNSLFIDRDQCMVVRQ 375          
BLAST of Tektin 3 vs. Ensembl Nematostella
Match: EDO37357 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG13])

HSP 1 Score: 201.06 bits (510), Expect = 8.493e-59
Identity = 144/387 (37.21%), Postives = 215/387 (55.56%), Query Frame = 2
Query:  392 RHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYH-NGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRK 1549
            R  V+DW  S Q +  N+ R R  S +VR +S  L  + D+ T  TQ DS  KL  R+ DIN  K +L+  + E   E  LL   K   E+ L   + PL I+ ECL  RE R  IDLV D+ E +L KE++ I+  +  +   + ++ EQ+ L +  +H+L  D  DK+  L+ID   ++ NN S ++ Y  N    +   V TPETW  F+  N  R+ +E +AS+ LRE I   L Q  +D+  +      S  KRI ET  A+++ +   KN ++EI  +E +I+ LK+AI  K AP+ VAQ+RL  R  RPN+E C D P+ ++  EV EI  S  +L  +LR A+++L+ L  N S +  DL  K NSL +D  +C+ +R+
Sbjct:   11 RFAVSDWHTSNQIIRTNAERQREASHRVRQESRFLRNETDNHTRWTQHDSNTKLEKRIDDINDWKRSLERCLAETDNEIALLTREKERTERALEAKKVPLDITLECLMLRENRQSIDLVRDEVEAQLHKEVEVIEGTKALLQQKVDESFEQLCLLQEARHQLHLDITDKFTTLQIDGDCYAMNNMSTNIGYQVNPTRTVKGSV-TPETWDSFSNYNKLRAEAEMKASKHLREAIFATLQQTANDLEAQRKASEYSFRKRIHETDQAKSELEWQQKNTMKEIATLEDDIKGLKEAIDAKNAPMMVAQTRLENRTYRPNVELCRDQPQYQLCHEVAEIAGSMRALTEKLREAQNSLEALRSNLSRINEDLAFKNNSLALD-NRCMSVRE 395          
BLAST of Tektin 3 vs. Ensembl Medaka
Match: tekt3 (tektin 3 [Source:NCBI gene;Acc:101160513])

HSP 1 Score: 330.102 bits (845), Expect = 6.456e-107
Identity = 178/399 (44.61%), Postives = 260/399 (65.16%), Query Frame = 2
Query:  359 IYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTY 1555
             + SNR A+  R+T +DW KS Q+ Y  S   R  +E++R D++RL++  D  T +TQ++++  +  R+ DI   KS L  EI  ++ E   L   K   E+ L E++ PL ++QECLY+REKR  IDLVHD  EK+L+K I+ IK CQ+++   + +A  Q+  NR  QHELEKD  DK  A +ID   H   N+S  + Y+ G++  ++ VS P++W +FT  N+ RS SER  S KLR+EIE+ LN   ++MW ++  V+ + + RI ET+DA++  QAHL   +QEIF  E  IE LKKAI DKE PLKVAQ+RL  R  RPN+E C D P +R++ EV EI+++ + L  +L  AE+TLQ L+  K  +E+DL++K NSLF+D+EKC+ +RKT+
Sbjct:   79 FFPSNRTAMTNRYTPDDWYKSNQSHYWESESSRKSAERLRKDTMRLIQDKDQLTRRTQENTSKNISERLNDIRFWKSELSHEIDNMVTEIAALTEVKRRLERALAETQGPLQVAQECLYHREKRMSIDLVHDGVEKDLIK-IEVIKSCQERMRLHLDRATSQLASNRAAQHELEKDLSDKLTAQRIDDRCHHLRNTSDGIGYYRGIDRQDHAVSLPDSWSRFTDDNILRSQSERATSHKLRDEIEILLNTTSNEMWNQFNNVNVAFTNRISETTDAKSSLQAHLAKTMQEIFQTEMLIESLKKAIRDKENPLKVAQTRLEERTRRPNIELCRDNPYHRLVTEVREIEDTIQKLHERLMEAENTLQALVKTKVKLENDLSIKANSLFLDQEKCMSMRKTF 476          
BLAST of Tektin 3 vs. Ensembl Medaka
Match: tekt4 (tektin 4 [Source:NCBI gene;Acc:101173527])

HSP 1 Score: 194.126 bits (492), Expect = 1.637e-55
Identity = 122/333 (36.64%), Postives = 183/333 (54.95%), Query Frame = 2
Query:  551 LGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRK 1549
            LG R+ +I+H +S L   I ++  +   L  A+   E+ L  ++ P  I+ + L  R KR G DLV D  E+ELLKE+  I+  Q  +   I +   QIR N + +  LE D  DK  A  +D+     +N S     H      +  V  P TW KFT  NL ++  E EASR+LR  +E  L +  +D+  +   V  + S+R QE  +A+ + Q  L  +LQ+I + EKNI  L+KAI  KEAPL+V QSRL +R  RPNME C D  +  +  E  +I+ +  SLK +L  A  +L NL  ++ +++ D++ K+ SLFI+ EKC+  R+
Sbjct:  101 LGERLQEIHHWRSELLRHIEQLQADMEALQAARTRLERALEATDTPYAIATDNLNCRAKRPGPDLVQDSVEEELLKEVGLIRNIQALLKRTIAQVASQIRRNMDAKQVLEMDWSDKQEAYNLDERGGGHSNRSPDTQLHPSSAANHEQVCNPTTWTKFTQDNLLQAAQEEEASRRLRALVEEMLRETTEDLINQRSTVDGAFSQRCQELLEAKTELQIKLTQVLQQIGEQEKNIVGLQKAIHLKEAPLRVVQSRLHLRSLRPNMELCRDPAQLSLEAEAAQIETTLNSLKQKLNEARISLSNLEESRMELQKDISCKSQSLFIEGEKCMTQRR 433          
BLAST of Tektin 3 vs. Ensembl Medaka
Match: tekt2 (tektin 2 [Source:NCBI gene;Acc:101164907])

HSP 1 Score: 152.525 bits (384), Expect = 2.238e-40
Identity = 104/378 (27.51%), Postives = 206/378 (54.50%), Query Frame = 2
Query:  392 RHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDR 1525
            R  V++W  +   ++  + + R VS ++R +   L  +   +T   + +++ +L  RV D++  +  LDS   ++ +E + L  +K + E+ L  +  PL +S EC+  RE R G +LV D  +++L KE++ I+R Q  +   I +A +Q+ + +  +H+L  D ++K  AL ID+   +   +S ++S       I +  STP+ W++ +  N+ ++      S+++RE++ L   Q Q+++  +      +L KR      AR++ Q  ++N+  EI +ME +I  L   +  K APLK+A +RL  R  RP M+ C D  +  ++ EVE+++ +  +L+ +L  A+ +LQN+ ++   +  DL+ K  +L +++
Sbjct:    9 RCGVSEWNNNNLQLWAEAQQQRLVSSEIRQECKSLRNETHCKTVWDEKETSRRLTERVWDVSRWRDLLDSCAQKVDEEMDALTLSKELTEQALAATATPLEVSTECMMLREGRRGYELVTDPVQEQLQKEVELIERVQQTLQQHIDEAFQQLCVLQEARHQLTGDLQNKMEALDIDKSCLTLTITSPNISLKTNPTRIPSGASTPQEWVQLSNHNVVQAEEAMRVSQQMREDMSLSRAQLQNELEAERRATEFALRKRSHHEEQARDELQWQIRNMEAEIAEMESDIRELDADLQAKTAPLKLAHTRLENRTHRPGMDLCRDEVQYSLVAEVEQLEATVLALQLKLSKAQHSLQNMRLHHGQMLQDLSRKQEALSLEQ 386          
BLAST of Tektin 3 vs. Ensembl Medaka
Match: tekt1 (tektin-1 [Source:NCBI gene;Acc:101161072])

HSP 1 Score: 115.161 bits (287), Expect = 1.782e-27
Identity = 99/386 (25.65%), Postives = 194/386 (50.26%), Query Frame = 2
Query:  419 SAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSY--------HNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKT 1552
            S  NV G  ++    SE+ R +   L+++      + Q+D   +   ++  I  +K  L+ ++ E+  E + L+  +    K L   + PL ++  C+  R KR   +  HD+ + ELLKE + +KR +  +  V ++ +EQ+RLNR+ ++ +EKD ++K  A  +D    +F    A+LS         H+  E   + V T + W   + +N+ ++  ++  SR L+  ++  L+Q   DM K+    + ++   +Q+  +A+N+ +  L  I  EI    K  E L+ A+ + E  L + Q+RL +R +RP  E   D  + +++ +V++I    + L+ ++  +E   + LL  K  ++  ++ K N L+ID   C+  R+ 
Sbjct:   12 SPVNVAGTLHQ----SERFRAECKELIKETKQICKRMQEDENQQFDQKLRRIQFLKKELELKLDEVNLEIDDLVVLQSRVTKALDACKEPLEVTDLCMKERLKRPNSERFHDEVDGELLKESEGLKRVESLLQRVTEQISEQLRLNRSAKYGIEKDLKEKSEAQNVD----NFCTLMATLSMSHRHRPKTHSTPE--PSSVLTLDQWENISYANMAKAEQQKTNSRSLQVLVQSVLDQTAADMQKQVQATTTAIQLNVQKMKNAKNQMEDELVKIQSEISSQRKTREDLRVAVAENEEFLSLTQARLALRHERPGKEQWRDPAQRKLLADVQKITEHIKQLQQEVDRSEDEERRLLNWKLRLQESIDSKANCLYIDEVVCMQRREA 387          
BLAST of Tektin 3 vs. Planmine SMEST
Match: SMESG000062615.1 (SMESG000062615.1)

HSP 1 Score: 1012.29 bits (2616), Expect = 0.000e+0
Identity = 510/510 (100.00%), Postives = 510/510 (100.00%), Query Frame = 2
Query:   50 MDFLTHSRNFSVDLDTKYSSHLTGSTQFPQISTKHNDLIRNNLLNFYPQQGSMRRSYTTVASTQNYSTNDKIKPIIIPLYKNPDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSMNTAIKI 1579
            MDFLTHSRNFSVDLDTKYSSHLTGSTQFPQISTKHNDLIRNNLLNFYPQQGSMRRSYTTVASTQNYSTNDKIKPIIIPLYKNPDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVRQFDDRTSQTQDDSTHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSMNTAIKI
Sbjct:    1 MDFLTHSRNFSVDLDTKYSSHLTGSTQFPQISTKHNDLIRNNLLNFYPQQGSMRRSYTTVASTQNYSTNDKIKPIIIPLYKNPDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVRQFDDRTSQTQDDSTHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSMNTAIKI 510          
BLAST of Tektin 3 vs. Planmine SMEST
Match: SMESG000020792.1 (SMESG000020792.1)

HSP 1 Score: 522.316 bits (1344), Expect = 0.000e+0
Identity = 271/463 (58.53%), Postives = 355/463 (76.67%), Query Frame = 2
Query:  176 LLNFYPQQGSMRRSYTTVA-STQNYSTNDKIKPIIIPLYKNPDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSM 1561
            L +FYP   +++RSYTT+A     Y  + ++      L  +     S+R+ L E EG+KVP+I+SS RNALYTR+T NDWIKSA+  Y  S+ +R  +EK+R D+ R+ R+FDDRT + Q+DS  KLG+R+ DIN +++ ++ EI +++ E+  L NAK  AEK L+E+ENPLH++QECLYNREKR+GIDLVHD  EK LL E+D IK+CQD+I+ ++ KAN Q+ LNR  QHELEKD+ DK+ A +ID  A S  NSS  ++Y+NGVE ++NC+STPETW+KFT +NLQRS +EREASR+LREEIE  L + Q DM KKW EV+ +LS+R QET+DARNK Q HL  +LQEIFDMEKNIEY+KK+I DKEAPLKVAQ+RL VRLDRPNMEAC D PR+R+I+EV EI+ S  +L  QL+ AE+T+Q+LL +KS++E DLN+KTNSLFIDREKCLG RKT+ M
Sbjct:   18 LTDFYPSPSTLQRSYTTLAWRPAVYYQSSRVPNNSTSLVNSTVSPSSIRNYLTELEGIKVPNIFSSARNALYTRYTPNDWIKSAEINYNVSDNVRNNAEKIRLDTSRMAREFDDRTKRAQEDSGKKLGDRLADINFMRNEVNDEIDKMMAESEALSNAKRAAEKSLSETENPLHVTQECLYNREKRSGIDLVHDMVEKNLLGEVDLIKKCQDQIAELVNKANVQLNLNRASQHELEKDSHDKFQAEQIDSYAQSLKNSSPGIAYYNGVENVDNCISTPETWLKFTNNNLQRSAAEREASRRLREEIEQVLARTQRDMAKKWAEVNAALSQRAQETADARNKIQNHLNKVLQEIFDMEKNIEYIKKSIQDKEAPLKVAQTRLHVRLDRPNMEACRDQPRSRLIEEVHEIRESINNLNRQLQQAEATMQHLLSSKSNLEHDLNVKTNSLFIDREKCLGTRKTFPM 480          
BLAST of Tektin 3 vs. Planmine SMEST
Match: SMESG000021346.1 (SMESG000021346.1)

HSP 1 Score: 453.366 bits (1165), Expect = 5.744e-155
Identity = 241/455 (52.97%), Postives = 324/455 (71.21%), Query Frame = 2
Query:  206 MRRSYTTVA-STQNYSTNDKIKPIIIPLYKN--PDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSM 1561
            ++RS TT+  +   +  +  I P I  L     P C    +++L E EGLKVP ++S+ RNALYTR+T  DW+ +A   + +++R+R   E++R D+ RL R+ DD+T + Q+D   K+G+R++D N  K+ LD EI ++I E N L   K VAEK L E+EN LHI +ECLY REKR GIDLVHD+ EK L+ EIDT+K+ QD I  +I KAN Q+ LNR  QHE E D+RDK+ A +ID+ AH   NSSA +++HNGVE I+NCVSTPETW K++  N++RS +ERE S K+REEIE  L++  +DMWK+W  V+ +L++RIQET DARNK QAHL  ILQEIFDMEKNIEYLKK I DKE  +KVAQ+RL  RL RP ME C D P +R+++EV+EI+     L  +LR AE+ LQ+LL NK+ +E DLN+K N+LF+DREKCLG+RKT+ +
Sbjct:   39 LKRSLTTLPWNAATFYKSSHISPSISLLNSQTAPLCG---KTALGELEGLKVPPVFSAARNALYTRYTPKDWMTAAMKTFQSADRVRDYGERIRFDTNRLGRETDDQTKRAQEDVGKKIGDRLSDTNFWKTELDDEIDKMITENNNLNEMKRVAEKMLGETENQLHIGEECLYTREKRQGIDLVHDNVEKSLIGEIDTVKQAQDDIRNIISKANAQMSLNRAAQHENELDSRDKFIAQQIDENAHQIKNSSAGINFHNGVETIDNCVSTPETWAKYSDDNVKRSQAERENSTKVREEIEATLDKAANDMWKRWNNVNTALTERIQETIDARNKIQAHLAKILQEIFDMEKNIEYLKKCIKDKEDYMKVAQTRLHFRLRRPGMELCRDQPNHRLVEEVDEIREVVAMLMRELREAETALQHLLDNKAVLEQDLNIKNNTLFLDREKCLGLRKTFPI 490          
BLAST of Tektin 3 vs. Planmine SMEST
Match: SMESG000021346.1 (SMESG000021346.1)

HSP 1 Score: 453.366 bits (1165), Expect = 8.099e-155
Identity = 241/455 (52.97%), Postives = 324/455 (71.21%), Query Frame = 2
Query:  206 MRRSYTTVA-STQNYSTNDKIKPIIIPLYKN--PDCSQSLRSSLCEFEGLKVPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSM 1561
            ++RS TT+  +   +  +  I P I  L     P C    +++L E EGLKVP ++S+ RNALYTR+T  DW+ +A   + +++R+R   E++R D+ RL R+ DD+T + Q+D   K+G+R++D N  K+ LD EI ++I E N L   K VAEK L E+EN LHI +ECLY REKR GIDLVHD+ EK L+ EIDT+K+ QD I  +I KAN Q+ LNR  QHE E D+RDK+ A +ID+ AH   NSSA +++HNGVE I+NCVSTPETW K++  N++RS +ERE S K+REEIE  L++  +DMWK+W  V+ +L++RIQET DARNK QAHL  ILQEIFDMEKNIEYLKK I DKE  +KVAQ+RL  RL RP ME C D P +R+++EV+EI+     L  +LR AE+ LQ+LL NK+ +E DLN+K N+LF+DREKCLG+RKT+ +
Sbjct:   51 LKRSLTTLPWNAATFYKSSHISPSISLLNSQTAPLCG---KTALGELEGLKVPPVFSAARNALYTRYTPKDWMTAAMKTFQSADRVRDYGERIRFDTNRLGRETDDQTKRAQEDVGKKIGDRLSDTNFWKTELDDEIDKMITENNNLNEMKRVAEKMLGETENQLHIGEECLYTREKRQGIDLVHDNVEKSLIGEIDTVKQAQDDIRNIISKANAQMSLNRAAQHENELDSRDKFIAQQIDENAHQIKNSSAGINFHNGVETIDNCVSTPETWAKYSDDNVKRSQAERENSTKVREEIEATLDKAANDMWKRWNNVNTALTERIQETIDARNKIQAHLAKILQEIFDMEKNIEYLKKCIKDKEDYMKVAQTRLHFRLRRPGMELCRDQPNHRLVEEVDEIREVVAMLMRELREAETALQHLLDNKAVLEQDLNIKNNTLFLDREKCLGLRKTFPI 502          
BLAST of Tektin 3 vs. Planmine SMEST
Match: SMESG000064101.1 (SMESG000064101.1)

HSP 1 Score: 309.686 bits (792), Expect = 2.900e-99
Identity = 179/452 (39.60%), Postives = 279/452 (61.73%), Query Frame = 2
Query:  227 VASTQNYSTND-KIKPIIIPLYKNPDCSQSLRSSLCEFEGLKVPDIY-SSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLVXXXXXXXXXXXXXXXHKLGNRVTDINHVKSNLDSEIYEI-IKETNLLINAKIVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKRCQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSSASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELCLNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKNIEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIKNSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRKTYSMNTAI 1573
            V++   YS ND  + P+  PL  +   S++ +SS+  F  +K   IY ++ RN LYTR + NDW  S    +  S   R  + +++ D+ + V++ + +T   Q ++T +L  RV +I+  +  LD EI  + I++ NL  + +++ E  L  ++ PL IS+ CL  RE R GID V D+ EK L+KE++TIK+CQ+K++  +QK   Q+++NR  QHE EKD +DK H+ ++D   +   N+S+ L+YH G+E  +N +S P +W KF+  N+ RS   R +S  LR EI++ +  C + MW  +  V+NSL  R+QE ++ARNK ++HL+  +QEIFD EK+I  L+KAI DKE PLK+A++RL  R  R N+E CND     + +E+ E++NS   LK Q R AE     L+  KS +E D+ +K NSL ID++ CLG+RK + M+  I
Sbjct:   12 VSARGRYSNNDGSVSPVRFPLRSSNGFSRT-KSSISVFPQIKNTKIYYNTARNQLYTRFSPNDWESSNNAHFKLSEAERAQATRLKSDAWKAVKETEHKTRSRQAEATKRLNERVQNISFWRQELDQEIRSMDIEQENLKEHLRVLKEN-LEHTQKPLAISEHCLVKREGRQGIDQVQDEVEKSLIKEVETIKKCQEKMNRFLQKGEIQMKMNRAAQHECEKDLKDKSHSHQLDDKMYHLKNTSSGLAYHPGIELFDNTISIPVSWAKFSQDNINRSQKCRASSEALRGEIDMLIRNCANIMWNNFSNVNNSLLSRVQEITNARNKLESHLQRTVQEIFDCEKSINLLRKAIADKEEPLKLAETRLEERTKRLNVELCNDPAMRTLQKEIMELRNSIRLLKEQKRSAEIVYNRLINTKSLLEKDIAVKENSLQIDQKACLGVRKIFPMDQKI 461          
The following BLAST results are available for this feature:
BLAST of Tektin 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TEKT36.387e-11346.67tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293][more]
TEKT36.387e-11346.67tektin 3 [Source:HGNC Symbol;Acc:HGNC:14293][more]
TEKT54.653e-9337.69tektin 5 [Source:HGNC Symbol;Acc:HGNC:26554][more]
TEKT12.429e-7035.92tektin 1 [Source:HGNC Symbol;Acc:HGNC:15534][more]
TEKT41.393e-6537.79tektin 4 [Source:HGNC Symbol;Acc:HGNC:31012][more]
back to top
BLAST of Tektin 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
R02E12.46.349e-1222.25pep chromosome:WBcel235:X:4005314:4007634:1 gene:W... [more]
back to top
BLAST of Tektin 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG328192.320e-9137.29gene:FBgn0052819 transcript:FBtr0070051[more]
CG328202.320e-9137.29gene:FBgn0052820 transcript:FBtr0070054[more]
CG174502.320e-9137.29gene:FBgn0040028 transcript:FBtr0345920[more]
CG174502.320e-9137.29gene:FBgn0040028 transcript:FBtr0070056[more]
CG328193.540e-9037.29gene:FBgn0052819 transcript:FBtr0070050[more]
back to top
BLAST of Tektin 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tekt33.683e-11145.11tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
tekt34.544e-11145.11tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
tekt34.544e-11145.11tektin 3 [Source:ZFIN;Acc:ZDB-GENE-080130-2][more]
tekt41.549e-5834.95tektin 4 [Source:ZFIN;Acc:ZDB-GENE-070410-98][more]
tekt15.702e-5633.16tektin 1 [Source:ZFIN;Acc:ZDB-GENE-041114-99][more]
back to top
BLAST of Tektin 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tekt32.177e-11944.31tektin 3 [Source:NCBI gene;Acc:549229][more]
gdf102.944e-7538.14growth differentiation factor 10 [Source:Xenbase;A... [more]
plcd11.187e-6538.15phospholipase C delta 1 [Source:Xenbase;Acc:XB-GEN... [more]
tekt21.782e-4230.18tektin 2 (testicular) [Source:NCBI gene;Acc:493269... [more]
fam168a6.452e-4133.93family with sequence similarity 168 member A [Sour... [more]
back to top
BLAST of Tektin 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tekt36.524e-11045.71tektin 3 [Source:MGI Symbol;Acc:MGI:1918312][more]
Tekt56.027e-9240.45tektin 5 [Source:MGI Symbol;Acc:MGI:1917676][more]
Tekt51.642e-7440.35tektin 5 [Source:MGI Symbol;Acc:MGI:1917676][more]
Tekt41.248e-6838.83tektin 4 [Source:MGI Symbol;Acc:MGI:1919090][more]
Tekt11.193e-6533.85tektin 1 [Source:MGI Symbol;Acc:MGI:1333819][more]
back to top
BLAST of Tektin 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BXF9|TEKT3_HUMAN3.067e-11246.67Tektin-3 OS=Homo sapiens OX=9606 GN=TEKT3 PE=1 SV=... [more]
sp|A6H782|TEKT3_BOVIN2.061e-11145.61Tektin-3 OS=Bos taurus OX=9913 GN=TEKT3 PE=1 SV=1[more]
sp|Q6X6Z7|TEKT3_MOUSE4.563e-10945.71Tektin-3 OS=Mus musculus OX=10090 GN=Tekt3 PE=2 SV... [more]
sp|Q4V8G8|TEKT3_RAT3.483e-10540.24Tektin-3 OS=Rattus norvegicus OX=10116 GN=Tekt3 PE... [more]
sp|Q96M29|TEKT5_HUMAN2.234e-9237.69Tektin-5 OS=Homo sapiens OX=9606 GN=TEKT5 PE=1 SV=... [more]
back to top
BLAST of Tektin 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267GV766.609e-15848.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GB647.612e-15848.32Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A2C9JWU57.037e-15749.40Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A1S3HLM84.092e-15647.75tektin-3-like OS=Lingula unguis OX=7574 GN=LOC1061... [more]
A0A2C9K2747.491e-15650.10Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Tektin 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tekt36.544e-10845.11tektin 3 [Source:NCBI gene;Acc:103037718][more]
tekt44.364e-5437.61tektin 4 [Source:NCBI gene;Acc:103034475][more]
tekt28.517e-3929.07tektin 2 [Source:NCBI gene;Acc:103026688][more]
back to top
BLAST of Tektin 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TEKT29.436e-2233.16tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725][more]
TEKT27.383e-1930.53tektin 2 [Source:HGNC Symbol;Acc:HGNC:11725][more]
back to top
BLAST of Tektin 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tektin 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO392922.213e-7740.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406811.990e-6938.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373578.493e-5937.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tektin 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tekt36.456e-10744.61tektin 3 [Source:NCBI gene;Acc:101160513][more]
tekt41.637e-5536.64tektin 4 [Source:NCBI gene;Acc:101173527][more]
tekt22.238e-4027.51tektin 2 [Source:NCBI gene;Acc:101164907][more]
tekt11.782e-2725.65tektin-1 [Source:NCBI gene;Acc:101161072][more]
back to top
BLAST of Tektin 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062615.10.000e+0100.00SMESG000062615.1[more]
SMESG000020792.10.000e+058.53SMESG000020792.1[more]
SMESG000021346.15.744e-15552.97SMESG000021346.1[more]
SMESG000021346.18.099e-15552.97SMESG000021346.1[more]
SMESG000064101.12.900e-9939.60SMESG000064101.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017127 ID=SMED30017127|Name=Tektin 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1690bp
TAACTATCATAATATTTCTAACTCACTAATTGCATAACATTCAAAACAAA
TGGATTTTCTCACTCATTCCAGAAATTTTTCGGTAGACTTAGACACAAAA
TATTCATCTCATTTAACTGGTTCCACTCAATTCCCACAAATATCTACGAA
ACATAATGATTTAATTAGAAACAATTTGTTAAATTTTTATCCACAACAAG
GTTCAATGAGACGGTCCTATACAACAGTGGCTTCAACACAGAACTATTCA
ACTAACGATAAGATCAAACCGATAATAATCCCGCTGTACAAAAATCCAGA
TTGCAGCCAGTCACTGAGATCTAGTCTTTGTGAATTTGAAGGTCTGAAAG
TGCCAGATATTTACTCATCGAATAGAAATGCACTTTATACGAGACACACA
GTTAATGATTGGATAAAATCCGCCCAAAATGTTTATGGGAATAGCAATAG
AATTCGAGGAGTTTCAGAAAAAGTTCGAGGTGATTCACTGAGATTAGTTC
GGCAATTTGACGACAGAACTAGTCAAACTCAGGATGATTCAACTCATAAG
TTAGGGAACCGAGTGACTGACATTAACCATGTAAAGTCGAATCTAGATTC
AGAAATCTACGAAATAATTAAAGAAACGAATCTATTAATCAACGCAAAAA
TAGTTGCTGAAAAAGAGCTGACTGAGAGCGAGAATCCTTTGCACATTTCT
CAGGAATGTTTATACAATCGAGAAAAGAGAGCGGGAATCGACCTTGTCCA
CGATGATCCAGAAAAGGAGCTGTTAAAAGAGATCGACACTATCAAGCGCT
GCCAGGATAAGATATCCTATGTCATTCAAAAGGCAAATGAGCAAATAAGA
CTCAATAGAAATGTCCAACACGAATTAGAGAAGGACACTCGGGATAAATA
TCACGCCCTGAAAATTGACCAGTTAGCCCATAGCTTTAATAATTCTTCGG
CCAGCCTTTCTTACCATAATGGGGTTGAATTCATTAACAATTGTGTATCA
ACTCCTGAGACGTGGATGAAATTCACGACTTCAAATCTTCAAAGGTCGTG
GTCTGAACGGGAGGCCAGTAGGAAACTGAGAGAGGAAATCGAATTATGTC
TCAATCAGTGTCAAGATGATATGTGGAAAAAATGGATAGAAGTGAGCAAT
TCTTTGTCGAAAAGAATTCAAGAAACATCAGACGCTAGAAATAAAGATCA
AGCTCATTTGAAAAATATTCTACAAGAAATATTTGACATGGAAAAAAATA
TAGAATATCTGAAGAAAGCAATTATAGATAAAGAAGCCCCGTTAAAAGTG
GCGCAAAGCAGGCTTTTAGTCCGGCTTGACAGACCTAATATGGAAGCTTG
TAACGATGTTCCTCGAAATAGAATAATTCAAGAAGTGGAAGAGATAAAGA
ATTCAACGGAATCATTGAAAAATCAGCTTCGATTGGCTGAAAGCACCTTG
CAAAACCTGTTGATGAACAAATCAGATGTTGAGTCTGATCTGAACTTGAA
AACCAACAGTTTGTTCATTGATCGAGAGAAATGTCTCGGAATACGGAAAA
CCTATTCAATGAACACCGCCATCAAAATATAAATGATCAACAATAGATTG
GAGAAACTTTTTTACTTATTATTTTTATTTACTAGATTAGTTTAGAAAAC
TTTGATGTGCAGTGAATAAAGTTTTATTTTTCGGAATGAG
back to top

protein sequence of SMED30017127-orf-1

>SMED30017127-orf-1 ID=SMED30017127-orf-1|Name=SMED30017127-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=511bp
MDFLTHSRNFSVDLDTKYSSHLTGSTQFPQISTKHNDLIRNNLLNFYPQQ
GSMRRSYTTVASTQNYSTNDKIKPIIIPLYKNPDCSQSLRSSLCEFEGLK
VPDIYSSNRNALYTRHTVNDWIKSAQNVYGNSNRIRGVSEKVRGDSLRLV
RQFDDRTSQTQDDSTHKLGNRVTDINHVKSNLDSEIYEIIKETNLLINAK
IVAEKELTESENPLHISQECLYNREKRAGIDLVHDDPEKELLKEIDTIKR
CQDKISYVIQKANEQIRLNRNVQHELEKDTRDKYHALKIDQLAHSFNNSS
ASLSYHNGVEFINNCVSTPETWMKFTTSNLQRSWSEREASRKLREEIELC
LNQCQDDMWKKWIEVSNSLSKRIQETSDARNKDQAHLKNILQEIFDMEKN
IEYLKKAIIDKEAPLKVAQSRLLVRLDRPNMEACNDVPRNRIIQEVEEIK
NSTESLKNQLRLAESTLQNLLMNKSDVESDLNLKTNSLFIDREKCLGIRK
TYSMNTAIKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000435Tektin
Vocabulary: cellular component
TermDefinition
GO:0002080acrosomal membrane
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0005929cilium
GO:0036126sperm flagellum
GO:0042995cell projection
GO:0070062extracellular exosome
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0030317flagellated sperm motility
GO:0060271cilium morphogenesis
GO:0060294cilium movement involved in cell motility
GO:0080154regulation of fertilization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 387..407
NoneNo IPR availableCOILSCoilCoilcoord: 439..473
NoneNo IPR availablePFAMPF03148Tektincoord: 121..502
e-value: 1.9E-130
score: 435.0
NoneNo IPR availablePANTHERPTHR19960:SF11TEKTIN 3coord: 43..507
IPR000435TektinPRINTSPR00511TEKTINcoord: 425..445
score: 42.86
coord: 479..491
score: 53.85
coord: 406..422
score: 67.65
coord: 448..464
score: 32.35
IPR000435TektinPANTHERPTHR19960TEKTINcoord: 43..507