Elongation factor 1-gamma

Overview
NameElongation factor 1-gamma
Smed IDSMED30017114
Length (bp)1374
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Elongation factor 1-gamma (SMED30017114) t-SNE clustered cells

Violin plots show distribution of expression levels for Elongation factor 1-gamma (SMED30017114) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Elongation factor 1-gamma (SMED30017114) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Elongation factor 1-gamma (SMED30017114) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017114

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30017114SMESG000018714.1 dd_Smed_v4_308_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017114SMESG000018714.1 dd_Smed_v4_308_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30017114SMESG000018714.1 dd_Smed_v4_308_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017114SMESG000018714.1 dd_Smed_v4_308_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017114SMESG000018714.1 dd_Smed_v4_308_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017114SMESG000018714.1 dd_Smed_v4_308_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017114SMESG000018714.1 dd_Smed_v4_308_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017114SMESG000018714.1 dd_Smed_v4_308_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30017114SMESG000018714.1 dd_Smed_v4_308_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30017114SMESG000018714.1 dd_Smed_v4_308_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017114SMESG000018714.1 Contig41609uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017114SMESG000018714.1 Contig41609newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30017114SMESG000018714.1 dd_Smed_v6_308_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017114SMESG000018714.1 dd_Smed_v6_308_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30017114SMESG000018714.1 dd_Smed_v6_308_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30017114SMESG000018714.1 NB.21.6bsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Category 4 cellSMED30017114SMESG000018714.1 NB.21.6bsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Elongation factor 1-gamma vs. Ensembl Human
Match: EEF1G (eukaryotic translation elongation factor 1 gamma [Source:HGNC Symbol;Acc:HGNC:3213])

HSP 1 Score: 342.813 bits (878), Expect = 1.152e-113
Identity = 191/438 (43.61%), Postives = 270/438 (61.64%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENP----------VPENLV-VPKGSVPVYCEGDVTF--FETNAIGYHLSNEQLRGNQNQAS--VAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF---GMPFNQGKIFK 1360
            M+ G LY   + ++  +  I A+YS  ++     P           PE L   P G VP + EGD  F  FE+NAI Y++SNE+LRG+  +A+  V QW ++AD  ++P   T VFP LG+M  NK   E AK  +   +  ++ +L TRT+LVGER+T ADIT+   L  LY+ +L+   R  F N NRWFLT  NQ   ++V+GE+KLC   A FDAKK+AE   KKD   K+   ++ ++K + +++++ K       E      +      +   P++ LPK TF ++E+KR YSN D ++VALPYFW  FD + +S+W  EY FP+EL   FM+CNL++GMFQRLD+LRK+AF S+++ G N ++ I G+WV +GQ+LAF L  D +VDYESY W KLDP +E T+ LV+ YF+ EG F   G  FNQGKIFK
Sbjct:    1 MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAF-EGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK 437          
BLAST of Elongation factor 1-gamma vs. Ensembl Human
Match: VARS1 (valyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:12651])

HSP 1 Score: 74.3294 bits (181), Expect = 7.242e-14
Identity = 37/122 (30.33%), Postives = 63/122 (51.64%), Query Frame = 2
Query:  335 GNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKL 700
            G++    V QW +YAD  L+PA      P LGL + +  + +     +   ++ + ++L   TYL GE  T AD+   + L + +  +LD   R  + N+ RWF+T   Q   ++V+GE+ L
Sbjct:   89 GSRAAVLVQQWVSYADTELIPAACGATLPALGL-RSSAQDPQAVLGALGRALSPLEEWLRLHTYLAGEAPTLADLAAVTALLLPFRYVLDPPARRIWNNVTRWFVTCVRQPEFRAVLGEVVL 209          
BLAST of Elongation factor 1-gamma vs. Ensembl Human
Match: VARS1 (valyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:12651])

HSP 1 Score: 73.1738 bits (178), Expect = 5.174e-13
Identity = 37/122 (30.33%), Postives = 63/122 (51.64%), Query Frame = 2
Query:  335 GNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKL 700
            G++    V QW +YAD  L+PA      P LGL + +  + +     +   ++ + ++L   TYL GE  T AD+   + L + +  +LD   R  + N+ RWF+T   Q   ++V+GE+ L
Sbjct:   89 GSRAAVLVQQWVSYADTELIPAACGATLPALGL-RSSAQDPQAVLGALGRALSPLEEWLRLHTYLAGEAPTLADLAAVTALLLPFRYVLDPPARRIWNNVTRWFVTCVRQPEFRAVLGEVVL 209          
BLAST of Elongation factor 1-gamma vs. Ensembl Human
Match: VARS1 (valyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:12651])

HSP 1 Score: 73.1738 bits (178), Expect = 5.174e-13
Identity = 37/122 (30.33%), Postives = 63/122 (51.64%), Query Frame = 2
Query:  335 GNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKL 700
            G++    V QW +YAD  L+PA      P LGL + +  + +     +   ++ + ++L   TYL GE  T AD+   + L + +  +LD   R  + N+ RWF+T   Q   ++V+GE+ L
Sbjct:   89 GSRAAVLVQQWVSYADTELIPAACGATLPALGL-RSSAQDPQAVLGALGRALSPLEEWLRLHTYLAGEAPTLADLAAVTALLLPFRYVLDPPARRIWNNVTRWFVTCVRQPEFRAVLGEVVL 209          
BLAST of Elongation factor 1-gamma vs. Ensembl Human
Match: VARS1 (valyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HGNC:12651])

HSP 1 Score: 73.1738 bits (178), Expect = 5.174e-13
Identity = 37/122 (30.33%), Postives = 63/122 (51.64%), Query Frame = 2
Query:  335 GNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKL 700
            G++    V QW +YAD  L+PA      P LGL + +  + +     +   ++ + ++L   TYL GE  T AD+   + L + +  +LD   R  + N+ RWF+T   Q   ++V+GE+ L
Sbjct:   89 GSRAAVLVQQWVSYADTELIPAACGATLPALGL-RSSAQDPQAVLGALGRALSPLEEWLRLHTYLAGEAPTLADLAAVTALLLPFRYVLDPPARRIWNNVTRWFVTCVRQPEFRAVLGEVVL 209          
BLAST of Elongation factor 1-gamma vs. Ensembl Celegans
Match: eef-1G (Probable elongation factor 1-gamma [Source:UniProtKB/Swiss-Prot;Acc:P54412])

HSP 1 Score: 303.138 bits (775), Expect = 3.770e-99
Identity = 167/413 (40.44%), Postives = 243/413 (58.84%), Query Frame = 2
Query:  125 GVLYGPADFYKTQRLQIIAKYSSKEIEFSENPVPENLVVPKGSVPVYCEGDVTFFETNAIGYHLSNEQLRGNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF-GMPFNQGKIFK 1360
            G LYG  D ++TQ++ I AK ++K +  + +  P +   P G  P + EGD   F   +IG HL+     G    A   QW  +A+  LLPA+   V P +     +K   E+ KN +N ++  +++ L  +TYLVGERL+ AD+++   L   ++ +LD   R   VN+ RWF T+ NQ  VK V+GE+ L  + A F+  K+ EL  K  K   K ++ K + K      +    E +EE   +          P+  +PKGTF ++ +KR+YSN D  T A+P+FW  FD++N+SIW CEY +P++L L FM+CNL++GM+QRL++L+K+AF SM++ G + N+ I G+WV KG  LAF L  D +VDYESY W KLD  ++ATK  V  Y   EGDF G  FNQGKIFK
Sbjct:    3 GKLYGNKDNFRTQKVLIAAKLANKTVTLAGDAAPAD-KFPLGVTPAF-EGDALLFGAESIGLHLT-----GTSANAETVQWLQFAEGYLLPAVLGYVLPSVSAANFDKKTVEQYKNELNGQLQVLDRVLVKKTYLVGERLSLADVSVALDLLPAFQYVLDANARKSIVNVTRWFRTVVNQPAVKEVLGEVSLASSVAQFNQAKFTELSAKVAKSAPKAEKPKKEAKPAAAAAQPEDDEPKEEKSKD----------PFQDMPKGTFVLDNFKRSYSNEDTATKAIPHFWENFDADNWSIWKCEYKYPEDLTLAFMSCNLINGMYQRLEKLKKNAFASMILFGTDNNSTISGIWVWKGDKLAFELSPDWQVDYESYTWTKLDAKSDATKKEVNEYLMWEGDFGGKKFNQGKIFK 398          
BLAST of Elongation factor 1-gamma vs. Ensembl Celegans
Match: eef-1G (Probable elongation factor 1-gamma [Source:UniProtKB/Swiss-Prot;Acc:P54412])

HSP 1 Score: 303.138 bits (775), Expect = 3.770e-99
Identity = 167/413 (40.44%), Postives = 243/413 (58.84%), Query Frame = 2
Query:  125 GVLYGPADFYKTQRLQIIAKYSSKEIEFSENPVPENLVVPKGSVPVYCEGDVTFFETNAIGYHLSNEQLRGNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF-GMPFNQGKIFK 1360
            G LYG  D ++TQ++ I AK ++K +  + +  P +   P G  P + EGD   F   +IG HL+     G    A   QW  +A+  LLPA+   V P +     +K   E+ KN +N ++  +++ L  +TYLVGERL+ AD+++   L   ++ +LD   R   VN+ RWF T+ NQ  VK V+GE+ L  + A F+  K+ EL  K  K   K ++ K + K      +    E +EE   +          P+  +PKGTF ++ +KR+YSN D  T A+P+FW  FD++N+SIW CEY +P++L L FM+CNL++GM+QRL++L+K+AF SM++ G + N+ I G+WV KG  LAF L  D +VDYESY W KLD  ++ATK  V  Y   EGDF G  FNQGKIFK
Sbjct:    3 GKLYGNKDNFRTQKVLIAAKLANKTVTLAGDAAPAD-KFPLGVTPAF-EGDALLFGAESIGLHLT-----GTSANAETVQWLQFAEGYLLPAVLGYVLPSVSAANFDKKTVEQYKNELNGQLQVLDRVLVKKTYLVGERLSLADVSVALDLLPAFQYVLDANARKSIVNVTRWFRTVVNQPAVKEVLGEVSLASSVAQFNQAKFTELSAKVAKSAPKAEKPKKEAKPAAAAAQPEDDEPKEEKSKD----------PFQDMPKGTFVLDNFKRSYSNEDTATKAIPHFWENFDADNWSIWKCEYKYPEDLTLAFMSCNLINGMYQRLEKLKKNAFASMILFGTDNNSTISGIWVWKGDKLAFELSPDWQVDYESYTWTKLDAKSDATKKEVNEYLMWEGDFGGKKFNQGKIFK 398          
BLAST of Elongation factor 1-gamma vs. Ensembl Celegans
Match: eef-1G (Probable elongation factor 1-gamma [Source:UniProtKB/Swiss-Prot;Acc:P54412])

HSP 1 Score: 280.026 bits (715), Expect = 1.642e-90
Identity = 152/365 (41.64%), Postives = 217/365 (59.45%), Query Frame = 2
Query:  269 EGDVTFFETNAIGYHLSNEQLRGNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF-GMPFNQGKIFK 1360
            EGD   F   +IG HL+     G    A   QW  +A+  LLPA+   V P +     +K   E+ KN +N ++  +++ L  +TYLVGERL+ AD+++   L   ++ +LD   R   VN+ RWF T+ NQ  VK V+GE+ L  + A F+  K+ EL  K  K   K ++ K + K      +    E +EE   +          P+  +PKGTF ++ +KR+YSN D  T A+P+FW  FD++N+SIW CEY +P++L L FM+CNL++GM+QRL++L+K+AF SM++ G + N+ I G+WV KG  LAF L  D +VDYESY W KLD  ++ATK  V  Y   EGDF G  FNQGKIFK
Sbjct:   24 EGDALLFGAESIGLHLT-----GTSANAETVQWLQFAEGYLLPAVLGYVLPSVSAANFDKKTVEQYKNELNGQLQVLDRVLVKKTYLVGERLSLADVSVALDLLPAFQYVLDANARKSIVNVTRWFRTVVNQPAVKEVLGEVSLASSVAQFNQAKFTELSAKVAKSAPKAEKPKKEAKPAAAAAQPEDDEPKEEKSKD----------PFQDMPKGTFVLDNFKRSYSNEDTATKAIPHFWENFDADNWSIWKCEYKYPEDLTLAFMSCNLINGMYQRLEKLKKNAFASMILFGTDNNSTISGIWVWKGDKLAFELSPDWQVDYESYTWTKLDAKSDATKKEVNEYLMWEGDFGGKKFNQGKIFK 373          
BLAST of Elongation factor 1-gamma vs. Ensembl Celegans
Match: eef-1G (Probable elongation factor 1-gamma [Source:UniProtKB/Swiss-Prot;Acc:P54412])

HSP 1 Score: 280.026 bits (715), Expect = 1.642e-90
Identity = 152/365 (41.64%), Postives = 217/365 (59.45%), Query Frame = 2
Query:  269 EGDVTFFETNAIGYHLSNEQLRGNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF-GMPFNQGKIFK 1360
            EGD   F   +IG HL+     G    A   QW  +A+  LLPA+   V P +     +K   E+ KN +N ++  +++ L  +TYLVGERL+ AD+++   L   ++ +LD   R   VN+ RWF T+ NQ  VK V+GE+ L  + A F+  K+ EL  K  K   K ++ K + K      +    E +EE   +          P+  +PKGTF ++ +KR+YSN D  T A+P+FW  FD++N+SIW CEY +P++L L FM+CNL++GM+QRL++L+K+AF SM++ G + N+ I G+WV KG  LAF L  D +VDYESY W KLD  ++ATK  V  Y   EGDF G  FNQGKIFK
Sbjct:   24 EGDALLFGAESIGLHLT-----GTSANAETVQWLQFAEGYLLPAVLGYVLPSVSAANFDKKTVEQYKNELNGQLQVLDRVLVKKTYLVGERLSLADVSVALDLLPAFQYVLDANARKSIVNVTRWFRTVVNQPAVKEVLGEVSLASSVAQFNQAKFTELSAKVAKSAPKAEKPKKEAKPAAAAAQPEDDEPKEEKSKD----------PFQDMPKGTFVLDNFKRSYSNEDTATKAIPHFWENFDADNWSIWKCEYKYPEDLTLAFMSCNLINGMYQRLEKLKKNAFASMILFGTDNNSTISGIWVWKGDKLAFELSPDWQVDYESYTWTKLDAKSDATKKEVNEYLMWEGDFGGKKFNQGKIFK 373          
BLAST of Elongation factor 1-gamma vs. Ensembl Celegans
Match: eef-1G (Probable elongation factor 1-gamma [Source:UniProtKB/Swiss-Prot;Acc:P54412])

HSP 1 Score: 280.026 bits (715), Expect = 1.642e-90
Identity = 152/365 (41.64%), Postives = 217/365 (59.45%), Query Frame = 2
Query:  269 EGDVTFFETNAIGYHLSNEQLRGNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF-GMPFNQGKIFK 1360
            EGD   F   +IG HL+     G    A   QW  +A+  LLPA+   V P +     +K   E+ KN +N ++  +++ L  +TYLVGERL+ AD+++   L   ++ +LD   R   VN+ RWF T+ NQ  VK V+GE+ L  + A F+  K+ EL  K  K   K ++ K + K      +    E +EE   +          P+  +PKGTF ++ +KR+YSN D  T A+P+FW  FD++N+SIW CEY +P++L L FM+CNL++GM+QRL++L+K+AF SM++ G + N+ I G+WV KG  LAF L  D +VDYESY W KLD  ++ATK  V  Y   EGDF G  FNQGKIFK
Sbjct:   24 EGDALLFGAESIGLHLT-----GTSANAETVQWLQFAEGYLLPAVLGYVLPSVSAANFDKKTVEQYKNELNGQLQVLDRVLVKKTYLVGERLSLADVSVALDLLPAFQYVLDANARKSIVNVTRWFRTVVNQPAVKEVLGEVSLASSVAQFNQAKFTELSAKVAKSAPKAEKPKKEAKPAAAAAQPEDDEPKEEKSKD----------PFQDMPKGTFVLDNFKRSYSNEDTATKAIPHFWENFDADNWSIWKCEYKYPEDLTLAFMSCNLINGMYQRLEKLKKNAFASMILFGTDNNSTISGIWVWKGDKLAFELSPDWQVDYESYTWTKLDAKSDATKKEVNEYLMWEGDFGGKKFNQGKIFK 373          
BLAST of Elongation factor 1-gamma vs. Ensembl Fly
Match: eEF1gamma (gene:FBgn0029176 transcript:FBtr0302442)

HSP 1 Score: 301.597 bits (771), Expect = 4.354e-98
Identity = 183/434 (42.17%), Postives = 261/434 (60.14%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSEN-------PVPENLV-VPKGSVPVYCEGDVTFF-ETNAIGYHLSNEQLRGNQN---QASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPCP-----YSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEG--DFGMPFNQGKIFK 1360
            M KG LY   + ++  +  I A+YS  +++ ++N          E L   P G VP +   +  +  E+NAI Y L+NEQLRG +    QA V QW ++AD  ++PA    VFP LG++   K  N  AK      +  +N+ L   T+L GER+T ADI +FS L  LYE +L+   R+ F N+NRWF+TI NQ+ V++VV + KLC     FD KKYAE   K    + + + ++ +++++ K++K+  K+  E AE  D         P     +  LPKGTF+ +++KR YSN D    ++PYF+ KFD+ENYSIW  EY + +EL  +FM+CNL++GMFQRLD++RK AF S+ + GE+ N+ I G+WV +GQDLAFTL  D ++DYE Y W KLD  +E TK LV  YF+  G    G  FNQGKIFK
Sbjct:    1 MVKGTLYTYPENFRAYKALIAAQYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSESNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQK--NSTAKQEAEAVLQQLNQKLQDATFLAGERITLADIVVFSSLLHLYEYVLEPSVRSAFGNVNRWFVTILNQKQVQAVVKDYKLCEKALVFDPKKYAEFQAKTGAAKPQQQAQQQKQEKKPKEKKEAPKKAAEPAEELDAADEALAAEPKSKDPFDALPKGTFNFDDFKRVYSNEDEAK-SIPYFFDKFDAENYSIWFGEYKYNEELSKVFMSCNLITGMFQRLDKMRKAAFASVCLFGEDGNSTISGIWVWRGQDLAFTLSPDWQIDYEVYDWKKLDAKSEETKKLVTQYFSWSGTDKDGRKFNQGKIFK 431          
BLAST of Elongation factor 1-gamma vs. Ensembl Fly
Match: eEF1gamma (gene:FBgn0029176 transcript:FBtr0085393)

HSP 1 Score: 301.597 bits (771), Expect = 4.354e-98
Identity = 183/434 (42.17%), Postives = 261/434 (60.14%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSEN-------PVPENLV-VPKGSVPVYCEGDVTFF-ETNAIGYHLSNEQLRGNQN---QASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPCP-----YSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEG--DFGMPFNQGKIFK 1360
            M KG LY   + ++  +  I A+YS  +++ ++N          E L   P G VP +   +  +  E+NAI Y L+NEQLRG +    QA V QW ++AD  ++PA    VFP LG++   K  N  AK      +  +N+ L   T+L GER+T ADI +FS L  LYE +L+   R+ F N+NRWF+TI NQ+ V++VV + KLC     FD KKYAE   K    + + + ++ +++++ K++K+  K+  E AE  D         P     +  LPKGTF+ +++KR YSN D    ++PYF+ KFD+ENYSIW  EY + +EL  +FM+CNL++GMFQRLD++RK AF S+ + GE+ N+ I G+WV +GQDLAFTL  D ++DYE Y W KLD  +E TK LV  YF+  G    G  FNQGKIFK
Sbjct:    1 MVKGTLYTYPENFRAYKALIAAQYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSESNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQK--NSTAKQEAEAVLQQLNQKLQDATFLAGERITLADIVVFSSLLHLYEYVLEPSVRSAFGNVNRWFVTILNQKQVQAVVKDYKLCEKALVFDPKKYAEFQAKTGAAKPQQQAQQQKQEKKPKEKKEAPKKAAEPAEELDAADEALAAEPKSKDPFDALPKGTFNFDDFKRVYSNEDEAK-SIPYFFDKFDAENYSIWFGEYKYNEELSKVFMSCNLITGMFQRLDKMRKAAFASVCLFGEDGNSTISGIWVWRGQDLAFTLSPDWQIDYEVYDWKKLDAKSEETKKLVTQYFSWSGTDKDGRKFNQGKIFK 431          
BLAST of Elongation factor 1-gamma vs. Ensembl Fly
Match: eEF1gamma (gene:FBgn0029176 transcript:FBtr0085392)

HSP 1 Score: 301.597 bits (771), Expect = 4.354e-98
Identity = 183/434 (42.17%), Postives = 261/434 (60.14%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSEN-------PVPENLV-VPKGSVPVYCEGDVTFF-ETNAIGYHLSNEQLRGNQN---QASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPCP-----YSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEG--DFGMPFNQGKIFK 1360
            M KG LY   + ++  +  I A+YS  +++ ++N          E L   P G VP +   +  +  E+NAI Y L+NEQLRG +    QA V QW ++AD  ++PA    VFP LG++   K  N  AK      +  +N+ L   T+L GER+T ADI +FS L  LYE +L+   R+ F N+NRWF+TI NQ+ V++VV + KLC     FD KKYAE   K    + + + ++ +++++ K++K+  K+  E AE  D         P     +  LPKGTF+ +++KR YSN D    ++PYF+ KFD+ENYSIW  EY + +EL  +FM+CNL++GMFQRLD++RK AF S+ + GE+ N+ I G+WV +GQDLAFTL  D ++DYE Y W KLD  +E TK LV  YF+  G    G  FNQGKIFK
Sbjct:    1 MVKGTLYTYPENFRAYKALIAAQYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSESNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQK--NSTAKQEAEAVLQQLNQKLQDATFLAGERITLADIVVFSSLLHLYEYVLEPSVRSAFGNVNRWFVTILNQKQVQAVVKDYKLCEKALVFDPKKYAEFQAKTGAAKPQQQAQQQKQEKKPKEKKEAPKKAAEPAEELDAADEALAAEPKSKDPFDALPKGTFNFDDFKRVYSNEDEAK-SIPYFFDKFDAENYSIWFGEYKYNEELSKVFMSCNLITGMFQRLDKMRKAAFASVCLFGEDGNSTISGIWVWRGQDLAFTLSPDWQIDYEVYDWKKLDAKSEETKKLVTQYFSWSGTDKDGRKFNQGKIFK 431          
BLAST of Elongation factor 1-gamma vs. Ensembl Zebrafish
Match: eef1g (eukaryotic translation elongation factor 1 gamma [Source:NCBI gene;Acc:195822])

HSP 1 Score: 339.347 bits (869), Expect = 2.046e-112
Identity = 202/443 (45.60%), Postives = 278/443 (62.75%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENP----------VPENLV-VPKGSVPVYCEGDVTF--FETNAIGYHLSNEQLRGNQNQAS--VAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPCPYSLLPKG----------TFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF---GMPFNQGKIFK 1360
            M+ G LY   + ++  + QI A+YS   ++ +  P           P  L   P G VP Y +GD  F  FE+NAI ++LSN+ LRG+  QAS  V QW ++AD  ++P     VFP LG+MQ NK   E+AK  +   +  +N+ L+TRT+LVGER++ ADIT+   L  LY+ +L+   R P+ N+ RWF+T  NQ   K+V+GE+KLC   A FDAKK+AE+  KK+   KK K  K   KQ+ +Q++K +K+ EE+  A  E  + E     +  PK           +F M+E+KR YSN D +TVALPYFW  FD E +SIW  EY FP+EL + FM+CNL++GMFQRLD+LRK+AF S+++ G N ++ I G+WV +GQDLAF L DD ++DYESY W KLD ++E  K +VK YF  EG+F   G PFNQGKIFK
Sbjct:    1 MAAGTLYTYPENWRAFKAQIAAQYSGARLKIASAPPAFTFGQTNRSPAFLGNFPLGKVPAY-QGDDGFCLFESNAIAHYLSNDVLRGSTPQASAQVLQWVSFADSEVIPPASAWVFPTLGIMQFNKQATEQAKEEVKRVLAVLNQHLNTRTFLVGERISLADITVVCSLLWLYKQVLEPAFRQPYPNVTRWFVTCVNQPQFKTVLGEVKLCEKMAQFDAKKFAEMQPKKEAPIKKEKGGKEGGKQQPQQQEKKEKKKEEKKAAPAEEEMDECEAALASEPKAKDPFAHLPKSSFVMDEFKRKYSNEDTMTVALPYFWDHFDREGFSIWYAEYRFPEELTMAFMSCNLITGMFQRLDKLRKNAFASVILFGANNDSCISGIWVFRGQDLAFPLSDDWQIDYESYTWRKLDVDSEECKTMVKEYFAWEGEFKHVGKPFNQGKIFK 442          
BLAST of Elongation factor 1-gamma vs. Ensembl Zebrafish
Match: eef1g (eukaryotic translation elongation factor 1 gamma [Source:NCBI gene;Acc:195822])

HSP 1 Score: 140.969 bits (354), Expect = 1.393e-38
Identity = 63/108 (58.33%), Postives = 83/108 (76.85%), Query Frame = 2
Query: 1046 QELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF---GMPFNQGKIFK 1360
            +EL + FM+CNL++GMFQRLD+LRK+AF S+++ G N ++ I G+WV +GQDLAF L DD ++DYESY W KLD ++E  K +VK YF  EG+F   G PFNQGKIFK
Sbjct:  133 EELTMAFMSCNLITGMFQRLDKLRKNAFASVILFGANNDSCISGIWVFRGQDLAFPLSDDWQIDYESYTWRKLDVDSEECKTMVKEYFAWEGEFKHVGKPFNQGKIFK 240          

HSP 2 Score: 82.8037 bits (203), Expect = 1.657e-17
Identity = 60/171 (35.09%), Postives = 89/171 (52.05%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENP----------VPENLV-VPKGSVPVYCEGDVTF--FETNAIGYHLSNEQLRGNQNQAS--VAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQ---ADITLFSV 574
            M+ G LY   + ++  + QI A+YS   ++ +  P           P  L   P G VP Y +GD  F  FE+NAI ++LSN+ LRG+  QAS  V QW ++AD  ++P     VFP LG+MQ NK   E+AK  +   M F++  L T  +   ++L +   A + LF  
Sbjct:    1 MAAGTLYTYPENWRAFKAQIAAQYSGARLKIASAPPAFTFGQTNRSPAFLGNFPLGKVPAY-QGDDGFCLFESNAIAHYLSNDVLRGSTPQASAQVLQWVSFADSEVIPPASAWVFPTLGIMQFNKQATEQAKEELT--MAFMSCNLITGMFQRLDKLRKNAFASVILFGA 168          
BLAST of Elongation factor 1-gamma vs. Ensembl Zebrafish
Match: vars1 (valyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-010601-1])

HSP 1 Score: 74.7146 bits (182), Expect = 1.213e-13
Identity = 53/199 (26.63%), Postives = 91/199 (45.73%), Query Frame = 2
Query:  140 PADFYKTQRLQIIAKYSSKEIEFSENPVPENLVVPKGSVPVYCEGDVTFFETNAIGYHLSNEQLRGN---QNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLC-----VTP 712
            P DF     L I A +            P  L   + ++ +   G      T+A+ ++L+    R     + ++ V QW ++A+  L P    + FP LG+M ++K   + ++  +   +  ++  L+ RT+LVGE +T AD  +     + ++  L+   R   VN+ RWF T  NQ     V+G+I LC     VTP
Sbjct:   10 PDDFRSLLPL-IAAGFCPSPPRILHQDPPAELARSRPALVLAGAGGTVLSGTSAVSWYLAATGKRAGSDKKQESQVWQWLSFAENELTPVACAVAFPLLGIMGVDKKLQQSSRAELLRVLKALDGTLALRTFLVGESVTLADAAVAMAALLPFKYALEPADRKSLVNVTRWFNTCVNQPQFLKVLGKISLCEKMVPVTP 207          
BLAST of Elongation factor 1-gamma vs. Ensembl Xenopus
Match: eef1g (eukaryotic translation elongation factor 1 gamma [Source:NCBI gene;Acc:394875])

HSP 1 Score: 269.24 bits (687), Expect = 1.076e-86
Identity = 153/318 (48.11%), Postives = 205/318 (64.47%), Query Frame = 2
Query:  434 MQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-GPCPYSLLP-----KGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF---GMPFNQGKIFK 1360
            MQ NK   E+AK  I   +  ++  L TRT+LVGER+T ADI +   L  LY+ +L+   R PF N+ RWF+T  NQ   ++V+GE+KLC   A FDAKK+AE+  KK+  +K+   K+P++++E+K++  P        E + +   K     P S  P     K +F M+E+KR YSN D + VALPYFW  FD E +SIW  EY FP+EL   FM+CNL++GMFQRLD+LRK  F S+++ G N ++ I G+WV +GQDLAFTL +D ++DYESY W KLD N+E  K LVK YF  EGDF   G  FNQGKIFK
Sbjct:    1 MQYNKQATEQAKEEIKAVLGVLDSHLKTRTFLVGERVTLADIAVTCSLLWLYKQVLEPSFRQPFGNVTRWFVTCVNQPEFRAVLGEVKLCDKMAQFDAKKFAEMQPKKETPKKEKPAKEPKKEKEEKKKATPAPAPAPAPEDDMDESEKALAAEPKSKDPYAHLPKSSFVMDEFKRKYSNEDTLAVALPYFWEHFDKEGWSIWYAEYKFPEELTQTFMSCNLITGMFQRLDKLRKTGFASVILFGTNNDSSISGVWVFRGQDLAFTLSEDWQIDYESYTWRKLDSNSEECKTLVKEYFCWEGDFKHVGKAFNQGKIFK 318          
BLAST of Elongation factor 1-gamma vs. Ensembl Xenopus
Match: eef1g (eukaryotic translation elongation factor 1 gamma [Source:NCBI gene;Acc:394875])

HSP 1 Score: 207.608 bits (527), Expect = 7.848e-63
Identity = 95/159 (59.75%), Postives = 117/159 (73.58%), Query Frame = 2
Query:  893 PYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF---GMPFNQGKIFK 1360
            PY+ LPK +F M+E+KR YSN D + VALPYFW  FD E +SIW  EY FP+EL   FM+CNL++GMFQRLD+LRK  F S+++ G N ++ I G+WV +GQDLAFTL +D ++DYESY W KLD N+E  K LVK YF  EGDF   G  FNQGKIFK
Sbjct:  155 PYAHLPKSSFVMDEFKRKYSNEDTLAVALPYFWEHFDKEGWSIWYAEYKFPEELTQTFMSCNLITGMFQRLDKLRKTGFASVILFGTNNDSSISGVWVFRGQDLAFTLSEDWQIDYESYTWRKLDSNSEECKTLVKEYFCWEGDFKHVGKAFNQGKIFK 313          

HSP 2 Score: 90.5077 bits (223), Expect = 1.617e-19
Identity = 43/95 (45.26%), Postives = 61/95 (64.21%), Query Frame = 2
Query:  464 AKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELH 748
            +K  I   +  ++  L TRT+LVGER+T ADI +   L  LY+ +L+   R PF N+ RWF+T  NQ   ++V+GE+KLC   A FDAKK+AE+ 
Sbjct:    6 SKEEIKAVLGVLDSHLKTRTFLVGERVTLADIAVTCSLLWLYKQVLEPSFRQPFGNVTRWFVTCVNQPEFRAVLGEVKLCDKMAQFDAKKFAEMQ 100          
BLAST of Elongation factor 1-gamma vs. Ensembl Xenopus
Match: eef1g (eukaryotic translation elongation factor 1 gamma [Source:NCBI gene;Acc:394875])

HSP 1 Score: 207.223 bits (526), Expect = 2.873e-61
Identity = 95/159 (59.75%), Postives = 117/159 (73.58%), Query Frame = 2
Query:  893 PYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF---GMPFNQGKIFK 1360
            PY+ LPK +F M+E+KR YSN D + VALPYFW  FD E +SIW  EY FP+EL   FM+CNL++GMFQRLD+LRK  F S+++ G N ++ I G+WV +GQDLAFTL +D ++DYESY W KLD N+E  K LVK YF  EGDF   G  FNQGKIFK
Sbjct:  280 PYAHLPKSSFVMDEFKRKYSNEDTLAVALPYFWEHFDKEGWSIWYAEYKFPEELTQTFMSCNLITGMFQRLDKLRKTGFASVILFGTNNDSSISGVWVFRGQDLAFTLSEDWQIDYESYTWRKLDSNSEECKTLVKEYFCWEGDFKHVGKAFNQGKIFK 438          

HSP 2 Score: 157.918 bits (398), Expect = 8.153e-43
Identity = 88/226 (38.94%), Postives = 130/226 (57.52%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENPVPENLVV-----------PKGSVPVYCEGDVTF--FETNAIGYHLSNEQLRGNQ--NQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELH 748
            M+ G LY   D ++  +  I A+YS   I+ + +P      V           P G VP + EG+  F  FE++AI +++ N++LRG    +QA V QW +++D  ++P     VFP LG+MQ NK   E+AK  I   +  ++  L TRT+LVGER+T ADI +   L  LY+ +L+   R PF N+ RWF+T  NQ   ++V+GE+KLC   A FDAKK+AE+ 
Sbjct:    1 MAGGTLYTYPDNWRAYKPLIAAQYSGFPIKVASSPPEFQFGVTNKTSEFLKKFPLGKVPAF-EGNDGFCLFESSAIAHYVGNDELRGTNRLHQAQVIQWLSFSDSHIVPPASAWVFPTLGIMQYNKQATEQAKEEIKAVLGVLDSHLKTRTFLVGERVTLADIAVTCSLLWLYKQVLEPSFRQPFGNVTRWFVTCVNQPEFRAVLGEVKLCDKMAQFDAKKFAEMQ 225          
BLAST of Elongation factor 1-gamma vs. Ensembl Xenopus
Match: eef1g (eukaryotic translation elongation factor 1 gamma [Source:NCBI gene;Acc:394875])

HSP 1 Score: 207.223 bits (526), Expect = 3.007e-61
Identity = 95/159 (59.75%), Postives = 117/159 (73.58%), Query Frame = 2
Query:  893 PYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF---GMPFNQGKIFK 1360
            PY+ LPK +F M+E+KR YSN D + VALPYFW  FD E +SIW  EY FP+EL   FM+CNL++GMFQRLD+LRK  F S+++ G N ++ I G+WV +GQDLAFTL +D ++DYESY W KLD N+E  K LVK YF  EGDF   G  FNQGKIFK
Sbjct:  281 PYAHLPKSSFVMDEFKRKYSNEDTLAVALPYFWEHFDKEGWSIWYAEYKFPEELTQTFMSCNLITGMFQRLDKLRKTGFASVILFGTNNDSSISGVWVFRGQDLAFTLSEDWQIDYESYTWRKLDSNSEECKTLVKEYFCWEGDFKHVGKAFNQGKIFK 439          

HSP 2 Score: 155.992 bits (393), Expect = 4.861e-42
Identity = 87/223 (39.01%), Postives = 128/223 (57.40%), Query Frame = 2
Query:  125 GVLYGPADFYKTQRLQIIAKYSSKEIEFSENPVPENLVV-----------PKGSVPVYCEGDVTF--FETNAIGYHLSNEQLRGNQ--NQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELH 748
            G LY   D ++  +  I A+YS   I+ + +P      V           P G VP + EG+  F  FE++AI +++ N++LRG    +QA V QW +++D  ++P     VFP LG+MQ NK   E+AK  I   +  ++  L TRT+LVGER+T ADI +   L  LY+ +L+   R PF N+ RWF+T  NQ   ++V+GE+KLC   A FDAKK+AE+ 
Sbjct:    5 GTLYTYPDNWRAYKPLIAAQYSGFPIKVASSPPEFQFGVTNKTSEFLKKFPLGKVPAF-EGNDGFCLFESSAIAHYVGNDELRGTNRLHQAQVIQWLSFSDSHIVPPASAWVFPTLGIMQYNKQATEQAKEEIKAVLGVLDSHLKTRTFLVGERVTLADIAVTCSLLWLYKQVLEPSFRQPFGNVTRWFVTCVNQPEFRAVLGEVKLCDKMAQFDAKKFAEMQ 226          
BLAST of Elongation factor 1-gamma vs. Ensembl Xenopus
Match: eef1g (eukaryotic translation elongation factor 1 gamma [Source:NCBI gene;Acc:394875])

HSP 1 Score: 207.223 bits (526), Expect = 3.058e-61
Identity = 95/159 (59.75%), Postives = 117/159 (73.58%), Query Frame = 2
Query:  893 PYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF---GMPFNQGKIFK 1360
            PY+ LPK +F M+E+KR YSN D + VALPYFW  FD E +SIW  EY FP+EL   FM+CNL++GMFQRLD+LRK  F S+++ G N ++ I G+WV +GQDLAFTL +D ++DYESY W KLD N+E  K LVK YF  EGDF   G  FNQGKIFK
Sbjct:  283 PYAHLPKSSFVMDEFKRKYSNEDTLAVALPYFWEHFDKEGWSIWYAEYKFPEELTQTFMSCNLITGMFQRLDKLRKTGFASVILFGTNNDSSISGVWVFRGQDLAFTLSEDWQIDYESYTWRKLDSNSEECKTLVKEYFCWEGDFKHVGKAFNQGKIFK 441          

HSP 2 Score: 153.295 bits (386), Expect = 4.692e-41
Identity = 86/222 (38.74%), Postives = 127/222 (57.21%), Query Frame = 2
Query:  128 VLYGPADFYKTQRLQIIAKYSSKEIEFSENPVPENLVV-----------PKGSVPVYCEGDVTF--FETNAIGYHLSNEQLRGNQ--NQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELH 748
             LY   D ++  +  I A+YS   I+ + +P      V           P G VP + EG+  F  FE++AI +++ N++LRG    +QA V QW +++D  ++P     VFP LG+MQ NK   E+AK  I   +  ++  L TRT+LVGER+T ADI +   L  LY+ +L+   R PF N+ RWF+T  NQ   ++V+GE+KLC   A FDAKK+AE+ 
Sbjct:    8 TLYTYPDNWRAYKPLIAAQYSGFPIKVASSPPEFQFGVTNKTSEFLKKFPLGKVPAF-EGNDGFCLFESSAIAHYVGNDELRGTNRLHQAQVIQWLSFSDSHIVPPASAWVFPTLGIMQYNKQATEQAKEEIKAVLGVLDSHLKTRTFLVGERVTLADIAVTCSLLWLYKQVLEPSFRQPFGNVTRWFVTCVNQPEFRAVLGEVKLCDKMAQFDAKKFAEMQ 228          
BLAST of Elongation factor 1-gamma vs. Ensembl Mouse
Match: Eef1g (eukaryotic translation elongation factor 1 gamma [Source:MGI Symbol;Acc:MGI:1914410])

HSP 1 Score: 337.806 bits (865), Expect = 5.693e-112
Identity = 189/438 (43.15%), Postives = 268/438 (61.19%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENP----------VPENLV-VPKGSVPVYCEGDVTF--FETNAIGYHLSNEQLRGNQNQAS--VAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF---GMPFNQGKIFK 1360
            M+ G LY   + ++  +  I A+YS  ++     P           PE L   P G VP + EGD  F  FE+NAI Y++SNE+LRG+  +A+  V QW ++AD  ++P   T VFP LG+M  NK   E AK  +   +  ++  L TRT+LVGER+T ADIT+   L  LY+ +L+   R  F N NRWFLT  NQ   ++++GE+KLC   A FDAKK+AE   KKD   K+   ++ ++K + +++++ K       E      +      +   P++ LPK TF ++E+KR YSN D ++VALPYFW  FD + +S+W  EY FP+EL   FM+CNL++GMFQRLD+LRK+AF S+++ G N ++ I G+WV +GQ+LAF L  D +VDYESY W KLDP +E T+ LV+ YF+ EG F   G   NQGKIFK
Sbjct:    1 MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAF-EGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVKRILGLLDTHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAILGEVKLCEKMAQFDAKKFAESQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYAEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGTFQHVGKAVNQGKIFK 437          
BLAST of Elongation factor 1-gamma vs. Ensembl Mouse
Match: Vars (valyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:90675])

HSP 1 Score: 75.0998 bits (183), Expect = 6.459e-15
Identity = 38/122 (31.15%), Postives = 61/122 (50.00%), Query Frame = 2
Query:  335 GNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKL 700
            G++    V QW +YAD  L+PA      P LGL    + + + A   +   +N +  +L   TYL G+  T AD+   + L + +  +LD   R  + N+ RWF T   Q   ++V+GE+ L
Sbjct:   89 GSRAAVLVQQWVSYADTELIPAACGATLPALGLRGPGQ-DPQAALGALGKALNPLEDWLRLHTYLAGDAPTLADLAAVTALLLPFRYVLDPSARRIWGNVTRWFNTCVRQPEFRAVLGEVAL 209          
BLAST of Elongation factor 1-gamma vs. Ensembl Mouse
Match: Vars (valyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:90675])

HSP 1 Score: 74.3294 bits (181), Expect = 1.632e-13
Identity = 38/122 (31.15%), Postives = 61/122 (50.00%), Query Frame = 2
Query:  335 GNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKL 700
            G++    V QW +YAD  L+PA      P LGL    + + + A   +   +N +  +L   TYL G+  T AD+   + L + +  +LD   R  + N+ RWF T   Q   ++V+GE+ L
Sbjct:   89 GSRAAVLVQQWVSYADTELIPAACGATLPALGLRGPGQ-DPQAALGALGKALNPLEDWLRLHTYLAGDAPTLADLAAVTALLLPFRYVLDPSARRIWGNVTRWFNTCVRQPEFRAVLGEVAL 209          
BLAST of Elongation factor 1-gamma vs. Ensembl Mouse
Match: Vars (valyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:90675])

HSP 1 Score: 73.559 bits (179), Expect = 2.331e-13
Identity = 38/122 (31.15%), Postives = 61/122 (50.00%), Query Frame = 2
Query:  335 GNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKL 700
            G++    V QW +YAD  L+PA      P LGL    + + + A   +   +N +  +L   TYL G+  T AD+   + L + +  +LD   R  + N+ RWF T   Q   ++V+GE+ L
Sbjct:   89 GSRAAVLVQQWVSYADTELIPAACGATLPALGLRGPGQ-DPQAALGALGKALNPLEDWLRLHTYLAGDAPTLADLAAVTALLLPFRYVLDPSARRIWGNVTRWFNTCVRQPEFRAVLGEVAL 209          
BLAST of Elongation factor 1-gamma vs. Ensembl Mouse
Match: Vars (valyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:90675])

HSP 1 Score: 48.521 bits (114), Expect = 1.283e-6
Identity = 23/71 (32.39%), Postives = 38/71 (53.52%), Query Frame = 2
Query:  488 MNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKL 700
            +N +  +L   TYL G+  T AD+   + L + +  +LD   R  + N+ RWF T   Q   ++V+GE+ L
Sbjct:   17 LNPLEDWLRLHTYLAGDAPTLADLAAVTALLLPFRYVLDPSARRIWGNVTRWFNTCVRQPEFRAVLGEVAL 87          
BLAST of Elongation factor 1-gamma vs. UniProt/SwissProt
Match: sp|P26641|EF1G_HUMAN (Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3)

HSP 1 Score: 342.813 bits (878), Expect = 5.532e-113
Identity = 191/438 (43.61%), Postives = 270/438 (61.64%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENP----------VPENLV-VPKGSVPVYCEGDVTF--FETNAIGYHLSNEQLRGNQNQAS--VAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF---GMPFNQGKIFK 1360
            M+ G LY   + ++  +  I A+YS  ++     P           PE L   P G VP + EGD  F  FE+NAI Y++SNE+LRG+  +A+  V QW ++AD  ++P   T VFP LG+M  NK   E AK  +   +  ++ +L TRT+LVGER+T ADIT+   L  LY+ +L+   R  F N NRWFLT  NQ   ++V+GE+KLC   A FDAKK+AE   KKD   K+   ++ ++K + +++++ K       E      +      +   P++ LPK TF ++E+KR YSN D ++VALPYFW  FD + +S+W  EY FP+EL   FM+CNL++GMFQRLD+LRK+AF S+++ G N ++ I G+WV +GQ+LAF L  D +VDYESY W KLDP +E T+ LV+ YF+ EG F   G  FNQGKIFK
Sbjct:    1 MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAF-EGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK 437          
BLAST of Elongation factor 1-gamma vs. UniProt/SwissProt
Match: sp|Q4R7H5|EF1G_MACFA (Elongation factor 1-gamma OS=Macaca fascicularis OX=9541 GN=EEF1G PE=2 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 2.188e-112
Identity = 191/438 (43.61%), Postives = 269/438 (61.42%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENP----------VPENLV-VPKGSVPVYCEGDVTF--FETNAIGYHLSNEQLRGNQNQAS--VAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF---GMPFNQGKIFK 1360
            M+ G LY   + ++  +  I A+YS  ++     P           PE L   P G VP + EGD  F  FE+NAI Y++SNE+LRG+  +A+  V QW ++AD  ++P   T VFP LG+M  NK   E AK  +   +  ++  L TRT+LVGER+T ADIT+   L  LY+ +L+   R  F N NRWFLT  NQ   ++V+GE+KLC   A FDAKK+AE   KKD   K+   ++ ++K + +++++ K       E      +      +   P++ LPK TF ++E+KR YSN D ++VALPYFW  FD + +S+W  EY FP+EL   FM+CNL++GMFQRLD+LRK+AF S+++ G N ++ I G+WV +GQ+LAF L  D +VDYESY W KLDP +E T+ LV+ YF+ EG F   G  FNQGKIFK
Sbjct:    1 MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAF-EGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILGLLDAHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAFNQGKIFK 437          
BLAST of Elongation factor 1-gamma vs. UniProt/SwissProt
Match: sp|P29694|EF1G_RABIT (Elongation factor 1-gamma OS=Oryctolagus cuniculus OX=9986 GN=EEF1G PE=2 SV=3)

HSP 1 Score: 340.887 bits (873), Expect = 3.128e-112
Identity = 190/438 (43.38%), Postives = 269/438 (61.42%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENP----------VPENLV-VPKGSVPVYCEGDVTF--FETNAIGYHLSNEQLRGNQNQAS--VAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF---GMPFNQGKIFK 1360
            M+ G LY   + ++  +  I A+YS  ++     P           PE L   P G VP + EGD  F  FE+NAI Y++SNE+LRG+  +A+  V QW ++AD  ++P   T VFP LG+M  NK   E AK  +   +  ++  L TRT+LVGER+T ADIT+   L  LY+ +L+   R  F N NRWFLT  NQ   ++V+GE+KLC   A FDAKK+AE   KKD   K+   ++ ++K + +++++ K       E      +      +   P++ LPK TF ++E+KR YSN D ++VALPYFW  FD + +S+W  EY FP+EL   FM+CNL++GMFQRLD+LRK+AF S+++ G N ++ I G+WV +GQ+LAF L  D +VDYESY W KLDP++E T+ LV+ YF  EG F   G  FNQGK+FK
Sbjct:    1 MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAF-EGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVKRILGLLDAHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAESQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYAEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGIWVFRGQELAFPLSPDWQVDYESYTWRKLDPSSEETQTLVREYFAWEGAFQHVGKAFNQGKVFK 437          
BLAST of Elongation factor 1-gamma vs. UniProt/SwissProt
Match: sp|P26642|EF1GA_XENLA (Elongation factor 1-gamma-A OS=Xenopus laevis OX=8355 GN=eef1g-a PE=1 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 3.452e-112
Identity = 197/437 (45.08%), Postives = 272/437 (62.24%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYS---------SKEIEFS-ENPVPENLV-VPKGSVPVYCEGDVTF--FETNAIGYHLSNEQLRGNQ--NQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----XXXXXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF---GMPFNQGKIFK 1360
            M+ G LY   D ++  +  I A+YS         + E +F   N  PE L   P G VP + EG   F  FE++AI +++ N++LRG    +QA V QW +++D  ++P     VFP LG+MQ NK   E+AK  I   +  ++  L TRT+LVGER+T ADIT+   L  LY+ +L+   R PF N+ RWF+T  NQ   ++V+GE+KLC   A FDAKK+AE+  KK+  +K+   K+P++++E+K++  P      E       +      +   PY+ LPK +F M+E+KR YSN D +TVALPYFW  FD E +SIW  EY FP+EL   FM+CNL++GMFQRLD+LRK  F S+++ G N N+ I G+WV +GQDLAFTL +D ++DYESY W KLD  +E  K LVK YF  EG+F   G PFNQGKIFK
Sbjct:    1 MAGGTLYTYPDNWRAYKPLIAAQYSGFPIKVASSAPEFQFGVTNKTPEFLKKFPLGKVPAF-EGKDGFCLFESSAIAHYVGNDELRGTTRLHQAQVIQWVSFSDSHIVPPASAWVFPTLGIMQYNKQATEQAKEGIKTVLGVLDSHLQTRTFLVGERITLADITVTCSLLWLYKQVLEPSFRQPFGNVTRWFVTCVNQPEFRAVLGEVKLCDKMAQFDAKKFAEMQPKKETPKKEKPAKEPKKEKEEKKKAAPTPAPAPEDDLDESEKALAAEPKSKDPYAHLPKSSFIMDEFKRKYSNEDTLTVALPYFWEHFDKEGWSIWYAEYKFPEELTQAFMSCNLITGMFQRLDKLRKTGFASVILFGTNNNSSISGVWVFRGQDLAFTLSEDWQIDYESYNWRKLDSGSEECKTLVKEYFAWEGEFKNVGKPFNQGKIFK 436          
BLAST of Elongation factor 1-gamma vs. UniProt/SwissProt
Match: sp|Q68FR6|EF1G_RAT (Elongation factor 1-gamma OS=Rattus norvegicus OX=10116 GN=Eef1g PE=2 SV=3)

HSP 1 Score: 340.117 bits (871), Expect = 6.392e-112
Identity = 191/438 (43.61%), Postives = 268/438 (61.19%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENP----------VPENLV-VPKGSVPVYCEGDVTF--FETNAIGYHLSNEQLRGNQNQAS--VAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF---GMPFNQGKIFK 1360
            M+ G LY   + ++  +  I A+YS  +I     P           PE L   P G VP + EGD  F  FE+NAI Y++SNE+LRG+  +A+  V QW ++AD  ++P   T VFP LG+M  NK   E AK  +   +  ++  L TRT+LVGER+T ADIT+   L  LY+ +L+   R  F N NRWFLT  NQ   ++++GE+KLC   A FDAKK+AE   KKD   K+   ++ ++K + +++++ K       E      +      +   P++ LPK TF ++E+KR YSN D ++VALPYFW  FD + +S+W  EY FP+EL   FM+CNL++GMFQRLD+LRK+AF S+++ G N ++ I G+WV +GQDLAF L  D +VDYESY W KLDP +E T+ LV+ YF+ EG F   G   NQGKIFK
Sbjct:    1 MAAGTLYTYPENWRAFKALIAAQYSGAQIRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAF-EGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVKRILGLLDTHLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCINQPQFRAILGEVKLCEKMAQFDAKKFAESQPKKDTPRKEKGSREEKQKPQTERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYAEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNSSSISGVWVFRGQDLAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVGKAVNQGKIFK 437          
BLAST of Elongation factor 1-gamma vs. TrEMBL
Match: A0A2T7NX35 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_13390 PE=4 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 1.490e-120
Identity = 209/434 (48.16%), Postives = 281/434 (64.75%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIE------FSENPVPENLVV--PKGSVPVY-CEGDVTFFETNAIGYHLSNEQLRGNQNQAS--VAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXX-------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF-GMPFNQGKIFK 1360
            M+ G LY     ++  +  I A+YS  +++      F E     N +   P G VP +     +T FE+NAI + + N QL+G   +A+  V QW ++AD  +LPA  T VFPCLG+ Q NK + EKAK  I   +  +N +L TRTYLVGE +TQADI+L   L  LYE +LD + R PF N+NRWF TI NQ NVK+V+GE+ LC   A FD+KKYAELH  +        ++++KP ++K ++  ++KQ  K K+    +A+ ++E   KE   P++  PKGTFDM+E+KR YSN D +TVA+PYFW KFD ENYSIW CEY       + FM+CNLVSGMFQRL++L K+AF SM I GEN  NQI GLW+ + Q+L FTL+ D +VDYESY W KLDP+A  TK++VK +F  EG+F G  FNQGK+FK
Sbjct:    1 MATGTLYTYPKNFRAYKALIAARYSGTDVKVDPDFKFGETNASANFIAKFPLGKVPAFESSSGITLFESNAIAHFVGNTQLQGATPEAAALVQQWISFADNEILPAACTWVFPCLGITQFNKQDTEKAKGQITKALTVLNDYLLTRTYLVGENVTQADISLACNLLALYENVLDPEFRKPFQNVNRWFCTIINQPNVKAVIGELTLCTKMAQFDSKKYAELHGAQGGQKKEKKEKQEKPTKEKQEKPAKEKQTPKKKEAEPPQADEDEEAKPKESKDPFAAYPKGTFDMDEFKRVYSNEDTLTVAIPYFWDKFDKENYSIWYCEYQEDLSKFITFMSCNLVSGMFQRLEKLNKNAFASMCIFGENHQNQIAGLWIWRTQELVFTLNPDWQVDYESYSWKKLDPDAPETKEMVKEFFLWEGNFGGKKFNQGKVFK 434          
BLAST of Elongation factor 1-gamma vs. TrEMBL
Match: C1LV11 (Eukaryotic translation elongation factor 1 gamma OS=Schistosoma japonicum OX=6182 GN=eef1g PE=2 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 3.285e-118
Identity = 199/424 (46.93%), Postives = 268/424 (63.21%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENPVPENL--------VVPKGSVPVYCEGDVT-FFETNAIGYHLSNEQLRGNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDFGMPFNQGKIFK 1360
            M  G LY P  ++++ R QI A++S   I    N VP             P  +VPV+   D T  F+ NAI Y L  +QLRG +N   V QW NYAD  +LP++ T V+PCLG+ Q NK   EKAK  I   + F+N+ LS  T+LVG+RL+QADIT+F+ L +L+  + +EK R P+ ++ RW+ TIANQ  V  VVG    C+  A FDAKKYAELH+K  + ++  + KK + K E   +K+  K+ ++E +   +P       P + LP G FDM+ +KR YSN DI   A+PYFWS FD E YSIW CEYL+P+EL L+FMTCNL++G FQR +++ K+AFGSM I GE++ N + GLW+ +G  L F L +D ++DYESY W KLDPN+E TK LV  YFT +     PFNQGKIFK
Sbjct:    1 MVSGTLYTPEGYHRSWRAQIAAQFSGATINIV-NFVPGVTDSDKSFLDKFPPATVPVFEANDGTCLFDVNAIAYFLGTDQLRGWKNTHLVTQWVNYADNSILPSVATWVYPCLGITQFNKQNTEKAKTCIASVLKFLNEQLSKITFLVGDRLSQADITVFTALHLLFTHVYEEKDRKPYPHVVRWYTTIANQPEVLKVVGPSSFCIKAAQFDAKKYAELHKKVTETKQPKETKKEKPKPEVPSKKEKPKDDDDEDDERSKPSKN----PLANLPAGKFDMDAFKRVYSNMDIEKEAIPYFWSNFDPEAYSIWFCEYLYPEELSLVFMTCNLINGFFQRAEKMLKYAFGSMCIFGEDKKNTVSGLWIWRGTGLIFDLDEDLRIDYESYSWRKLDPNSEETKSLVHDYFTRKFH-DKPFNQGKIFK 418          
BLAST of Elongation factor 1-gamma vs. TrEMBL
Match: C1LV05 (Eukaryotic translation elongation factor 1 gamma OS=Schistosoma japonicum OX=6182 GN=eef1g PE=2 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 3.866e-118
Identity = 199/424 (46.93%), Postives = 268/424 (63.21%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENPVPENL--------VVPKGSVPVYCEGDVT-FFETNAIGYHLSNEQLRGNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDFGMPFNQGKIFK 1360
            M  G LY P  ++++ R QI A++S   +    N VP             P  +VPV+   D T  FE NAI Y L  +QLRG +N   V QW NYAD  +LP++ T V+PCLG+ Q NK   EKAK  I   + F+N+ LS  T+LVG+RL+QADIT+F+ L +L+  + +EK R P+ ++ RW+ TIANQ  V  VVG    C+  A FDAKKYAELH+K  + ++  + KK + K E   +K+  K+ ++E +   +P       P + LP G FDM+ +KR YSN DI   A+PYFWS FD E YSIW CEYL+P+EL L+FMTCNL++G FQR +++ K+AFGSM I GE++ N + GLW+ +G  L F L +D ++DYESY W KLDPN+E TK LV  YFT +     PFNQGKIFK
Sbjct:    1 MVSGTLYTPEGYHRSWRAQIAAQFSGATLNIV-NFVPGVTDSDKSFLDKFPPATVPVFEANDGTCLFEVNAIAYFLGTDQLRGWKNTHLVTQWVNYADNSILPSVATWVYPCLGITQFNKQNTEKAKTCIASVLKFLNEQLSKITFLVGDRLSQADITVFTALHLLFTHVYEEKDRKPYPHVVRWYTTIANQPEVLKVVGPSSFCIKAAQFDAKKYAELHKKVTETKQPKETKKEKPKPEVPSKKEKPKDDDDEDDERPKPSKN----PLANLPAGKFDMDAFKRVYSNMDIEKEAIPYFWSNFDPEAYSIWFCEYLYPEELSLVFMTCNLINGFFQRAEKMLKYAFGSMCIFGEDKKNTVSGLWIWRGTGLIFDLDEDLRIDYESYSWRKLDPNSEETKSLVHDYFTRKFH-DKPFNQGKIFK 418          
BLAST of Elongation factor 1-gamma vs. TrEMBL
Match: R7U2Z4 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_173297 PE=4 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 3.900e-118
Identity = 206/430 (47.91%), Postives = 275/430 (63.95%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIE---------FSE-NPVPENLV-VPKGSVPVY-CEGDVTFFETNAIGYHLSNEQLRGN--QNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDFGMP-FNQGKIFK 1360
            M+ G LY   + ++  + QI A+YS  +++         F E N   E L   P G VP +  +  V  FE+NAI Y L+NE+LRG    + A + QW ++AD  +LPA  T VFPC+G+M  NK   E++K  +   +  +N  L+TRT+LVGER++ ADIT+   L  LY+ +L+   R  +VN NRWF TI NQ NVK+V+G+ KLC   A FD KK+ E+   K   +    ++K  EK+++K+++K K   + E E +          P++ LPKGTF M++WK+TYSN D  TVALPYFW  FD ENYSIW  EY +P++L+ IFMTCNLV GMFQRLDRLRKHAFGS++I GEN NN I G+WV +GQDLAF L  D +VDYESY W KL+P+ EATK  V  YF  EGDFG    NQGK++K
Sbjct:    1 MASGTLYTYPENFRAYKAQIAARYSGGKVKVVQDAPAFKFGETNKSAEFLKKFPTGKVPAFESDSGVKLFESNAIAYFLANEELRGQTPADAACIQQWIHFADSEILPASCTWVFPCMGIMAFNKQNTERSKEEVKRALAILNAQLATRTFLVGERISLADITVACNLLHLYQYVLEPAFRGEYVNTNRWFNTIINQPNVKAVIGDFKLCEKMAVFDNKKFQEMQGGKAGGKSGGNKEKKTEKKQEKKQEKKKPAADPEEEDDMPVEKPSKD-PFAALPKGTFVMDDWKKTYSNEDTATVALPYFWKNFDKENYSIWFAEYKYPEKLKKIFMTCNLVGGMFQRLDRLRKHAFGSVLIFGENDNNSISGIWVWRGQDLAFELSPDLQVDYESYDWVKLNPDDEATKKKVNDYFLWEGDFGGKVVNQGKVYK 429          
BLAST of Elongation factor 1-gamma vs. TrEMBL
Match: C1LV10 (Eukaryotic translation elongation factor 1 gamma OS=Schistosoma japonicum OX=6182 GN=eef1g PE=2 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 5.903e-118
Identity = 199/424 (46.93%), Postives = 268/424 (63.21%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENPVPENL--------VVPKGSVPVYCEGDVT-FFETNAIGYHLSNEQLRGNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDFGMPFNQGKIFK 1360
            M  G LY P  ++++ R QI A++S   I    N VP             P  +VPV+   D T  F+ NAI Y L  +QLRG +N   V QW NYAD  +LP++ T V+PCLG+ Q NK   EKAK  I   + F+N+ LS  T+LVG+RL+QADIT+F+ L +L+  + +EK R P+ ++ RW+ TIANQ  V  VVG    C+  A FDAKKYAELH+K  + ++  + KK + K E   +K+  K+ ++E +   +P       P + LP G FDM+ +KR YSN DI   A+PYFWS FD E YSIW CEYL+P+EL L+FMTCNL++G FQR +++ K+AFGSM I GE++ N + GLW+ +G  L F L +D ++DYESY W KLDPN+E TK LV  YFT +     PFNQGKIFK
Sbjct:    1 MVSGTLYTPEGYHRSWRAQIAAQFSGATINIV-NFVPGVTDSDKSFLDKFPPATVPVFEANDGTCLFDVNAIAYFLGTDQLRGWKNTHLVTQWVNYADNSILPSVATWVYPCLGITQFNKQNTEKAKTCIASVLKFLNEQLSKITFLVGDRLSQADITVFTALHLLFTHVYEEKDRKPYPHVVRWYTTIANQPEVLKVVGPSSFCIKAAQFDAKKYAELHKKVTETKQPKETKKEKPKPEVPSKKEKPKDDDDEDDERPKPSKN----PLANLPAGKFDMDAFKRVYSNMDIEKEAIPYFWSNFDPEAYSIWFCEYLYPEELSLVFMTCNLINGFFQRAEKMLKYAFGSMCIFGEDKKNTVSGLWIWRGTGLIFDLDEDLRIDYESYSWRKLDPNSEETKSLVHDYFTRKFH-DKPFNQGKIFK 418          
BLAST of Elongation factor 1-gamma vs. Ensembl Cavefish
Match: eef1g (eukaryotic translation elongation factor 1 gamma [Source:NCBI gene;Acc:103034671])

HSP 1 Score: 201.06 bits (510), Expect = 3.398e-59
Identity = 90/159 (56.60%), Postives = 117/159 (73.58%), Query Frame = 2
Query:  893 PYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF---GMPFNQGKIFK 1360
            P++ LPK +F ++E+KR YSN D ++VALPYFW   D E YSIW  EY FP EL + FM+CNL++GMFQRLD+LRK+AF S+++ G N  + I G+WV +GQ+LAF L +D ++DYESY W KLD  +E  K +VK YF  EG+F   G PFNQGKIFK
Sbjct:  283 PFAHLPKSSFILDEFKRKYSNEDTLSVALPYFWENLDREGYSIWYGEYRFPDELAMTFMSCNLITGMFQRLDKLRKNAFASVILFGTNNASSISGIWVFRGQELAFPLSEDWQIDYESYNWRKLDVESEECKTMVKEYFAWEGEFKHVGKPFNQGKIFK 441          

HSP 2 Score: 170.244 bits (430), Expect = 1.570e-47
Identity = 94/224 (41.96%), Postives = 136/224 (60.71%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENP----------VPENLV-VPKGSVPVYCEGDVTF--FETNAIGYHLSNEQLRGNQNQAS--VAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAE 742
            M+ G LY  A+ ++  + QI A+YS   ++ + +P           P  L   P G VP Y +GD  F  FE+NAI ++LSN+ LRG+  QAS  V QW ++AD  ++P     VFP LG+MQ NK   E+AK  +   +  +N+ L+TRT+LVGER++ ADI +   L  LY+ +L+   R P+ N+NRWF+T  NQ   K+++GE+KLC   A FDAKK+AE
Sbjct:    1 MAAGTLYTYAENWRAYKAQIAAQYSGARLKVASSPPAFTFGQTNRSPAFLNNFPLGKVPAY-QGDDGFCLFESNAIAHYLSNDALRGSTPQASAQVLQWVSFADSEIIPPASAWVFPTLGIMQFNKQATEQAKEEVKRVLTVLNQHLNTRTFLVGERVSLADIAVACSLLWLYKQVLEPAFRQPYPNVNRWFVTCINQPQFKAILGEVKLCEKMAQFDAKKFAE 223          
BLAST of Elongation factor 1-gamma vs. Ensembl Cavefish
Match: vars1 (valyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-010601-1])

HSP 1 Score: 79.7221 bits (195), Expect = 2.423e-15
Identity = 55/191 (28.80%), Postives = 95/191 (49.74%), Query Frame = 2
Query:  140 PADFYKTQRLQIIAKYS-SKEIEFSENPVPENLVVPKGSVPVYCEGDVTFFETNAIGYHLSNEQLRGN---QNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKL 700
            P DF   Q L I A++S S+    +E P P  +   + ++ +            A+ ++L++   R     Q Q+ V QW ++A+  L P    +VFP LGL Q +++E  +        +  +++ L  RT+LVGE L+ AD+ +     + ++  L+   R   VN++RWF T  NQ  +  V+G+I L
Sbjct:   10 PDDFRSLQAL-IAAEFSPSRPQTLAEEP-PARVARCRPALVLRDAEATALCGAGAVSWYLASVGGRTGSDAQQQSEVWQWLSFAENELTPVACAVVFPLLGLQQSSRAELLRV-------LKVLDQILEPRTFLVGESLSLADVAVAMAALLPFKYALEPSDRKTLVNVSRWFDTCVNQPQLLKVLGKITL 191          
BLAST of Elongation factor 1-gamma vs. Ensembl Sea Lamprey
Match: eef1g (eukaryotic translation elongation factor 1 gamma [Source:NCBI gene;Acc:195822])

HSP 1 Score: 277.33 bits (708), Expect = 4.408e-90
Identity = 157/360 (43.61%), Postives = 227/360 (63.06%), Query Frame = 2
Query:  164 RLQIIAKYSSKEIEFSENPVPENLVV--PKGSVPVYCEGDVTF--FETNAIGYHLSNEQLRGNQNQAS--VAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPC---PYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTL 1216
            +++++A+  + E  F +    E  +   P G VP + EG   F  FE+NAI ++++N  LRG+ N+AS  V QW ++AD  ++PA  T VFP LG++Q NK   ++AK  +   +  +N+ L   T+LVGER++ ADIT+   L  LY+ +L+   R PF N NRWF T  NQ   K+V+GE+KLC   A FDAKK+AEL  KKD   K+   K+ +   EKK++KK +    EE     +  +   P    P++ LPK  F ++E+KR YSN D +TVA+P+FW  FD E +SIW  EY +P EL  IFM+CNL++GMFQRLD+LRK+AF S ++ GEN  + I G+WV +GQ+LAF +
Sbjct:    4 KIKVVAE--TPEFIFGQTNKSEKFIAKFPLGKVPAF-EGSNGFSLFESNAIAHYVANNSLRGDNNEASAKVQQWISFADSEIVPASATWVFPTLGIVQYNKQSTDRAKEDVKKALGILNEHLKAHTFLVGERVSLADITVVCSLLALYKQVLEPSFRQPFGNANRWFTTCINQPQFKAVLGEVKLCDKMAQFDAKKFAELQPKKDTHCKEKSTKENKHHDEKKEKKKEEPAAAEEDFDAADEALANEPKAKDPFAALPKSAFVLDEFKRKYSNEDTLTVAIPHFWQHFDKEGWSIWYGEYKYPDELTQIFMSCNLITGMFQRLDKLRKNAFASAILFGENNKSSISGIWVFRGQELAFEV 360          
BLAST of Elongation factor 1-gamma vs. Ensembl Yeast
Match: TEF4 (Gamma subunit of translational elongation factor eEF1B; stimulates the binding of aminoacyl-tRNA (AA-tRNA) to ribosomes by releasing eEF1A (Tef1p/Tef2p) from the ribosomal complex [Source:SGD;Acc:S000001564])

HSP 1 Score: 127.487 bits (319), Expect = 4.661e-33
Identity = 63/135 (46.67%), Postives = 82/135 (60.74%), Query Frame = 2
Query:  893 PYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLV 1297
            P   L K TF +++WKR YSN+D   VALP+FW  ++ E YSIW   Y +  EL L FM+ NLV G F RL    K+ FG +V+ GEN NN I G  +++GQD A     D   D+ESY++ KLDP  E  K+ V
Sbjct:  254 PLEALGKSTFVLDDWKRKYSNDDTRPVALPWFWEHYNPEEYSIWKVGYKYNDELTLTFMSNNLVGGFFNRLSASTKYMFGCLVVYGENNNNGIVGAVMVRGQDFAPAF--DVAPDWESYEYTKLDPTKEEDKEFV 386          
BLAST of Elongation factor 1-gamma vs. Ensembl Yeast
Match: CAM1 (One of two isoforms of the gamma subunit of eEF1B; stimulates the release of GDP from eEF1A (Tef1p/Tef2p) post association with the ribosomal complex with eEF1Balpha subunit; nuclear protein required for transcription of MXR1; binds the MXR1 promoter in the presence of other nuclear factors; binds calcium and phospholipids [Source:SGD;Acc:S000005969])

HSP 1 Score: 122.094 bits (305), Expect = 4.839e-31
Identity = 60/135 (44.44%), Postives = 80/135 (59.26%), Query Frame = 2
Query:  893 PYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLV 1297
            P  LL K TF +++WKR YSN D   VALP+FW  ++ E YS+W   Y +  EL L FM+ NLV G F RL    K+ FG +V+ GEN NN I G  +++GQD       D   D+ESY + KLDP  +  K+ +
Sbjct:  257 PLELLGKSTFVLDDWKRKYSNEDTRPVALPWFWEHYNPEEYSLWKVTYKYNDELTLTFMSNNLVGGFFNRLSASTKYMFGCLVVYGENNNNGIVGAVMVRGQDYVPAF--DVAPDWESYDYAKLDPTNDDDKEFI 389          

HSP 2 Score: 46.9802 bits (110), Expect = 4.084e-6
Identity = 52/224 (23.21%), Postives = 84/224 (37.50%), Query Frame = 2
Query:  116 MSKGVLYG--------PADFYKTQRL--QIIAKYSSKE---IEFSENPVPENLVVPKGSVPVYCEGDVTFFETNAIGYHLSN--------EQLRGNQN----QASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTP 712
            MS+G LY         P    K  +L  +++   ++ E    +F    VP   V PKG             E  AI Y+L           QL G  +    QA + +W + A+  L   I   + P  G    NK   + A + ++  ++     L   TYL  E ++ AD+   S+    +E +   + R     + RWF T+     +K    + K    P
Sbjct:    1 MSQGTLYANFRIRTWVPRGLVKALKLDVKVVTPDAAAEQFARDFPLKKVPA-FVGPKG---------YKLTEAMAINYYLVKLSQDDKMKTQLLGADDDLNAQAQIIRWQSLANSDLCIQIANTIVPLKGGAPYNKKSVDSAMDAVDKIVDIFENRLKNYTYLATENISLADLVAASIFTRYFESLFGTEWRAQHPAIVRWFNTVRASPFLKDEYKDFKFADKP 214          
BLAST of Elongation factor 1-gamma vs. Ensembl Yeast
Match: YGR201C_mRNA (Putative protein of unknown function [Source:SGD;Acc:S000003433])

HSP 1 Score: 45.0542 bits (105), Expect = 7.492e-6
Identity = 37/156 (23.72%), Postives = 68/156 (43.59%), Query Frame = 2
Query:  281 TFFETNAIGY---HLSNE-----QLRGNQ----NQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLV-GERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVT 709
            T  E  AI Y   HLS++     QL G +     +A + +W + ++   L  +  + FP +G+   N +E + A+  ++  ++   K L  + YLV  +  T AD+   +   + +    DE  R+    + RWF  +      +      K+C T
Sbjct:   64 TLTEAMAIDYYLIHLSSDKEAVRQLLGPEGDFKTRADILRWESLSNSDFLNEVCEVFFPLIGVKPYNATEFKAARENVDTIVSLYEKRLKKQQYLVCDDHETLADLISAAAFSLGFISFFDETWRSKHPEVTRWFNRVIKSRFFEGEFESFKMCET 219          
BLAST of Elongation factor 1-gamma vs. Ensembl Nematostella
Match: EDO48468 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIW1])

HSP 1 Score: 290.426 bits (742), Expect = 4.043e-94
Identity = 173/430 (40.23%), Postives = 258/430 (60.00%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEF------SENPVPENLV-VPKGSVPVYCEGD-VTFFETNAIGYHLSNEQLRGNQNQAS--VAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYL--FPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF---GMPFNQGKIFK 1360
            M+ G LY   D ++ Q++ I A+YS  +IE        +N   E L   P G VP +   D    +E+NAI ++++NEQLRG   + S  V Q+ N+AD  LLPA  T VFP  G+MQ +K   +KA   +   M  +N  L  +T+LVGER+T ADI +  VL+MLY+ +++   R P+ N+NRWF T  NQ   K ++G++K+C T A FD+K +  LH K   ++K  KE+KP+++++K + KK ++  E+E   +          P++ LP  + +++ WK+ YSN D  + A+PYFW  FD E YS+W  EY   + ++L ++FM CNLV GM QRL++L K+ FGS+ I GEN N  I G+W+ +GQ LAF L++D  VD  SY   +L+P+  A K L++ YF    +    G  FNQGK+FK
Sbjct:    1 MAAGKLYTYPDSFRAQKILIAAEYSGTKIEVPAFTFGKDNHTAEFLKKFPLGKVPAFETKDGKCLYESNAIAHYVANEQLRGTTAELSALVVQYVNFADQELLPAAATWVFPTYGMMQYHKQSTDKAMEDVKKYMTMLNDVLLMKTFLVGERVTLADIAVCCVLQMLYKQVMEPSFRAPYGNVNRWFTTCVNQPEFKKILGDVKMCDTMAKFDSKTFNSLHHKDHHKKKAHKEEKPKQEKKKAEPKKVEEPKEQEPPKKPAKTD-----PFAALPPSSMNLDAWKKVYSNEDTESKAIPYFWENFDKEGYSLWFLEYKEEYEKDLGMVFMACNLVGGMIQRLEKLVKNGFGSICIFGENHNCSIAGVWMFRGQQLAFELNEDWNVDAPSYTSRRLNPDDPADKKLIEDYFIQREELTYRGKKFNQGKVFK 425          
BLAST of Elongation factor 1-gamma vs. Ensembl Medaka
Match: eef1g (eukaryotic translation elongation factor 1 gamma [Source:NCBI gene;Acc:101155525])

HSP 1 Score: 342.813 bits (878), Expect = 4.811e-114
Identity = 194/438 (44.29%), Postives = 276/438 (63.01%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENP----------VPENLV-VPKGSVPVYCEGDVTF--FETNAIGYHLSNEQLRGNQNQAS--VAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXXXXXGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENYSIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNNQIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTHEGDF---GMPFNQGKIFK 1360
            M+ G +Y   + ++  + QI A+YS   I+ +  P           P  +   P G VP Y +GD  F  FE+NAI ++LSN+ LRG   QA+  V QW ++AD  ++P   T VFP LG+MQ NK   E+AK  +   +  +N+ L+TRT+LVGER++ ADIT+   L  LY+ +L+   R P+VN+ RWF+T  NQ   K+V+G++KLC   A FDAKK+AE+  KK+   KK K  K   K ++K+EKK ++   +  E             +   P++ LPK TF  +E+KR YSN D +TVA+P+FW  FD E YSIW  +Y +P+EL L F +CNL++GMFQRLD+LRK+AF S+++ G N ++ I G+WV +GQ+LAFTL +D ++DYESY W KLDP+++  K +VK YF  EG+F   G  FNQGKIFK
Sbjct:    1 MAAGTIYTYPENWRAFKAQIAAQYSGARIKIASTPPAFTFGQTNRTPAFINNFPLGKVPAY-QGDDGFCLFESNAIAHYLSNDALRGATPQAAAQVLQWVSFADSEIIPPASTWVFPTLGIMQFNKQATEQAKEDVKKILTVLNQHLNTRTFLVGERISLADITVACSLLWLYKQVLEPSFRQPYVNVTRWFVTCVNQPQFKAVLGDVKLCEKMAQFDAKKFAEMQPKKEAPAKKEKGGKEAAKPQEKKEKKKEESKPDPEEEMDDCDAVLAAEPKAKDPFAHLPKSTFVFDEFKRKYSNEDTLTVAIPHFWEHFDREGYSIWYSQYKYPEELTLTFKSCNLITGMFQRLDKLRKNAFASVILFGTNNDSSISGIWVFRGQELAFTLSEDWQIDYESYDWRKLDPDSDECKTMVKEYFAWEGEFKHVGKSFNQGKIFK 437          
BLAST of Elongation factor 1-gamma vs. Ensembl Medaka
Match: vars1 (valyl-tRNA synthetase 1 [Source:NCBI gene;Acc:101158795])

HSP 1 Score: 87.0409 bits (214), Expect = 1.076e-17
Identity = 56/199 (28.14%), Postives = 101/199 (50.75%), Query Frame = 2
Query:  143 ADFYKTQRLQIIAKYSSKEIEFSENPVPENLVVPKG-SVPVYCEGDVTFFETNAIGYHLSNEQLRGN---QNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLC-----VTP 712
            A+F  + R QII +     +     P    L +  G S  V C G       +A+ ++L+++  R     + Q+ V QW ++A+  L P    + FP +G+  ++K   + ++  +   +N +++ L+ RT+LVGE +T AD+ + + + + ++  L+   R   +N+ RWF T  NQ    +V+GEI LC     VTP
Sbjct:   22 AEFSPSSRPQIITEDPPSSLNVHSRPA---LRLGTGVSDSVLCGG-------SAVAWYLASQGKRAGVDLKQQSQVWQWLSFAENELTPLSCAVAFPLMGVTGVDKKIQQNSRAELMGILNVLDQALAPRTFLVGESITLADMAVATAVLLPFKYALEPSDRKLIINVTRWFTTCINQPQFLAVLGEIPLCERAVSVTP 210          
BLAST of Elongation factor 1-gamma vs. Planmine SMEST
Match: SMESG000018714.1 (SMESG000018714.1)

HSP 1 Score: 438.728 bits (1127), Expect = 8.929e-155
Identity = 210/211 (99.53%), Postives = 211/211 (100.00%), Query Frame = 2
Query:  116 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENPVPENLVVPKGSVPVYCEGDVTFFETNAIGYHLSNEQLRGNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELH 748
            MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENPVPENLVVPKGSVPVYCEGDVTFFETNAIGYHLSNEQLRGNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPF+NLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELH
Sbjct:    1 MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENPVPENLVVPKGSVPVYCEGDVTFFETNAIGYHLSNEQLRGNQNQASVAQWSNYADMVLLPAIGTLVFPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITLFSVLRMLYEMILDEKTRTPFINLNRWFLTIANQENVKSVVGEIKLCVTPAAFDAKKYAELH 211          
BLAST of Elongation factor 1-gamma vs. Planmine SMEST
Match: SMESG000069658.1 (SMESG000069658.1)

HSP 1 Score: 67.3958 bits (163), Expect = 4.978e-13
Identity = 33/46 (71.74%), Postives = 38/46 (82.61%), Query Frame = 2
Query:  152 YKTQRLQIIAKYSSKEIEFSENPVPENLVVPKGSVPVYCEGDVTFF 289
            YKT+RLQIIAKY +KEI  S+N VPEN +VPK SVPVY +GDVT F
Sbjct:  127 YKTRRLQIIAKYFTKEITLSKNLVPENSLVPKESVPVYFDGDVTLF 172          
BLAST of Elongation factor 1-gamma vs. Planmine SMEST
Match: SMESG000003618.1 (SMESG000003618.1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.158e-11
Identity = 28/42 (66.67%), Postives = 33/42 (78.57%), Query Frame = 2
Query:  158 TQRLQIIAKYSSKEIEFSENPVPENLVVPKGSVPVYCEGDVT 283
            TQR+Q IA+ S KEIE S+N +PE L+ PKGSV VYCEGD T
Sbjct:   87 TQRIQTIARCSFKEIELSKNLIPEELLFPKGSVSVYCEGDYT 128          
The following BLAST results are available for this feature:
BLAST of Elongation factor 1-gamma vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EEF1G1.152e-11343.61eukaryotic translation elongation factor 1 gamma [... [more]
VARS17.242e-1430.33valyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HG... [more]
VARS15.174e-1330.33valyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HG... [more]
VARS15.174e-1330.33valyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HG... [more]
VARS15.174e-1330.33valyl-tRNA synthetase 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Elongation factor 1-gamma vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eef-1G3.770e-9940.44Probable elongation factor 1-gamma [Source:UniPro... [more]
eef-1G3.770e-9940.44Probable elongation factor 1-gamma [Source:UniPro... [more]
eef-1G1.642e-9041.64Probable elongation factor 1-gamma [Source:UniPro... [more]
eef-1G1.642e-9041.64Probable elongation factor 1-gamma [Source:UniPro... [more]
eef-1G1.642e-9041.64Probable elongation factor 1-gamma [Source:UniPro... [more]
back to top
BLAST of Elongation factor 1-gamma vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
eEF1gamma4.354e-9842.17gene:FBgn0029176 transcript:FBtr0302442[more]
eEF1gamma4.354e-9842.17gene:FBgn0029176 transcript:FBtr0085393[more]
eEF1gamma4.354e-9842.17gene:FBgn0029176 transcript:FBtr0085392[more]
back to top
BLAST of Elongation factor 1-gamma vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
eef1g2.046e-11245.60eukaryotic translation elongation factor 1 gamma [... [more]
eef1g1.393e-3858.33eukaryotic translation elongation factor 1 gamma [... [more]
vars11.213e-1326.63valyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Elongation factor 1-gamma vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eef1g1.076e-8648.11eukaryotic translation elongation factor 1 gamma [... [more]
eef1g7.848e-6359.75eukaryotic translation elongation factor 1 gamma [... [more]
eef1g2.873e-6159.75eukaryotic translation elongation factor 1 gamma [... [more]
eef1g3.007e-6159.75eukaryotic translation elongation factor 1 gamma [... [more]
eef1g3.058e-6159.75eukaryotic translation elongation factor 1 gamma [... [more]
back to top
BLAST of Elongation factor 1-gamma vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eef1g5.693e-11243.15eukaryotic translation elongation factor 1 gamma [... [more]
Vars6.459e-1531.15valyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:9... [more]
Vars1.632e-1331.15valyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:9... [more]
Vars2.331e-1331.15valyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:9... [more]
Vars1.283e-632.39valyl-tRNA synthetase [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of Elongation factor 1-gamma vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26641|EF1G_HUMAN5.532e-11343.61Elongation factor 1-gamma OS=Homo sapiens OX=9606 ... [more]
sp|Q4R7H5|EF1G_MACFA2.188e-11243.61Elongation factor 1-gamma OS=Macaca fascicularis O... [more]
sp|P29694|EF1G_RABIT3.128e-11243.38Elongation factor 1-gamma OS=Oryctolagus cuniculus... [more]
sp|P26642|EF1GA_XENLA3.452e-11245.08Elongation factor 1-gamma-A OS=Xenopus laevis OX=8... [more]
sp|Q68FR6|EF1G_RAT6.392e-11243.61Elongation factor 1-gamma OS=Rattus norvegicus OX=... [more]
back to top
BLAST of Elongation factor 1-gamma vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NX351.490e-12048.16Uncharacterized protein OS=Pomacea canaliculata OX... [more]
C1LV113.285e-11846.93Eukaryotic translation elongation factor 1 gamma O... [more]
C1LV053.866e-11846.93Eukaryotic translation elongation factor 1 gamma O... [more]
R7U2Z43.900e-11847.91Uncharacterized protein OS=Capitella teleta OX=283... [more]
C1LV105.903e-11846.93Eukaryotic translation elongation factor 1 gamma O... [more]
back to top
BLAST of Elongation factor 1-gamma vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eef1g3.398e-5956.60eukaryotic translation elongation factor 1 gamma [... [more]
vars12.423e-1528.80valyl-tRNA synthetase 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Elongation factor 1-gamma vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eef1g4.408e-9043.61eukaryotic translation elongation factor 1 gamma [... [more]
back to top
BLAST of Elongation factor 1-gamma vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TEF44.661e-3346.67Gamma subunit of translational elongation factor e... [more]
CAM14.839e-3144.44One of two isoforms of the gamma subunit of eEF1B;... [more]
YGR201C_mRNA7.492e-623.72Putative protein of unknown function [Source:SGD;A... [more]
back to top
BLAST of Elongation factor 1-gamma vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO484684.043e-9440.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Elongation factor 1-gamma vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eef1g4.811e-11444.29eukaryotic translation elongation factor 1 gamma [... [more]
vars11.076e-1728.14valyl-tRNA synthetase 1 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Elongation factor 1-gamma vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000018714.18.929e-15599.53SMESG000018714.1[more]
SMESG000069658.14.978e-1371.74SMESG000069658.1[more]
SMESG000003618.11.158e-1166.67SMESG000003618.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017114 ID=SMED30017114|Name=Elongation factor 1-gamma|organism=Schmidtea mediterranea sexual|type=transcript|length=1374bp
AAATTAGTACGTATTCAATAGTAAATGTATCATATGGTTATTTTACTATA
ACTGAATTAGACTTAAATTTGTTTATATACTTTGTTTTACTTTATTTTTT
GAAATTTAATTCACAATGAGCAAAGGTGTATTATATGGTCCTGCTGATTT
TTATAAAACTCAGCGACTTCAAATAATTGCCAAATATTCGAGCAAAGAAA
TAGAATTTTCCGAAAATCCTGTCCCAGAAAATTTGGTAGTTCCAAAAGGA
TCTGTACCTGTTTATTGTGAAGGAGATGTCACATTTTTCGAAACCAATGC
TATTGGATATCATTTATCAAATGAACAACTAAGAGGAAATCAAAATCAAG
CCTCTGTGGCTCAATGGTCAAATTATGCTGATATGGTTTTGTTACCAGCA
ATCGGAACTTTAGTTTTTCCTTGTTTAGGATTAATGCAAATGAACAAAAG
TGAAAATGAAAAAGCAAAAAATTTAATTAATGATGAAATGAATTTTATCA
ATAAGTTCCTTTCTACAAGAACTTACTTGGTTGGTGAAAGATTAACCCAG
GCAGACATCACTTTATTCAGTGTCTTAAGGATGTTATATGAAATGATTCT
CGATGAAAAAACTCGTACTCCATTTGTCAACTTAAATAGATGGTTTTTAA
CTATTGCCAATCAAGAAAATGTTAAAAGTGTAGTCGGTGAAATCAAGTTA
TGTGTTACACCGGCTGCATTTGATGCAAAAAAATATGCAGAATTGCATCA
AAAGAAAGATAAAGAGGAAAAAAAGCCAAAAGAAAAAAAACCACAGGAGA
AGCAAGAAAAGAAACAAGAAAAGAAGCCAAAGAAAGAAGTTGAAGAAGAA
GCTGAAGCGGAAGATGAACCCGTTGTTAAAGAAGGGCCATGTCCTTATAG
TCTATTGCCAAAAGGAACATTTGATATGGAAGAATGGAAAAGAACTTATT
CAAACAACGATATTGTTACTGTAGCTTTACCATACTTCTGGAGCAAATTT
GATTCTGAAAATTATTCAATTTGGACTTGTGAATATCTCTTTCCACAAGA
ACTTGAATTGATTTTTATGACCTGCAATTTAGTTTCTGGAATGTTCCAAA
GATTAGATAGATTAAGAAAGCATGCTTTTGGCAGCATGGTTATATTAGGT
GAAAATCGTAATAATCAAATTAAAGGTCTGTGGGTATTAAAAGGACAGGA
TTTAGCTTTCACATTGCATGACGATTGTAAAGTTGATTATGAGTCTTATA
AATGGAACAAACTTGATCCAAATGCTGAAGCAACCAAGGATTTAGTCAAA
ATTTATTTTACTCATGAAGGTGATTTTGGAATGCCATTCAACCAAGGCAA
AATTTTTAAATAATGCATTAGAAT
back to top

protein sequence of SMED30017114-orf-1

>SMED30017114-orf-1 ID=SMED30017114-orf-1|Name=SMED30017114-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=416bp
MSKGVLYGPADFYKTQRLQIIAKYSSKEIEFSENPVPENLVVPKGSVPVY
CEGDVTFFETNAIGYHLSNEQLRGNQNQASVAQWSNYADMVLLPAIGTLV
FPCLGLMQMNKSENEKAKNLINDEMNFINKFLSTRTYLVGERLTQADITL
FSVLRMLYEMILDEKTRTPFVNLNRWFLTIANQENVKSVVGEIKLCVTPA
AFDAKKYAELHQKKDKEEKKPKEKKPQEKQEKKQEKKPKKEVEEEAEAED
EPVVKEGPCPYSLLPKGTFDMEEWKRTYSNNDIVTVALPYFWSKFDSENY
SIWTCEYLFPQELELIFMTCNLVSGMFQRLDRLRKHAFGSMVILGENRNN
QIKGLWVLKGQDLAFTLHDDCKVDYESYKWNKLDPNAEATKDLVKIYFTH
EGDFGMPFNQGKIFK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0006414translational elongation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000039gamma neoblast
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001662Transl_elong_EF1_G_con
IPR004046GST_C
IPR012336Thioredoxin-like_fold
IPR010987Glutathione-S-Trfase_C-like
Vocabulary: molecular function
TermDefinition
GO:0003746translation elongation factor activity