Integrase catalytic domain-containing protein

Overview
NameIntegrase catalytic domain-containing protein
Smed IDSMED30017119
Length (bp)2730
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Integrase catalytic domain-containing protein (SMED30017119) t-SNE clustered cells

Violin plots show distribution of expression levels for Integrase catalytic domain-containing protein (SMED30017119) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Integrase catalytic domain-containing protein (SMED30017119) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Integrase catalytic domain-containing protein (SMED30017119) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017119

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30017119SMESG000069853.1 dd_Smed_v4_1941_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017119SMESG000069853.1 dd_Smed_v4_1941_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
oocyteSMED30017119SMESG000069873.1 SMESG000069862.1 Contig6551newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30017119SMESG000069873.1 SMESG000069862.1 Contig6551uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30017119SMESG000069873.1 SMESG000069862.1 Contig6551newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30017119SMESG000069873.1 SMESG000069862.1 Contig6551uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Match: A0A2B4RBS5 (Uncharacterized protein OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene22069 PE=4 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 5.069e-14
Identity = 91/325 (28.00%), Postives = 146/325 (44.92%), Query Frame = 1
Query: 1393 WLREPSFLKEKVPGRREITNI*TTLRSDTDKRALL*QRKSMYRNDHFGFNKLL--------------EYSRWINLTRA-----RFYENSRLPMNKRYIGDMTVLEIEDPEFK*IQEDQKVEFKEEWNCRSKNLHKMIESKNEV*RVNTK*------KSFGQCELA*I--NNKIYRIILSGKSWVTWLIA------TEHYGRLEYLTPKLNEKYLVVGGRPFPEK---EIHNLSKTKCKT*LTNHGIIAFFPSKLTFYRIHK*INNKAADYVGVIITTQSRGNRQTKKYPCLFICLITRVIPLEMLYRLGTDSFIHSFKRFIEQRG 2259
            W   PS+LKEK P    I  + T   SDT+ R    +      +   G ++++               +S W+ LTR      RF +N  LP  +R  G++TV EI+D E + I+  Q++ FKEE  C + +  K +   +++  +  +       +S G+ E A     +  Y IIL  K WVT LI         H          L+ ++ ++  R    +   E +   + K K       ++A  P K+      +  +  A D+ G  +  Q RG R+ K+Y CLF CL +R + LE+ Y L TDSF+++F R   +RG
Sbjct:  214 WWEGPSYLKEK-PSEWPINKLTTVRASDTEVR----KSNKCQLDPSDGRDRMMVTIEGDGESRLEPKRFSSWLRLTRIQARIYRFLKNCLLPNGRRTRGELTVEEIQDAEIRIIKAAQRL-FKEE--CSALSSGKPLPMSSKLLTLKPRLDEDGVVRSDGRLENAEYLPYDVKYPIILPRKEWVTKLIVRWYHQQGNHPSGTHQTLAMLSSRFWLMQRREEIRECKGECYECRRRKAKA---AQQVMAPLP-KIRLKMPPRAFSRTAVDFGGPFMMIQGRGKRRAKRYLCLFTCLTSRALHLEIAYGLDTDSFLNAFCRMASRRG 526          
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Match: A0A2B4SD70 (Uncharacterized protein OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene8853 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.252e-12
Identity = 41/108 (37.96%), Postives = 64/108 (59.26%), Query Frame = 1
Query:  880 EIWQQAGMETRKWVTNDGEVLETLPIEMISEFIHLDEKSDISVKTLGVVVWYASGDKFGFNIRRINKE-NISKRGFFSGLAKIFDPLVLDGAFLVRGKMLMQEIWIAG 1200
            E+W +AGM  RKW++N  +VLE +P++  +    LD+    SVKTLG ++W A    F +      KE  ++KR F  G+A +FDPL     ++VR K+++QE+   G
Sbjct:  195 ELWGRAGMHARKWLSNSPKVLEEIPVDDRASEADLDQGHLPSVKTLG-ILWLAEEGMFTYTAHPPGKEFQLTKRSFLKGIATLFDPLGFLAPYIVRAKIILQEMRTTG 301          
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Match: A0A2G8KMP0 (Integrase_H2C2 domain-containing protein OS=Stichopus japonicus OX=307972 GN=BSL78_13912 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 6.284e-12
Identity = 54/151 (35.76%), Postives = 76/151 (50.33%), Query Frame = 1
Query: 1837 IILSGKSWVTWLIATEHYGRLEYLTPK------LNEKYLVVGGRPFPEKEIHNLSKT--KCKT*LTNHG--IIAFFPSKLTFYRIHK*INNKAADYVGVIITTQSRGNRQTKKYPCLFICLITRVIPLEMLYRLGTDSFIHSFKRFIEQRG 2259
            IIL  K  VT LI  EH+   +++         L+ KY ++GGR    +EI     T  +CK      G  I+A  P   T     +  +  + D+ G  +T Q RG  +TK+Y CLF C+ TR + LEM + L TDSFI+   RF  +RG
Sbjct:   27 IILPRKHPVTRLIVKEHHVEGKHIAGTNHTLALLSNKYWLIGGR----EEIREWENTCNECKRGKPRGGQQIMAPLPKSRTNVDTMRAFDKVSVDFAGQFLTKQGRGKIKTKRYLCLFTCMKTRAVHLEMAFGLDTDSFINCLYRFTSRRG 173          
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Match: A0A2B4RBG6 (Nucleotide-binding oligomerization domain-containing protein 2 OS=Stylophora pistillata OX=50429 GN=Nod2 PE=4 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 6.804e-12
Identity = 77/259 (29.73%), Postives = 119/259 (45.95%), Query Frame = 1
Query: 1555 YSRWINLTRA-----RFYENSRLPMNKRYIGDMTVLEIEDPEFK*IQEDQKVEF--------KEEWNCRSK--NLHKMIESKNEV*RVNTK*KSFGQCELA*INNKIYRIILSGKSWVTWLI------ATEHYGRLEYLTPKLNEKYLVVGGRPFP---EKEIHNLSKTKCKT*LTNHGIIAFFPSKLTFYRIHK*INNKAADYVGVIITTQSRGNRQTKKYPCLFICLITRVIPLEMLYRLGTDSFIHSFKRFIEQRG 2259
            +S W  L R      RF +N R P  +R  GD+ + +IED   + I++ Q+  F        + E   +SK   L   ++ + +V R N   +     E     +  + IIL  KS+VT LI        +H G    L   L+ ++ ++ GR      EKE +   + K K       I+A  P     Y +       A DY G  IT Q+R  R+ K+  CLF CL +R + +EM Y L TD+F+++F R + +RG
Sbjct: 1501 FSSWTKLIRIQAWVHRFVDNCRSPNRER--GDLNLEKIEDIAVQVIKDAQRKAFPIEYLALQRRELPKKSKLLGLQPWLDEEGQV-RCN---RRLRYAEFL-PQDACFLIILPRKSYVTKLIDKHYHEKDDHAGGTNQLLAALSTRFWIISGREEICEWEKECNECRRRKAKA---AKQIMAPLPQIRLRYSLRA-FAQTAVDYGGPFITVQARRPRRQKRNLCLFTCLASRAVYVEMAYALDTDAFLNAFYRMVNRRG 1748          
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Match: A0A2B4SSQ9 (DUF5641 domain-containing protein OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene3220 PE=4 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.015e-12
Identity = 43/108 (39.81%), Postives = 63/108 (58.33%), Query Frame = 1
Query:  880 EIWQQAGMETRKWVTNDGEVLETLPIEMISEFIHLDEKSDISVKTLGVVVWYASGDKFGFNIRR-INKENISKRGFFSGLAKIFDPLVLDGAFLVRGKMLMQEIWIAG 1200
            E+W  AGM  RKW++N  EVL+++P    +  + LD      VKTLG V+W      F F + +   K + +KR F  G+A +FDPL L   + VR K+L+QE+W +G
Sbjct:   19 ELWGSAGMYARKWLSNKLEVLQSIPSSDCATEVDLDSGELPQVKTLG-VLWSPVEYVFKFQVNQPAEKCDQTKRNFLKGIATLFDPLGLLTPYTVRAKILLQEMWASG 125          
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Match: SMESG000017840.1 (SMESG000017840.1)

HSP 1 Score: 169.088 bits (427), Expect = 1.952e-53
Identity = 84/108 (77.78%), Postives = 93/108 (86.11%), Query Frame = 1
Query:  880 EIWQQAGMETRKWVTNDGEVLETLPIEMISEFIHLDEKSDISVKTLGVVVWYASGDKFGFNIRRINKENISKRGFFSGLAKIFDPLVLDGAFLVRGKMLMQEIWIAGS 1203
            EIWQ  GM+TRKW+TNDG+VLET+ IEM S+FI+LDEKSDISVKTLGVV WYAS DK GFN+RRINK  ISKR   S LAKIFDPL L GAFLVRGK+LMQEIWIAG+
Sbjct:  596 EIWQHVGMQTRKWLTNDGQVLETIQIEMRSKFINLDEKSDISVKTLGVV-WYASEDKLGFNVRRINKGKISKRELLSCLAKIFDPLGLAGAFLVRGKILMQEIWIAGT 702          

HSP 2 Score: 52.7582 bits (125), Expect = 1.952e-53
Identity = 31/56 (55.36%), Postives = 34/56 (60.71%), Query Frame = 2
Query:  755 ISIFLAQLLTRCNPEQLHSKHST--------------MDSFGTWRKLIRIKNELIE 880
            IS FLAQL+TR N E+ HSKH T              MDSFGT  + IRIKNELIE
Sbjct:  541 ISPFLAQLVTRRNAEKFHSKHPTASDTIVNSTLMDYTMDSFGTTEETIRIKNELIE 596          

HSP 3 Score: 29.261 bits (64), Expect = 1.952e-53
Identity = 17/28 (60.71%), Postives = 19/28 (67.86%), Query Frame = 3
Query:  696 KFHWE-GGNIE---FEILDFGLNIYPYF 767
            +F WE GGNIE   FE L FGLNI P+ 
Sbjct:  518 RFLWEEGGNIEGFEFERLVFGLNISPFL 545          
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Match: SMESG000022805.1 (SMESG000022805.1)

HSP 1 Score: 99.7525 bits (247), Expect = 9.312e-22
Identity = 49/108 (45.37%), Postives = 74/108 (68.52%), Query Frame = 1
Query:  880 EIWQQAGMETRKWVTNDGEVLETLPIEMISEFIHLDEKSDISVKTLGVVVWYASGDKFGFNIRRINKENISKRGFFSGLAKIFDPLVLDGAFLVRGKMLMQEIWIAGS 1203
            EIW +AGM T+KW++N  +VLE +PIE  +  + + E+  +++KTLG+  W A+ D F F+++    E ++KR   S +A+IFDPL    AF+VRGKM+MQ IWI G+
Sbjct:  166 EIWNKAGMRTQKWMSNSKKVLENVPIENRAIKLDIKEEGSMTMKTLGLR-WVANLDVFEFSVKAFESETLTKRLLLSWIARIFDPLGFLAAFVVRGKMIMQSIWITGA 272          
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Match: SMESG000021004.1 (SMESG000021004.1)

HSP 1 Score: 98.9821 bits (245), Expect = 4.595e-21
Identity = 48/108 (44.44%), Postives = 75/108 (69.44%), Query Frame = 1
Query:  880 EIWQQAGMETRKWVTNDGEVLETLPIEMISEFIHLDEKSDISVKTLGVVVWYASGDKFGFNIRRINKENISKRGFFSGLAKIFDPLVLDGAFLVRGKMLMQEIWIAGS 1203
            EIW +AGM T+KW++N  +VLE +PIE  +  + ++E+  +++KTLG+  W A+ D F F+++    E ++KR   S +A+IFDPL    AF+VRG+M+MQ IWI G+
Sbjct:  468 EIWNKAGMRTQKWMSNSTKVLENVPIENRAIKLDIEEEGSMTMKTLGLR-WVANLDVFEFSVKAFESETLTKRLLLSWIARIFDPLGFLAAFVVRGEMIMQSIWITGA 574          
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Match: SMESG000053711.1 (SMESG000053711.1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.475e-20
Identity = 48/108 (44.44%), Postives = 75/108 (69.44%), Query Frame = 1
Query:  880 EIWQQAGMETRKWVTNDGEVLETLPIEMISEFIHLDEKSDISVKTLGVVVWYASGDKFGFNIRRINKENISKRGFFSGLAKIFDPLVLDGAFLVRGKMLMQEIWIAGS 1203
            EIW +AGM T+KW++N  +VLE +PIE  +  + ++E+  +++KTLG+  W A+ D F F+++    E ++KR   S +A+IFDPL    AF+VRGK++MQ IWI G+
Sbjct:  563 EIWNKAGMRTQKWMSNSTKVLENVPIENRAIKLDIEEEGSMTMKTLGLR-WVANLDVFEFSVKAFESETLTKRLLLSWIARIFDPLGFLAAFVVRGKIIMQSIWIIGA 669          

HSP 2 Score: 77.7962 bits (190), Expect = 2.589e-14
Identity = 53/156 (33.97%), Postives = 75/156 (48.08%), Query Frame = 1
Query: 1819 NNKIYRIILSGKSWVTWLI------ATEHYGRLEYLTPKLNEKYLVVGGRPFPEKEIHNLSKTKCKT*LTNHGIIAFFPSKLTFYRIHK*INNKAADYVGVIITTQSRGNRQTKKYPCLFICLITRVIPLEMLYRLGTDSFIHSFKRFIEQRGTKL 2268
            NN  Y IILS +SW+  LI        +HY  + +   +LN +Y VV  R   +K I    + + +       I+A  PS   F    +     A D+ G   T Q     + K+Y CLF CL TR + LE+ Y L TD+FI +F RF+ +R   L
Sbjct:  923 NNTRYPIILSDESWIARLIIRGLHIKNKHYAGVNHTLGELNREYWVVCARWLIKKCIKGCFECRRRKAKGMEQIMATLPS-FRFQEPLQAFARIAVDFAGPFETIQGSAKTRQKRYMCLFTCLQTRAVHLEVAYALDTDAFILAFIRFMGRRRKPL 1077          
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Match: SMESG000058166.1 (SMESG000058166.1)

HSP 1 Score: 97.4413 bits (241), Expect = 2.848e-20
Identity = 48/108 (44.44%), Postives = 73/108 (67.59%), Query Frame = 1
Query:  880 EIWQQAGMETRKWVTNDGEVLETLPIEMISEFIHLDEKSDISVKTLGVVVWYASGDKFGFNIRRINKENISKRGFFSGLAKIFDPLVLDGAFLVRGKMLMQEIWIAGS 1203
            EIW +AGM T+KW++N  +VLE +PIE  +  + ++E+  +++K LG+  W  + D F F+I+    E ++KR   S +A+IFDPL    AF+VRGKM+MQ IWI G+
Sbjct: 1240 EIWNKAGMRTQKWMSNSTKVLENVPIENRAIKLDIEEEGSMTMKALGLR-WVTNLDVFEFSIKSFESETLTKRLLLSWIARIFDPLGFLAAFVVRGKMIMQSIWITGA 1346          
The following BLAST results are available for this feature:
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4RBS55.069e-1428.00Uncharacterized protein OS=Stylophora pistillata O... [more]
A0A2B4SD703.252e-1237.96Uncharacterized protein OS=Stylophora pistillata O... [more]
A0A2G8KMP06.284e-1235.76Integrase_H2C2 domain-containing protein OS=Sticho... [more]
A0A2B4RBG66.804e-1229.73Nucleotide-binding oligomerization domain-containi... [more]
A0A2B4SSQ97.015e-1239.81DUF5641 domain-containing protein OS=Stylophora pi... [more]
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integrase catalytic domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017840.11.952e-5377.78SMESG000017840.1[more]
SMESG000022805.19.312e-2245.37SMESG000022805.1[more]
SMESG000021004.14.595e-2144.44SMESG000021004.1[more]
SMESG000053711.11.475e-2044.44SMESG000053711.1[more]
SMESG000058166.12.848e-2044.44SMESG000058166.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017119 ID=SMED30017119|Name=Integrase catalytic domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2730bp
AATTGTTAAGATGTATCTCCGTGGCATTAATTTGATGACGTATATCTAAG
AATATCAAATTTTCGTGATAGAAATCGATTTATATTTGCATCAGCCTGTG
ATGCCAATTATCAATTTTTCAAATAATGTGATGCGTGATTCAATTATCCG
ATAATTTGATCAGTTTTATTCATTTTTAATCAATCGCAATGATACGATTC
AATATATTTTTAGTTTTAGTTGTTTGTAGTTTCATATTTTCACTTCATTT
CGTAAATAGTTGGATAGTTATGGACGAAAAGCAGATACGATTTGCGATTC
CGAATTGTACGTACTCAACCGGAACGAATGTAGCGTGTGATTTTAGTAAT
TTGCATGACTGCTTATTATGGTGCGGTCAGTGCTGTGACTGGAATTCTTT
AATATGCTGTGATTATTAACGATCAGATCAGCACTTGATCAAGTTACCTA
CATGCAAAAAAATTTTCGCAATTTAATTACCAGATATTTTTTGGACTTGA
TTTTTTGAAAAATTTCTTTTCGGAATATTATAGAGTTCGTTGAAAATTTC
TACTTTGTTTAACAACTATTTCATATCTCATTTGGAGTGATTAAAAATAT
TGGGGAAAATTCCTCCGAAAAAATTTGCGGTCTTACAAATCATTATCAGT
TATCGAGCACCCTTCCGAGCAGCTCTACTTCTAGCAGAAAACTAAAAATT
TCATTGGGAAGGTGGAAATATTGAATTTGAAATATTAGATTTTGGGTTGA
ATATATATCCATATTTTTGGCGCAGTTATTAACACGATGTAATCCAGAGC
AATTGCACTCAAAGCATTCTACTATGGATTCTTTTGGGACGTGGAGGAAA
CTAATAAGAATAAAAAATGAGTTAATCGAGAAATTTGGCAACAAGCGGGG
ATGGAGACTAGGAAGTGGGTTACAAATGATGGAGAAGTTTTAGAAACATT
ACCAATCGAAATGATCTCAGAGTTTATTCATTTGGATGAAAAATCAGATA
TATCTGTTAAAACACTTGGAGTGGTGGTTTGGTATGCTTCTGGGGATAAA
TTCGGATTTAATATTCGAAGAATAAATAAAGAAAATATTTCCAAACGTGG
GTTTTTCAGTGGTTTGGCAAAAATATTTGATCCTCTAGTTTTGGATGGAG
CGTTTTTGGTTAGAGGAAAAATGCTTATGCAGGAAATTTGGATAGCTGGA
TCTTAGGATTGAAGATAGGCGAAAGTTTGAAATGAAATATTTAAAGACAG
ACAGTGAAGGTATTTTATATTGAATTACGCAATTGGGACGAAATTGTAAA
GTTTTTATTGCAAACAGAATTGGTTGAAATTCAGAGGTTGACAAAAAGTA
CCCAATGGAGATATACTAACAAAAGAGTGTTCTACAGATTTTTGGTTGCG
TGAACCGTCATTTCTGAAAGAGAAAGTACCTGGCAGACGTGAAATAACCA
ACATTTAAACAACATTGAGGTCAGATACAGACAAGCGAGCACTTTTATGA
CAAAGAAAGAGTATGTACAGGAATGATCATTTCGGTTTTAACAAGTTGCT
AGAATATTCGAGATGGATAAATCTTACCCGTGCAAGGTTTTATGAGAATT
CAAGATTGCCAATGAACAAACGATACATTGGTGATATGACTGTATTGGAG
ATTGAGGATCCTGAATTTAAATAAATTCAAGAGGATCAAAAAGTCGAATT
TAAGGAAGAATGGAATTGTAGGAGCAAAAACCTGCATAAAATGATTGAGT
CCAAAAATGAAGTTTGACGGGTCAATACGAAGTGAAAGTCGTTTGGCCAA
TGTGAACTGGCTTGAATCAATAACAAAATATATCGAATAATTCTCTCCGG
GAAAAGTTGGGTGACATGGTTGATAGCGACGGAGCATTATGGGAGACTAG
AATACTTGACTCCAAAATTAAATGAAAAATATTTGGTTGTGGGTGGACGA
CCATTTCCTGAGAAAGAAATCCATAACTTGTCGAAAACTAAGTGCAAAAC
CTAGCTCACAAATCATGGCATCATTGCCTTCTTTCCGAGTAAATTAACCT
TTTACAGAATTCACAAATGAATTAATAATAAAGCAGCAGATTATGTCGGG
GTAATAATTACAACTCAAAGTCGTGGTAATCGACAAACAAAAAAGTACCC
ATGTTTGTTCATCTGTTTAATAACACGAGTAATACCCCTGGAAATGTTAT
ATCGATTGGGCACAGACAGTTTCATTCATTCTTTCAAACGGTTTATCGAA
CAACGTGGGACCAAACTTTGTAGGAGTGACAAAGTAAATTAAGAAATCAA
TATCGACACTTATGGAATAAAGATAATTGCACAGACTTTATGAAGTCATG
ATTATGTGGACAATTCATGCTAAATATCGCGACTTGGTCGAAAGAATTAG
ACGTGCACATAAATATACGCAAACATAAATCTGTTATTGCTGTGCTTTAC
TTTATATCGTAATTTTTATTTAATTTGAATGAATCGTGCACAAATCGATT
AGAGAAGCTAAAAAGGCATTAAAGGGGTTAAAGAAGCGATGATTATGAGA
AGACGCAAAGTGATTGAAGAGACAAATATCAAATTTTGGAGAAAAGAGGT
TATGATGGGGTGGCTATATAAACATTTTGATGAAATGTCGGGATTTAGTG
AGGAAGAAGATTGAAATTTGTTAAATAAAATCAATTTTCTTTTCGATACC
AGCTTGAGTGATAATTTCTTTTGTTGCGTT
back to top

protein sequence of SMED30017119-orf-1

>SMED30017119-orf-1 ID=SMED30017119-orf-1|Name=SMED30017119-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=102bp
METRKWVTNDGEVLETLPIEMISEFIHLDEKSDISVKTLGVVVWYASGDK
FGFNIRRINKENISKRGFFSGLAKIFDPLVLDGAFLVRGKMLMQEIWIAG
S*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008042Retrotrans_Pao
IPR023388Bacteriocin_IIa_dom
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008042Retrotransposon, PaoPFAMPF05380Peptidase_A17coord: 64..98
e-value: 2.0E-5
score: 24.6