Serine/threonine-protein phosphatase

Overview
NameSerine/threonine-protein phosphatase
Smed IDSMED30017087
Length (bp)1225
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017087

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30017087SMESG000079155.1 Contig3930_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CB (protein phosphatase 1 catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9282])

HSP 1 Score: 296.975 bits (759), Expect = 6.159e-98
Identity = 143/296 (48.31%), Postives = 198/296 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+         S  + L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMM---------SVDETLMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CB (protein phosphatase 1 catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9282])

HSP 1 Score: 296.975 bits (759), Expect = 6.159e-98
Identity = 143/296 (48.31%), Postives = 198/296 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+         S  + L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMM---------SVDETLMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CB (protein phosphatase 1 catalytic subunit beta [Source:HGNC Symbol;Acc:HGNC:9282])

HSP 1 Score: 296.975 bits (759), Expect = 6.159e-98
Identity = 143/296 (48.31%), Postives = 198/296 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+         S  + L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMM---------SVDETLMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CC (protein phosphatase 1 catalytic subunit gamma [Source:HGNC Symbol;Acc:HGNC:9283])

HSP 1 Score: 292.352 bits (747), Expect = 3.025e-96
Identity = 142/301 (47.18%), Postives = 200/301 (66.45%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRP-ERRFPTT 1086
            + L E  ++ LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V   G +CDLLWSD    P+++  GW  NDRG+S+ FGA+V+ +F  K +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  + L   F++++P E++ P  
Sbjct:   28 VQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDQGLLCDLLWSD----PDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKPAEKKKPNA 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Match: PPP1CC (protein phosphatase 1 catalytic subunit gamma [Source:HGNC Symbol;Acc:HGNC:9283])

HSP 1 Score: 292.352 bits (747), Expect = 5.353e-96
Identity = 142/301 (47.18%), Postives = 200/301 (66.45%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRP-ERRFPTT 1086
            + L E  ++ LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V   G +CDLLWSD    P+++  GW  NDRG+S+ FGA+V+ +F  K +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  + L   F++++P E++ P  
Sbjct:   28 VQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDQGLLCDLLWSD----PDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKPAEKKKPNA 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-1 (Serine/threonine-protein phosphatase PP1-alpha [Source:UniProtKB/Swiss-Prot;Acc:Q27497])

HSP 1 Score: 295.434 bits (755), Expect = 8.270e-98
Identity = 140/296 (47.30%), Postives = 203/296 (68.58%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  ++ALC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF   ++K+WK+F   F  +P+AA+I+E IFC HGG+SP +  +N   +      + RP +V  TG +CDLLWSD    P+++ +GW  NDRG+S+ FG DV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+ ++++         L   F++++P  +
Sbjct:   28 VTMSEAEIRALCHKSREIFLSQPILLELEAPLKICGDIHGQYNDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRF---SIKLWKTFTDCFNCLPIAALIDEKIFCCHGGLSPDL--QNMEQIRR----VMRPTDVPDTGLLCDLLWSD----PDKDVTGWGENDRGVSFTFGPDVVAKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDET---------LMCSFQILKPSEK 301          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-2 (Serine/threonine-protein phosphatase PP1-beta [Source:UniProtKB/Swiss-Prot;Acc:P48727])

HSP 1 Score: 291.967 bits (746), Expect = 2.460e-96
Identity = 141/300 (47.00%), Postives = 203/300 (67.67%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRP--ERRFP 1080
            + L E  +K LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAII+E IFC HGG+SP     +  S+  +   I RP +V   G +CDLLWSD    P+++ +GW  NDRG+S+ FG +V+ +F  K +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+ ++++         L   F++++P  ++++P
Sbjct:   27 VQLTESEIKGLCQKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN---IKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDQGLLCDLLWSD----PDKDVTGWGENDRGVSFTFGPEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGSMMTVDET---------LMCSFQILKPADKKKYP 304          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: pph-1 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:G5EC18])

HSP 1 Score: 291.967 bits (746), Expect = 3.846e-96
Identity = 139/313 (44.41%), Postives = 203/313 (64.86%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERRFPTTKWYNDKDFEIIDN 1125
            +D+ E  ++ +C L RQI+ +QP+LLE++  + I GD+HGQF DLLR+F   G P    +LFLGDYVDRG + +E +VLLL +++KYP   +LLRGNHE   LNR YGF  E + R+   ++K+WK F  +F  MP+AA+I+  IFC HGG+SP     N  SL  +   + RP +V  TG +CD+LWSD    P+    GW PN+RG+SY FG DV+ +F +K +L++++RGHQVVEDGYEFF  R +VT+FSAP YCG +DNAG ++ ++++         L   F++++P+ +        +K    + N
Sbjct:   33 LDVTENEIRMVCVLARQIFMHQPMLLELEPPLKIGGDIHGQFADLLRLFNLAGYPPESNYLFLGDYVDRGPKSIETIVLLLCYKIKYPNNFFLLRGNHEVANLNRIYGFYDECKRRY---SVKLWKCFQDVFNCMPVAALIDNKIFCCHGGLSP-----NLRSLD-QLKRLSRPCDVQETGLLCDVLWSD----PDATVVGWAPNERGVSYVFGVDVLAQFLQKMDLDIVVRGHQVVEDGYEFFGRRGLVTVFSAPNYCGEFDNAGAVMNVDEN---------LLCSFQILKPQSQLVMDAALAEKQNNFVAN 323          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: gsp-3 (Serine/threonine-protein phosphatase PP1-gamma [Source:UniProtKB/Swiss-Prot;Acc:O02658])

HSP 1 Score: 256.914 bits (655), Expect = 4.290e-83
Identity = 115/270 (42.59%), Postives = 174/270 (64.44%), Query Frame = 1
Query:  199 EESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKS 1008
            E+ ++  C + + ++A+Q  LLE++  II+ GD+HGQ+ DLLRIF+  G P    FLFLGDYVDRG Q +E + L+L F++KYP   ++LRGNHE P +NR YGF  E   R++ +  ++W  F   F  MPL  +I   I C+HGG+SP +   +      +   +PRP +        DLLW+D    P++   GW+ N RG+SY FG DV+ + C + +++L+ R HQVV+DGYEFFA++K+VT+FSAP YCG +DN+   + ++++
Sbjct:   30 EQELQTCCAVAKSVFASQASLLEVEPPIIVCGDIHGQYSDLLRIFDKNGFPPDVNFLFLGDYVDRGRQNIETICLMLCFKIKYPENFFMLRGNHECPAINRVYGFYEECNRRYKST--RLWSIFQDTFNWMPLCGLIGSRILCMHGGLSPHLQTLD------QLRQLPRPQDPPNPSIGIDLLWAD----PDQWVKGWQANTRGVSYVFGQDVVADVCSRLDIDLVARAHQVVQDGYEFFASKKMVTIFSAPHYCGQFDNSAATMKVDEN 287          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Match: F25B3.4 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:Q27496])

HSP 1 Score: 258.455 bits (659), Expect = 7.586e-83
Identity = 126/295 (42.71%), Postives = 185/295 (62.71%), Query Frame = 1
Query:  193 LPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPV-NVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            +P E V+ L F    I+  QP+L+E+   I I GD+HGQF DLLR+F+  G P    +LFLGDYVDRG   LE ++LL A+++ +P   ++LRGNHE   +NR YGF  E + R+ + +  VW SF  +F  MPL A++ + I C+HGG+S ++  +N + L A    I RP  N +      D+LWSDP +  +    GW PN RG+SY FG+D + +  ++  ++L++R HQVV+DGYEFFANR++VT+FSAP YCG +DNA  ++ + K+         L   F V+RP ++
Sbjct:   79 IPPEDVETLLFHAFSIFNKQPMLIEVNSPINICGDIHGQFSDLLRLFDKNGFPHRANYLFLGDYVDRGKHCLETILLLFAYKVIFPNHFFMLRGNHECSLINRQYGFYEECQRRYNKPS--VWHSFQGVFSVMPLTALVGQRILCMHGGVSKML--QNVSQLRA----IKRPFDNPEPNTLAIDILWSDPTNFQK----GWNPNSRGVSYVFGSDALRKLLDRLQIDLVVRAHQVVQDGYEFFANRRLVTIFSAPFYCGQFDNAAAVMYVNKN---------LVCSFVVLRPRKK 352          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: flw (gene:FBgn0000711 transcript:FBtr0071447)

HSP 1 Score: 296.975 bits (759), Expect = 2.886e-98
Identity = 141/296 (47.64%), Postives = 195/296 (65.88%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+  QP+LLE++  +II GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAII+E IFC HGG+SP +          +   + RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FG DV+ +F  +  L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+ ++         D L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN---VKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDL------QGMEQIRRLMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVD---------DTLMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: flw (gene:FBgn0000711 transcript:FBtr0333305)

HSP 1 Score: 296.975 bits (759), Expect = 2.886e-98
Identity = 141/296 (47.64%), Postives = 195/296 (65.88%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+  QP+LLE++  +II GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAII+E IFC HGG+SP +          +   + RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FG DV+ +F  +  L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+ ++         D L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN---VKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDL------QGMEQIRRLMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVD---------DTLMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: flw (gene:FBgn0000711 transcript:FBtr0474146)

HSP 1 Score: 296.204 bits (757), Expect = 7.811e-98
Identity = 141/296 (47.64%), Postives = 195/296 (65.88%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+  QP+LLE++  +II GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAII+E IFC HGG+SP +          +   + RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FG DV+ +F  +  L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+ ++         D L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN---VKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDL------QGMEQIRRLMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVD---------DTLMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: flw (gene:FBgn0000711 transcript:FBtr0071446)

HSP 1 Score: 298.13 bits (762), Expect = 6.495e-97
Identity = 141/296 (47.64%), Postives = 195/296 (65.88%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+  QP+LLE++  +II GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAII+E IFC HGG+SP +          +   + RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FG DV+ +F  +  L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+ ++         D L   F++++P  +
Sbjct:  158 VQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN---VKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDL------QGMEQIRRLMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVD---------DTLMCSFQILKPSEK 431          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Match: Pp1alpha-96A (gene:FBgn0003134 transcript:FBtr0334334)

HSP 1 Score: 291.967 bits (746), Expect = 2.005e-96
Identity = 142/299 (47.49%), Postives = 200/299 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRP--ERRF 1077
            + L E  +++LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KY    +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAI++E IFC HGG+SP     + +S+  +   I RP +V   G +CDLLWSD    P+++  GW  NDRG+S+ FGA+V+ +F +K   +LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  D L   F++++P  +RRF
Sbjct:   26 VQLSESEIRSLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYAENFFLLRGNHECASINRIYGFYDECKRRY---TIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSP-----DLSSME-QIRRIMRPTDVPDQGLLCDLLWSD----PDKDTMGWGENDRGVSFTFGAEVVGKFLQKHEFDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDDTLMCSFQILKPADKRRF 302          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 298.901 bits (764), Expect = 5.499e-99
Identity = 144/296 (48.65%), Postives = 200/296 (67.57%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAII+E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+ +++S         L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDES---------LMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: CABZ01076667.1 (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:571753])

HSP 1 Score: 291.967 bits (746), Expect = 2.782e-96
Identity = 142/300 (47.33%), Postives = 199/300 (66.33%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRP-ERRFPT 1083
            + L E  ++ LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E   R+    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V   G +CDLLWSD    P+++  GW  NDRG+S+ FGA+V+ +F  K +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  + L   F++++P E++ P 
Sbjct:   28 VQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECRRRYN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDQGLLCDLLWSD----PDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKPAEKKKPN 305          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 291.582 bits (745), Expect = 4.425e-96
Identity = 137/296 (46.28%), Postives = 198/296 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + L E+ ++ LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   + RP +V   G +CDLLW+D    P+++  GW  NDRG+S+ FG+DV+ +F  K +++LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  + L   F++++P  +
Sbjct:   28 VQLTEQEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN---IKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSP-----DLQSME-QIRRVMRPTDVPDQGLLCDLLWAD----PDKDVMGWGENDRGVSFTFGSDVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKPAEK 301          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1caa (protein phosphatase 1, catalytic subunit, alpha isozyme a [Source:ZFIN;Acc:ZDB-GENE-040516-3])

HSP 1 Score: 290.426 bits (742), Expect = 1.090e-95
Identity = 138/293 (47.10%), Postives = 196/293 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRP 1065
            + L E  ++ LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   + RP +V   G +CDLLW+D    P+++  GW  NDRG+S+ FGADV+ +F  K +++LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  + L   F++++P
Sbjct:   24 VQLTESEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRYN---IKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSP-----DLQSME-QVRRVMRPTDVPDQGLLCDLLWAD----PDKDVLGWGENDRGVSFTFGADVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKP 294          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Match: ppp1caa (protein phosphatase 1, catalytic subunit, alpha isozyme a [Source:ZFIN;Acc:ZDB-GENE-040516-3])

HSP 1 Score: 290.812 bits (743), Expect = 1.149e-95
Identity = 138/293 (47.10%), Postives = 196/293 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRP 1065
            + L E  ++ LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   + RP +V   G +CDLLW+D    P+++  GW  NDRG+S+ FGADV+ +F  K +++LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  + L   F++++P
Sbjct:   28 VQLTESEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKVKYPENFFLLRGNHECASINRIYGFYDECKRRYN---IKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSP-----DLQSME-QVRRVMRPTDVPDQGLLCDLLWAD----PDKDVLGWGENDRGVSFTFGADVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKP 298          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:NCBI gene;Acc:496958])

HSP 1 Score: 296.59 bits (758), Expect = 6.291e-98
Identity = 143/296 (48.31%), Postives = 198/296 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+         S  + L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMM---------SVDETLMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:NCBI gene;Acc:496958])

HSP 1 Score: 296.204 bits (757), Expect = 8.251e-98
Identity = 143/296 (48.31%), Postives = 198/296 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+         S  + L   F++++P  +
Sbjct:   26 VQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMM---------SVDETLMCSFQILKPSEK 299          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:NCBI gene;Acc:496958])

HSP 1 Score: 296.204 bits (757), Expect = 8.711e-98
Identity = 143/296 (48.31%), Postives = 198/296 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+         S  + L   F++++P  +
Sbjct:   26 VQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMM---------SVDETLMCSFQILKPSEK 299          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cc (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:407879])

HSP 1 Score: 291.967 bits (746), Expect = 2.207e-96
Identity = 142/301 (47.18%), Postives = 200/301 (66.45%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRP-ERRFPTT 1086
            + L E  ++ LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V   G +CDLLWSD    P+++  GW  NDRG+S+ FGA+V+ +F  K +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  + L   F++++P E++ P  
Sbjct:   16 VQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDQGLLCDLLWSD----PDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKPAEKKKPNA 294          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Match: ppp1cc (protein phosphatase 1, catalytic subunit, gamma isozyme [Source:NCBI gene;Acc:407879])

HSP 1 Score: 292.352 bits (747), Expect = 2.833e-96
Identity = 142/301 (47.18%), Postives = 200/301 (66.45%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRP-ERRFPTT 1086
            + L E  ++ LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V   G +CDLLWSD    P+++  GW  NDRG+S+ FGA+V+ +F  K +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  + L   F++++P E++ P  
Sbjct:   28 VQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDQGLLCDLLWSD----PDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKPAEKKKPNA 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1cb (protein phosphatase 1 catalytic subunit beta [Source:MGI Symbol;Acc:MGI:104871])

HSP 1 Score: 296.975 bits (759), Expect = 4.228e-98
Identity = 143/296 (48.31%), Postives = 198/296 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+         S  + L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMM---------SVDETLMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1cb (protein phosphatase 1 catalytic subunit beta [Source:MGI Symbol;Acc:MGI:104871])

HSP 1 Score: 296.975 bits (759), Expect = 4.228e-98
Identity = 143/296 (48.31%), Postives = 198/296 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+         S  + L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMM---------SVDETLMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1cc (protein phosphatase 1 catalytic subunit gamma [Source:MGI Symbol;Acc:MGI:104872])

HSP 1 Score: 291.967 bits (746), Expect = 2.470e-96
Identity = 142/301 (47.18%), Postives = 200/301 (66.45%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRP-ERRFPTT 1086
            + L E  ++ LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V   G +CDLLWSD    P+++  GW  NDRG+S+ FGA+V+ +F  K +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  + L   F++++P E++ P  
Sbjct:   28 VQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDQGLLCDLLWSD----PDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKPAEKKKPNA 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1cc (protein phosphatase 1 catalytic subunit gamma [Source:MGI Symbol;Acc:MGI:104872])

HSP 1 Score: 291.967 bits (746), Expect = 4.231e-96
Identity = 142/301 (47.18%), Postives = 200/301 (66.45%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRP-ERRFPTT 1086
            + L E  ++ LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V   G +CDLLWSD    P+++  GW  NDRG+S+ FGA+V+ +F  K +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  + L   F++++P E++ P  
Sbjct:   28 VQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDQGLLCDLLWSD----PDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKPAEKKKPNA 306          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Match: Ppp1ca (protein phosphatase 1 catalytic subunit alpha [Source:MGI Symbol;Acc:MGI:103016])

HSP 1 Score: 290.812 bits (743), Expect = 1.113e-95
Identity = 139/293 (47.44%), Postives = 196/293 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRP 1065
            + L E  ++ LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA++++YP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V   G +CDLLWSD    P+++  GW  NDRG+S+ FGA+V+ +F  K +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  + L   F++++P
Sbjct:   28 VQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINRIYGFYDECKRRYN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDQGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKP 298          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P48489|PP1_ORYSJ (Serine/threonine-protein phosphatase PP1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0268000 PE=2 SV=2)

HSP 1 Score: 296.975 bits (759), Expect = 2.207e-97
Identity = 145/296 (48.99%), Postives = 197/296 (66.55%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + L E  ++ LC ++R+I+ +QP LLE++  I I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +++WK F   F  +P+AA+I++ I C+HGG+SP     + T L  E   +PRP +V  TG +CDLLWSD    P ++  GW  NDRG+SY FGAD + EF EK +L+LI R HQVVEDGYEFFA+R++VT+FSAP YCG +DNAG M+         S  + L   F++++P  R
Sbjct:   39 VQLSESEIRQLCTVSREIFLSQPNLLELEAPIKICGDIHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---VRLWKVFTDCFNCLPVAALIDDKILCMHGGLSP-----DLTHLD-EIKSLPRPTDVPDTGLLCDLLWSD----PGKDVQGWGMNDRGVSYTFGADKVSEFLEKHDLDLICRAHQVVEDGYEFFADRQLVTIFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKPAER 312          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P48462|PP1B_DROME (Serine/threonine-protein phosphatase beta isoform OS=Drosophila melanogaster OX=7227 GN=flw PE=1 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 2.893e-97
Identity = 141/296 (47.64%), Postives = 195/296 (65.88%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+  QP+LLE++  +II GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAII+E IFC HGG+SP +          +   + RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FG DV+ +F  +  L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+ ++         D L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN---VKLWKTFTDCFNCLPVAAIIDEKIFCCHGGLSPDL------QGMEQIRRLMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMTVD---------DTLMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P62142|PP1B_RAT (Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Rattus norvegicus OX=10116 GN=Ppp1cb PE=1 SV=3)

HSP 1 Score: 296.975 bits (759), Expect = 2.958e-97
Identity = 143/296 (48.31%), Postives = 198/296 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+         S  + L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMM---------SVDETLMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|P62143|PP1B_RABIT (Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Oryctolagus cuniculus OX=9986 GN=PPP1CB PE=1 SV=3)

HSP 1 Score: 296.975 bits (759), Expect = 2.958e-97
Identity = 143/296 (48.31%), Postives = 198/296 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+         S  + L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMM---------SVDETLMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Match: sp|Q5R740|PP1B_PONAB (Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Pongo abelii OX=9601 GN=PPP1CB PE=2 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 2.958e-97
Identity = 143/296 (48.31%), Postives = 198/296 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+         S  + L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMM---------SVDETLMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A3S5BQW5 (Serine/threonine-protein phosphatase OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS28799 PE=3 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 7.293e-101
Identity = 154/314 (49.04%), Postives = 213/314 (67.83%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMD-KPEEECS-GWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERRFPTTKWYNDKDFEIID 1122
            ++L E    ALC L + I+ ++ +LLE+   I + GD+HGQF+DLLR+F     P    +LFLGDYVDRG Q +E+L LL A ++KYPR  ++LRGNHE+  +NR YGF  E+ ER+ +S L+  K F  +F  MP+AAIIE SIFC HGG+SP +L+ N T L    N IPRPV+V   G +CDLLW+DP D  P  E   GW P+ RG S+ FG DVI++F +KF L+LI+R HQVVEDGYEF+ NRK++T+FSAP YC  +DNAGG+ +++K E+  S   +L   F++IRPE++F        +  E+++
Sbjct:   34 MELNELDCIALCCLVKPIFESENMLLELAAPIKVCGDIHGQFYDLLRLFLLCEYPPKTRYLFLGDYVDRGPQSVEVLCLLFALKIKYPRGFFMLRGNHESDIVNRIYGFRDEIRERYGKSKLR--KHFSNVFSVMPVAAIIENSIFCCHGGLSPELLQDNVTGLQEMINPIPRPVDVPRQGLLCDLLWADPADYAPNGEMQLGWTPSPRGCSWCFGHDVIDKFLDKFGLDLIVRAHQVVEDGYEFYHNRKLITVFSAPNYCNQFDNAGGVFVIKKEEESSS---VLEGGFQIIRPEKKFNAMTLNRRRSSELLE 342          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A1I8HHA2 (Serine/threonine-protein phosphatase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 3.650e-98
Identity = 143/294 (48.64%), Postives = 204/294 (69.39%), Query Frame = 1
Query:  193 LPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + EE ++ALC  +R+I+  QP+LLE++  + + GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRGHQ LE + LLLA+++K+P   +LLRGNHE   +NR YGF  E + RF   ++++WK+F   F  +P+AA+I+E IFC HGG+SP     +  SL  +   I RP +V  TG +CDLLWSD    P+++ +GW  NDRG+S+ FGADV+ +F  +F+L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+ ++++         L   F++++P  +
Sbjct:    1 MTEEEIRALCLRSREIFLQQPILLELEAPLKVCGDIHGQYTDLLRLFEYGGFPPESNYLFLGDYVDRGHQSLETICLLLAYKVKFPENFFLLRGNHECASINRIYGFYDECKRRF---SIRLWKTFTDCFNCLPIAAVIDEKIFCCHGGLSP-----DLQSLE-QVRRIMRPTDVPDTGLLCDLLWSD----PDKDVTGWGENDRGVSFTFGADVVAKFLNRFDLDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMSIDET---------LMCSFQILKPSEK 272          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A267DD19 (Serine/threonine-protein phosphatase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012061g1 PE=3 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 5.124e-98
Identity = 143/296 (48.31%), Postives = 205/296 (69.26%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + EE ++ALC  +R+I+  QP+LLE++  + + GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRGHQ LE + LLLA+++K+P   +LLRGNHE   +NR YGF  E + RF   ++++WK+F   F  +P+AA+I+E IFC HGG+SP     +  SL  +   I RP +V  TG +CDLLWSD    P+++ +GW  NDRG+S+ FGADV+ +F  +F+L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+ ++++         L   F++++P  +
Sbjct:   27 VQMTEEEIRALCLRSREIFLQQPILLELEAPLKVCGDIHGQYTDLLRLFEYGGFPPESNYLFLGDYVDRGHQSLETICLLLAYKVKFPENFFLLRGNHECASINRIYGFYDECKRRF---SIRLWKTFTDCFNCLPIAAVIDEKIFCCHGGLSP-----DLQSLE-QVRRIMRPTDVPDTGLLCDLLWSD----PDKDVTGWGENDRGVSFTFGADVVAKFLNRFDLDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMSIDET---------LMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A267F2H6 (Serine/threonine-protein phosphatase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017404g1 PE=3 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 5.410e-98
Identity = 143/296 (48.31%), Postives = 205/296 (69.26%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + EE ++ALC  +R+I+  QP+LLE++  + + GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRGHQ LE + LLLA+++K+P   +LLRGNHE   +NR YGF  E + RF   ++++WK+F   F  +P+AA+I+E IFC HGG+SP     +  SL  +   I RP +V  TG +CDLLWSD    P+++ +GW  NDRG+S+ FGADV+ +F  +F+L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+ ++++         L   F++++P  +
Sbjct:   27 VQMTEEEIRALCLRSREIFLQQPILLELEAPLKVCGDIHGQYTDLLRLFEYGGFPPESNYLFLGDYVDRGHQSLETICLLLAYKVKFPENFFLLRGNHECASINRIYGFYDECKRRF---SIRLWKTFTDCFNCLPIAAVIDEKIFCCHGGLSP-----DLQSLE-QVRRIMRPTDVPDTGLLCDLLWSD----PDKDVTGWGENDRGVSFTFGADVVAKFLNRFDLDLICRAHQVVEDGYEFFARRQLVTLFSAPNYCGEFDNAGGMMSIDET---------LMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A1J1GT87 (Serine/threonine-protein phosphatase OS=Plasmodium gallinaceum OX=5849 GN=PGAL8A_00286000 PE=3 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 1.112e-97
Identity = 149/300 (49.67%), Postives = 200/300 (66.67%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERRFPTT 1086
            ++L E  +K LC  +R+I+ NQP+LLE++  I I GD+HGQF+DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+   ++K+WK+F+  F  +P+AAII+E IFC+HGG+SP +   N   +      I RP +V   G +CDLLWSD    PE+E +GW  NDRG+S+ FG DV+  F  K  L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  + L   F++++P  +  TT
Sbjct:   26 VNLTENEIKILCLSSREIFLNQPILLELEAPIKICGDIHGQFYDLLRLFEYGGFPPDANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY---SVKLWKTFIDCFNCLPVAAIIDEKIFCMHGGLSPEL--NNMEQIRK----ITRPTDVPDNGLLCDLLWSD----PEKEINGWGENDRGVSFTFGQDVVHNFLRKHELDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKPVEKKKTT 303          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp1cb (serine/threonine-protein phosphatase PP1-beta catalytic subunit-like [Source:NCBI gene;Acc:103030509])

HSP 1 Score: 298.901 bits (764), Expect = 4.610e-99
Identity = 144/296 (48.65%), Postives = 200/296 (67.57%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAII+E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+ +++S         L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDES---------LMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: PPP1CB (serine/threonine-protein phosphatase PP1-beta catalytic subunit-like [Source:NCBI gene;Acc:103028275])

HSP 1 Score: 298.516 bits (763), Expect = 5.135e-99
Identity = 144/296 (48.65%), Postives = 200/296 (67.57%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAII+E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+ +++S         L   F++++P  +
Sbjct:   17 VQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDES---------LMCSFQILKPSEK 290          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: PPP1CB (serine/threonine-protein phosphatase PP1-beta catalytic subunit-like [Source:NCBI gene;Acc:103028275])

HSP 1 Score: 298.516 bits (763), Expect = 6.595e-99
Identity = 144/296 (48.65%), Postives = 200/296 (67.57%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAII+E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+ +++S         L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDES---------LMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ppp1cb (serine/threonine-protein phosphatase PP1-beta catalytic subunit-like [Source:NCBI gene;Acc:103030509])

HSP 1 Score: 298.13 bits (762), Expect = 1.040e-98
Identity = 144/296 (48.65%), Postives = 200/296 (67.57%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAII+E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+ +++S         L   F++++P  +
Sbjct:   31 VQMTEAEVRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDES---------LMCSFQILKPSEK 304          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Match: ENSAMXT00000056848.1 (serine/threonine-protein phosphatase PP1-beta catalytic subunit [Source:NCBI gene;Acc:103033313])

HSP 1 Score: 297.36 bits (760), Expect = 1.889e-98
Identity = 143/296 (48.31%), Postives = 198/296 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+         S  + L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMM---------SVDETLMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cab (protein phosphatase 1, catalytic subunit, alpha isozyme b [Source:ZFIN;Acc:ZDB-GENE-030131-5512])

HSP 1 Score: 288.115 bits (736), Expect = 8.380e-96
Identity = 142/300 (47.33%), Postives = 201/300 (67.00%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRP--ERRFP 1080
            + L E  ++ LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V   G +CDLLWSD    P+++  GW  NDRG+S+ FGA+V+ +F  K +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  + L   F++++P  +++FP
Sbjct:   10 VQLTEGEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHE-ASINRIYGFYDECKRRYN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDQGLLCDLLWSD----PDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKPADKKKFP 286          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010086.1 (pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 gene:ENSPMAG00000009123.1 transcript:ENSPMAT00000010086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 261.536 bits (667), Expect = 6.765e-86
Identity = 129/264 (48.86%), Postives = 176/264 (66.67%), Query Frame = 1
Query:  292 GDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTG---FVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V  TG    +CDLLWSDP    +++  GW  NDRG+S+ FG DV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+ ++++         L   F++++P  +
Sbjct:    1 GDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGDAGLLCDLLWSDP----DKDVQGWGENDRGVSFTFGGDVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDET---------LMCSFQILKPSEK 242          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp1cb (protein phosphatase 1, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-030616-609])

HSP 1 Score: 220.705 bits (561), Expect = 1.227e-70
Identity = 106/221 (47.96%), Postives = 148/221 (66.97%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEF 849
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F
Sbjct:   14 VHMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKF 221          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp5c (protein phosphatase 5, catalytic subunit [Source:ZFIN;Acc:ZDB-GENE-050327-75])

HSP 1 Score: 169.859 bits (429), Expect = 1.702e-48
Identity = 101/264 (38.26%), Postives = 148/264 (56.06%), Query Frame = 1
Query:  229 TRQIYANQPLLLEI-----KGSIIII-GDLHGQFHDLLRIFEAVGNPS-TRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIIL 999
             +Q     P L+E+     +G +I + GD+HGQ+ DLL IFE  G PS T  ++F GD+VDRG   +E++++L  F+L YP   +L+RGNHE   +N+ YGF  E++ ++     +++  F  +FQ +PLA  I   +  +HGG    +  ++  +L  +   I R      +G +CDLLWSDP  +P     G   + RG+S  FG DV   F E+ NL LIIR H+   DGYE   + + VT+FSAP YC    N G  I L
Sbjct:  176 VKQSLQKLPSLVEVTIKDEQGDMITVCGDIHGQYFDLLHIFELNGLPSETNPYVFNGDFVDRGSWSVEVILVLFGFKLLYPDHFHLMRGNHETDNMNQMYGFEGEVKAKY---TAQMFDFFSEVFQWLPLAMCINSRVLIMHGG----LFSEDGVTLD-DIRKIDRNRQPPDSGPMCDLLWSDPQPQP-----GRSVSKRGVSCQFGPDVSRAFMEQNNLELIIRSHE-KPDGYEVAHDGRCVTVFSAPNYCDQMGNKGSYIHL 425          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Match: ppp3cb (protein phosphatase 3, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-050417-406])

HSP 1 Score: 160.229 bits (404), Expect = 1.568e-44
Identity = 88/267 (32.96%), Postives = 145/267 (54.31%), Query Frame = 1
Query:  235 QIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPM-DKPEEECSGWEPND--RGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRK------VVTLFSAPGYCGTYDNAGGMIILEKS 1008
             I   +  +++I+  + + GD+HGQF DL+++FE  G+P+   +LFLGDYVDRG+  +E ++ L A ++ YP  ++LLRGNHE   L  Y+ F  E + ++ E+   V+ + +  F  +PLAA++ +   CVHGG+SP +           F   P        G +CDLLWSDP  D   E+   +  ++  RG SY +    + +F +  NL  +IR H+  + GY  +   +      ++T+FSAP Y   Y+N   ++  E +
Sbjct:   53 SILRREKTMIDIEAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPTTLFLLRGNHECRHLTEYFTFKQECKIKYTET---VYDACMDAFDCLPLAALMNQQFLCVHGGLSPEVHNLEDIRKLDRFKEPP------AFGPMCDLLWSDPSEDFGNEKTQEYFCHNTVRGCSYFYSYPAVCDFLQNNNLLSVIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENN 310          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: GLC7 (Type 1 S/T protein phosphatase (PP1) catalytic subunit; involved in glycogen metabolism, sporulation and mitotic progression; interacts with multiple regulatory subunits; regulates actomyosin ring formation; subunit of CPF; recruited to mating projections by Afr1p interaction; regulates nucleocytoplasmic shuttling of Hxk2p; import into the nucleus is inhibited during spindle assembly checkpoint arrest; involved in dephosphorylating Rps6a/b and Bnr1p [Source:SGD;Acc:S000000935])

HSP 1 Score: 290.812 bits (743), Expect = 6.752e-97
Identity = 138/296 (46.62%), Postives = 197/296 (66.55%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            +DL E  ++ LC   R I+  QP+LLE++  I I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   ++LRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAII+E IFC+HGG+SP     +  S+  +   + RP ++   G +CDLLWSD    P+++  GW  NDRG+S+ FG DV+  F +K ++ LI R HQVVEDGYEFF+ R++VTLFSAP YCG +DNAG M+ +++S         L   F++++P ++
Sbjct:   27 VDLEENEIRYLCSKARSIFIKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYN---IKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSP-----DLNSME-QIRRVMRPTDIPDVGLLCDLLWSD----PDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDES---------LLCSFQILKPAQK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPQ1 (Protein phosphatase that regulates the mating response; negatively regulates the MAP kinase signaling cascade during mating; member of the serine/threonine phosphatase PP1 family [Source:SGD;Acc:S000006100])

HSP 1 Score: 270.011 bits (689), Expect = 8.111e-86
Identity = 125/264 (47.35%), Postives = 173/264 (65.53%), Query Frame = 1
Query:  208 VKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLH--AEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMI 993
            ++ +C+  R+I+ NQP LL ++  I ++GD+HGQF+DLLRI +  G PS   +LFLGDYVDRG   LE ++LLL +++KY    ++LRGNHE+  + + YGF  E + R      KVWK F+ +F  +PLAAII++ IFCVHGGISP         LH   +   + RP ++  +G V DLLWSD    P+ + + W  NDRG+SY F    + +FC KF  +LI+RGH VVEDGYEFFA +K VT+FSAP YCG + N G ++
Sbjct:  272 IQLICYHAREIFLNQPTLLRLQAPIKVVGDVHGQFNDLLRILKLSGVPSDTNYLFLGDYVDRGKNSLETILLLLCYKIKYKDNFFMLRGNHESANVTKMYGFYDECKRRLSS---KVWKMFVDVFNTLPLAAIIQDKIFCVHGGISP--------DLHDMKQIEKVARPTDIPESGLVTDLLWSD----PDPQVTDWSENDRGVSYTFSKRNVLDFCAKFKFDLILRGHMVVEDGYEFFARKKFVTIFSAPNYCGEFHNWGAVM 520          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPZ1 (Serine/threonine protein phosphatase Z, isoform of Ppz2p; involved in regulation of potassium transport, which affects osmotic stability, cell cycle progression, and halotolerance [Source:SGD;Acc:S000004478])

HSP 1 Score: 265.774 bits (678), Expect = 8.962e-83
Identity = 127/274 (46.35%), Postives = 174/274 (63.50%), Query Frame = 1
Query:  217 LCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLL 1038
            +C   R+I+ +QP LLE+   + I+GD+HGQ+ DLLR+F   G P +  +LFLGDYVDRG Q LE ++LL  +++KYP   +LLRGNHE   + R YGF  E + R     +K+WK+F+  F  +PLAAI+   IFCVHGG+SP++   +      E   + RP +V   G + DLLWSDP D P E    WE N+RG+SY +    I +F  KF  +L+ R H VVEDGYEFF +R +VT+FSAP YCG +DN G   ++  SE L  + +LL
Sbjct:  393 ICIKAREIFLSQPSLLELSPPVKIVGDVHGQYGDLLRLFTKCGFPPSSNYLFLGDYVDRGKQSLETILLLFCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCN---IKIWKTFIDTFNTLPLAAIVAGKIFCVHGGLSPVLNSMD------EIRHVVRPTDVPDFGLINDLLWSDPTDSPNE----WEDNERGVSYCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWGA--VMSVSEGLLCSFELL 651          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPZ2 (Serine/threonine protein phosphatase Z, isoform of Ppz1p; involved in regulation of potassium transport, which affects osmotic stability, cell cycle progression, and halotolerance [Source:SGD;Acc:S000002844])

HSP 1 Score: 261.536 bits (667), Expect = 5.055e-81
Identity = 121/263 (46.01%), Postives = 168/263 (63.88%), Query Frame = 1
Query:  217 LCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEK 1005
            +C   R+++  QP LLE+  S+ I+GD+HGQ+ DLLR+F   G P    +LFLGDYVDRG Q LE ++LLL +++KYP   +LLRGNHE   + R YGF  E + R     +K+WK+F+  F  +PLAAI+   IFCVHGG+SP++   +      E   + RP +V   G + DLLWSDP D   E    WE N+RG+S+ +    I +F  KF  +L+ R H VVEDGYEFF +R +VT+FSAP YCG +DN G ++ + +
Sbjct:  428 ICHKARELFLAQPALLELSPSVKIVGDVHGQYADLLRLFTKCGFPPMANYLFLGDYVDRGKQSLETILLLLCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCN---IKIWKTFVDTFNTLPLAAIVTGKIFCVHGGLSPVLNSMD------EIRHVSRPTDVPDFGLINDLLWSDPTDSSNE----WEDNERGVSFCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVTVFSAPNYCGEFDNWGAVMTVSE 677          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Match: PPH3 (Catalytic subunit of protein phosphatase PP4 complex; Pph3p and Psy2p form active complex, Psy4p may provide substrate specificity; regulates recovery from the DNA damage checkpoint, the gene conversion- and single-strand annealing-mediated pathways of meiotic double-strand break repair and efficient Non-Homologous End-Joining (NHEJ) pathway; involved in activation of Gln3p to alleviate nitrogen catabolite repression; Pph3p and Psy2p localize to foci on meiotic chromosomes [Source:SGD;Acc:S000002482])

HSP 1 Score: 204.912 bits (520), Expect = 1.233e-63
Identity = 107/276 (38.77%), Postives = 159/276 (57.61%), Query Frame = 1
Query:  193 LPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQ 1020
            +PEE+V  LC  ++++  N+  + ++   + I GD+HGQ HDLL +FE  G      ++FLGD+VDRG   LE  +LLL ++L+YP ++ L+RGNHE  ++ + YGF  E+  ++  S   VW+    +F  + L AII  SIFCVHGG+SP M   +      E   I R   V   G +CDLLWSDP     E+   W  + RG  + FG   +++F EK N+ LI R HQ+V +GY+   +  +VT++SAP YC    N     +L+  +DL 
Sbjct:   17 IPEETVFRLCLNSQELLMNEGNVTQVDTPVTICGDIHGQLHDLLTLFEKSGGVEKTRYIFLGDFVDRGFYSLESFLLLLCYKLRYPDRITLIRGNHETRQITKVYGFYDEVVRKYGNS--NVWRYCCEVFDYLSLGAIINNSIFCVHGGLSPDMTTVD------EIRTIDRKQEVPHEGAMCDLLWSDP-----EDVDTWSLSPRGAGFLFGKREVDQFLEKNNVELIARAHQLVMEGYKEMFDGGLVTVWSAPNYCYRCGNVAA--VLKIDDDLN 277          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO44648 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RVJ0])

HSP 1 Score: 292.352 bits (747), Expect = 7.076e-97
Identity = 141/300 (47.00%), Postives = 200/300 (66.67%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRP--ERRFP 1080
            + L E  ++ LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V   G +CDLLWSD    P+++  GW  NDRG+S+ FG D++ +F  K +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  + L   F++++P  +++FP
Sbjct:   28 VQLTEAEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN---IKLWKTFTDCFNCLPVAAILDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDQGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGPDIVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKPADKKKFP 305          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO29759 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7T2Q5])

HSP 1 Score: 208.379 bits (529), Expect = 1.760e-64
Identity = 102/272 (37.50%), Postives = 157/272 (57.72%), Query Frame = 1
Query:  193 LPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKS 1008
            L E  VK LC   ++I + +  + E+K  + + GD+HGQFHDL+ +F   G      +LF+GDYVDRG+  +E + LL+  ++++P ++ +LRGNHE+ ++ + YGF  E   ++  ++  VWK F  +F  +PL A+++  IFC+HGG+SP +   +          + R   V   G +CDLLWSDP D+      GW  + RG  Y FG D+ E F     L LI R HQ+V +GY +  +R VVT+FSAP YC    N   ++ L+ +
Sbjct:   24 LTEAQVKTLCEKAKEILSKESNVQEVKCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVTLKVRFPHRICILRGNHESRQITQVYGFYDECLRKYGNAS--VWKYFTDLFDYLPLTALVDNQIFCLHGGLSPSIDTLD------HIRALDRIQEVPHEGPMCDLLWSDPDDR-----GGWGISPRGAGYTFGQDISETFNHTNGLTLITRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDA 282          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO49936 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7RFC7])

HSP 1 Score: 201.06 bits (510), Expect = 1.060e-61
Identity = 104/290 (35.86%), Postives = 167/290 (57.59%), Query Frame = 1
Query:  193 LPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIR 1062
            + E+ VK LC   R+I   +  +  +   + + GD+HGQF+DL  +F+  G+     +LF+GD+VDRG   +E  +LLLA +++YP ++ L+RGNHE+ ++ + YGF  E  +++   ++ VW+    +F  + L+AII+  +FCVHGG+SP +      S   +   I R   V   G +CDLLWSDP     E+  GW  + RG  Y FG+DV+ ++    +++LI R HQ+V +GY++  N  V+T++SAP YC    N     ILE  E L+    +  A  + +R
Sbjct:   20 ITEKEVKQLCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFKVGGDVPDTNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLKKY--GSITVWRYCAEIFDYLSLSAIIDNRVFCVHGGLSPSI------STLDQIRSIDRKQEVPHDGPMCDLLWSDP-----EDIQGWGVSPRGAGYLFGSDVVAQYNAANDIDLICRAHQLVMEGYKWHFNETVLTVWSAPNYCYRCGNVAA--ILELDEHLKREFTIFEAAPQDVR 294          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO40084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8D8])

HSP 1 Score: 168.318 bits (425), Expect = 5.959e-51
Identity = 82/171 (47.95%), Postives = 113/171 (66.08%), Query Frame = 1
Query:  550 LKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIR 1062
            +K+WK F   F  +P+AAI+E++IFC+HGG+SP     +   L    NL  RP++V   G VCDLLWSDP    +E+ +GW  NDRG+S+ FG DV+ E+ EK+  +L++R HQVVEDGY FF  RK+VTLFSAP YCG +DNAGG++         S G+ L   F +++
Sbjct:    7 IKLWKIFTDCFNCLPIAAIVEQTIFCMHGGLSP-----DLQGLDEIRNL-ERPMDVPDKGLVCDLLWSDP----DEDITGWGDNDRGVSWTFGGDVVREYLEKYGFSLVVRAHQVVEDGYRFFEKRKLVTLFSAPNYCGEFDNAGGVM---------SVGENLMCSFSILK 158          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Match: EDO36272 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7SJ38])

HSP 1 Score: 166.007 bits (419), Expect = 1.075e-46
Identity = 93/266 (34.96%), Postives = 145/266 (54.51%), Query Frame = 1
Query:  238 IYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPM-DKPEEECSGWEPND--RGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRK------VVTLFSAPGYCGTYDNAGGMIILEKS 1008
            I   +  +LE+   I + GD+HGQF+DL+++FE  G+P+T  +LFLGDYVDRG+  +E ++ L   +  Y   ++LLRGNHE   L  Y+ F TE + ++ E+   V+ + +  F  +PLAA++ +   CVHGG+SP +   +       F   P        G +CDLLWSDP+ D   E+ S    ++  RG SY +      EF +  NL  IIR H+  + GY  +   +      ++T+FSAP Y   Y+N   ++  E +
Sbjct:   49 ILRKEKTMLEVDAPITVCGDIHGQFYDLVKLFEVGGSPATTRYLFLGDYVDRGYFSIECVLYLWTLKCLYTNTLFLLRGNHECRHLTEYFTFKTECKIKYSEA---VYDACMESFDCLPLAALMNQQFLCVHGGLSPEIHTLDDVKKLDRFKEPP------AFGPMCDLLWSDPLEDYGNEKTSEHFSHNTVRGCSYFYSYPATCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAAVLKYENN 305          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: PPP1CB (serine/threonine-protein phosphatase PP1-beta catalytic subunit [Source:NCBI gene;Acc:101155811])

HSP 1 Score: 298.516 bits (763), Expect = 6.554e-99
Identity = 144/296 (48.65%), Postives = 200/296 (67.57%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAII+E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+ +++S         L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIIDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDES---------LMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000013925.2 (serine/threonine-protein phosphatase PP1-beta catalytic subunit [Source:NCBI gene;Acc:101158483])

HSP 1 Score: 297.36 bits (760), Expect = 1.961e-98
Identity = 143/296 (48.31%), Postives = 198/296 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + + E  V+ LC  +R+I+ +QP+LLE++  + I GD+HGQ+ DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + RF    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V  TG +CDLLWSD    P+++  GW  NDRG+S+ FGADV+ +F  + +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAGGM+         S  + L   F++++P  +
Sbjct:   27 VQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDTGLLCDLLWSD----PDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMM---------SVDETLMCSFQILKPSEK 300          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ENSORLT00000019964.2 (protein phosphatase 1 catalytic subunit gamma [Source:NCBI gene;Acc:101161814])

HSP 1 Score: 291.197 bits (744), Expect = 4.846e-96
Identity = 141/300 (47.00%), Postives = 200/300 (66.67%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRP-ERRFPT 1083
            + L E  ++ LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   I RP +V   G +CDLLWSD    P+++  GW  NDRG+S+ FG++V+ +F  K +L+LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  + L   F++++P E++ P 
Sbjct:   28 VQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN---IKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSP-----DLQSME-QIRRIMRPTDVPDQGLLCDLLWSD----PDKDVLGWGENDRGVSFTFGSEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKPAEKKKPN 305          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp1cab (serine/threonine-protein phosphatase alpha-2 isoform [Source:NCBI gene;Acc:101171445])

HSP 1 Score: 290.812 bits (743), Expect = 7.003e-96
Identity = 138/293 (47.10%), Postives = 196/293 (66.89%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRP 1065
            + L E  ++ LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   + RP +V   G +CDLLW+D    P+++  GW  NDRG+S+ FGADV+ +F  K +++LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  + L   F++++P
Sbjct:   28 VQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN---IKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSP-----DLQSME-QIRRVMRPTDVPDQGLLCDLLWAD----PDKDVLGWGENDRGVSFTFGADVVTKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKP 298          
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Match: ppp1caa (serine/threonine-protein phosphatase alpha-2 isoform-like [Source:NCBI gene;Acc:101169945])

HSP 1 Score: 289.656 bits (740), Expect = 2.459e-95
Identity = 138/296 (46.62%), Postives = 197/296 (66.55%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERR 1074
            + L E  ++ LC  +R+I+ +QP+LLE++  + I GD+HGQ++DLLR+FE  G P    +LFLGDYVDRG Q LE + LLLA+++KYP   +LLRGNHE   +NR YGF  E + R+    +K+WK+F   F  +P+AAI++E IFC HGG+SP     +  S+  +   + RP +V   G +CDLLW+D    P+++  GW  NDRG+S+ FGADV+ +F  K +++LI R HQVVEDGYEFFA R++VTLFSAP YCG +DNAG M+         S  + L   F++++P  +
Sbjct:   28 VQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDVHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYN---IKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSP-----DLQSME-QIRRVMRPTDVPDQGLLCDLLWAD----PDKDVLGWGENDRGVSFTFGADVVAKFLHKHDMDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMM---------SVDETLMCSFQILKPADK 301          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000079155.1 (SMESG000079155.1)

HSP 1 Score: 698.353 bits (1801), Expect = 0.000e+0
Identity = 364/364 (100.00%), Postives = 364/364 (100.00%), Query Frame = 1
Query:   43 MNNVEMPPRAPINPDLDKLKNASNVQXXXXXXXXXXXXXXXXXXXXXXIDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERRFPTTKWYNDKDFEIIDNHSK 1134
            MNNVEMPPRAPINPDLDKLKNASNVQIELDLDLIIERLLKLKKRPLERIDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERRFPTTKWYNDKDFEIIDNHSK
Sbjct:    1 MNNVEMPPRAPINPDLDKLKNASNVQIELDLDLIIERLLKLKKRPLERIDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERRFPTTKWYNDKDFEIIDNHSK 364          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000022539.1 (SMESG000022539.1)

HSP 1 Score: 327.02 bits (837), Expect = 3.776e-109
Identity = 156/304 (51.32%), Postives = 217/304 (71.38%), Query Frame = 1
Query:  190 DLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECS-GWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRP--ERRFPTTKW 1092
            +L +  ++ L  ++R+I+ N+  +LEIK  I I GDLHGQF+DL+RIF+  G+P  R +LFLGDY+DRG +GLE + LL A+++KYP ++YLLRGNHE   ++R YGF  E+  RF  S  K+W +FLR F  +PLAAIIEES+FC HGG+SP  ++  FTSL +E N I RP+ V   G +CDLLW+DP+D+  +    G+ PN+RG S++FG DVIE F +KF+L+LI+R HQVVEDGYEF+ANRK++T+FSAP YCG +DNAG +  L+ +E  QST   +   F +++P  E  F +  W
Sbjct:   77 NLSQTHMQLLAIISREIFKNEKSVLEIKAPIRICGDLHGQFNDLIRIFKLAGDPQNRKYLFLGDYIDRGSKGLECICLLFAYKIKYPDQIYLLRGNHETEAVSRIYGFRDEIITRFSSS--KLWWTFLRTFNYLPLAAIIEESVFCCHGGLSPEFMQSRFTSLTSELNKINRPLEVPAKGLICDLLWADPLDQVGKSVPLGFIPNERGCSWSFGFDVIERFLDKFDLDLIVRAHQVVEDGYEFYANRKLITIFSAPNYCGEFDNAGAIFCLDYNEKNQSTL-TVDGGFIILKPRVEPHFHSRNW 377          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000003447.1 (SMESG000003447.1)

HSP 1 Score: 305.064 bits (780), Expect = 2.647e-101
Identity = 145/305 (47.54%), Postives = 202/305 (66.23%), Query Frame = 1
Query:  187 IDLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDP--MDKPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDL-QSTGDLLRAKFKVIRPERRFPTTKW 1092
            +DL  E   A+ ++++ I+  +P+LLE+   I I GD+HGQ+ DLLR+F+  G      +LFLGDYVDRG  GLE + LL   ++KYP  +YLLRGNHE   LNR YGF  E+  RF  S  K+WK+FL+ F  +P+AAI+E +IFC HGG+SP +L  +  +L    N + RP +V   G +CDLLWSDP  M+  E    GWE NDRG S+ FG D +E+F  KF+L+LIIRGHQVVEDGYEF+ +RK++T+F+AP YCG +DNAGG+  L K+ +  +    ++   F +++P    P  +W
Sbjct:   28 LDLNYEDYLAIAYVSKSIFIKEPMLLEVNAPIKICGDIHGQYTDLLRMFKLCGYVPKSRYLFLGDYVDRGSYGLECICLLFCLKIKYPNHLYLLRGNHECETLNRTYGFRDEVRNRFGSS--KIWKAFLKTFNFLPVAAIVENTIFCCHGGLSPDLLSASVKNLKNTINAVKRPTDVPLEGLLCDLLWSDPTDMESLESRPQGWEVNDRGCSWTFGFDAVEQFLNKFDLDLIIRGHQVVEDGYEFYCDRKLITVFTAPNYCGKFDNAGGIFCLSKNLNTPKGLPPIVEGSFVILKPNYELP-NQW 329          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000004381.1 (SMESG000004381.1)

HSP 1 Score: 303.138 bits (775), Expect = 1.420e-100
Identity = 144/287 (50.17%), Postives = 199/287 (69.34%), Query Frame = 1
Query:  214 ALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEEC--SGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDL-QSTGDLLRAKFKVIRP 1065
            ++  + +  +A +  +LE+   I I GD+HGQ+ DLLR+F   G P  + FLFLGDYVDRG+ GLE + LL + +++YP+ ++LLRGNHE   +NR+YGF  E+  +F   + K+W++FL+ F  +P+ A I+ SIFC HGG+SP ML+   TSL    N I RP NV   G VCDLLWSDP D  E E   +GWE N+RG S+ FG D+IE+F +KF+L+LI+R HQVVEDGYEFF NRK++T+FSAP YCG +DNAGG+  LEK+ D    T  ++  KF +++P
Sbjct:   45 SIALVAQSHFATENAMLELVAPIHICGDIHGQYRDLLRLFHMCGFPPNQRFLFLGDYVDRGNYGLECVCLLFSLKIRYPKDIFLLRGNHECENINRFYGFRDEIRSKF--CSTKLWRAFLKPFDCLPICATIDNSIFCCHGGLSPFMLDPQITSLKDLVNNIKRPCNVILEGLVCDLLWSDPTDLIEGESPPNGWEDNERGCSWTFGYDIIEKFLDKFDLDLIVRAHQVVEDGYEFFCNRKLLTIFSAPNYCGKFDNAGGIFQLEKNFDTPHGTPPIIEGKFLILQP 329          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000070492.1 (SMESG000070492.1)

HSP 1 Score: 301.982 bits (772), Expect = 3.424e-100
Identity = 139/305 (45.57%), Postives = 204/305 (66.89%), Query Frame = 1
Query:  190 DLPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAVGNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPELNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGISPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMD-KPEEECSGWEPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTLFSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERRFPTTKWYND 1101
            +L  +  +A+  + R  +    + + +   I + GD+HGQF DLLR+F+  G P    +LFLGDYVDRG +GLE+L+LL  +++KYP  +++LRGNHE   + R YGF  E++ERF  S  KVWK+FL+ FQ MP+ AIIE+SIFC HGG+SP+     + +L   F  +  P  +   G +CDL+W+DPMD   + E +GW  N RG S+ FG D+I EF +KF+L+L+IRGHQVVEDGYEF+ +R +VTLF+AP YCG +DNAGG+ +L++ E   ++   L   FK++ P+ + P  +W+ +
Sbjct:   36 NLSAKECQAVAVVIRAEFDLNSICVYVNAPIKVCGDIHGQFTDLLRVFDLCGYPPNSRYLFLGDYVDRGRKGLEVLMLLFLYKIKYPSSIFMLRGNHECERITRVYGFRQEIKERFNSS--KVWKAFLKTFQLMPMCAIIEKSIFCCHGGLSPIFFSDKYKTLEEVFGTVSLPSEISYEGLLCDLVWADPMDFDGKTEPTGWVTNKRGCSWNFGCDIIREFLKKFSLDLVIRGHQVVEDGYEFYCDRSLVTLFTAPRYCGEFDNAGGIFVLDR-EVKANSETTLEGSFKILSPDYKIP-HQWFRN 336          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP1CB6.159e-9848.31protein phosphatase 1 catalytic subunit beta [Sour... [more]
PPP1CB6.159e-9848.31protein phosphatase 1 catalytic subunit beta [Sour... [more]
PPP1CB6.159e-9848.31protein phosphatase 1 catalytic subunit beta [Sour... [more]
PPP1CC3.025e-9647.18protein phosphatase 1 catalytic subunit gamma [Sou... [more]
PPP1CC5.353e-9647.18protein phosphatase 1 catalytic subunit gamma [Sou... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsp-18.270e-9847.30Serine/threonine-protein phosphatase PP1-alpha [S... [more]
gsp-22.460e-9647.00Serine/threonine-protein phosphatase PP1-beta [So... [more]
pph-13.846e-9644.41Serine/threonine-protein phosphatase [Source:UniP... [more]
gsp-34.290e-8342.59Serine/threonine-protein phosphatase PP1-gamma [S... [more]
F25B3.47.586e-8342.71Serine/threonine-protein phosphatase [Source:UniP... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
flw2.886e-9847.64gene:FBgn0000711 transcript:FBtr0071447[more]
flw2.886e-9847.64gene:FBgn0000711 transcript:FBtr0333305[more]
flw7.811e-9847.64gene:FBgn0000711 transcript:FBtr0474146[more]
flw6.495e-9747.64gene:FBgn0000711 transcript:FBtr0071446[more]
Pp1alpha-96A2.005e-9647.49gene:FBgn0003134 transcript:FBtr0334334[more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cb5.499e-9948.65protein phosphatase 1, catalytic subunit, beta iso... [more]
CABZ01076667.12.782e-9647.33protein phosphatase 1, catalytic subunit, gamma is... [more]
ppp1cab4.425e-9646.28protein phosphatase 1, catalytic subunit, alpha is... [more]
ppp1caa1.090e-9547.10protein phosphatase 1, catalytic subunit, alpha is... [more]
ppp1caa1.149e-9547.10protein phosphatase 1, catalytic subunit, alpha is... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cb6.291e-9848.31protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp1cb8.251e-9848.31protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp1cb8.711e-9848.31protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp1cc2.207e-9647.18protein phosphatase 1, catalytic subunit, gamma is... [more]
ppp1cc2.833e-9647.18protein phosphatase 1, catalytic subunit, gamma is... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp1cb4.228e-9848.31protein phosphatase 1 catalytic subunit beta [Sour... [more]
Ppp1cb4.228e-9848.31protein phosphatase 1 catalytic subunit beta [Sour... [more]
Ppp1cc2.470e-9647.18protein phosphatase 1 catalytic subunit gamma [Sou... [more]
Ppp1cc4.231e-9647.18protein phosphatase 1 catalytic subunit gamma [Sou... [more]
Ppp1ca1.113e-9547.44protein phosphatase 1 catalytic subunit alpha [Sou... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P48489|PP1_ORYSJ2.207e-9748.99Serine/threonine-protein phosphatase PP1 OS=Oryza ... [more]
sp|P48462|PP1B_DROME2.893e-9747.64Serine/threonine-protein phosphatase beta isoform ... [more]
sp|P62142|PP1B_RAT2.958e-9748.31Serine/threonine-protein phosphatase PP1-beta cata... [more]
sp|P62143|PP1B_RABIT2.958e-9748.31Serine/threonine-protein phosphatase PP1-beta cata... [more]
sp|Q5R740|PP1B_PONAB2.958e-9748.31Serine/threonine-protein phosphatase PP1-beta cata... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S5BQW57.293e-10149.04Serine/threonine-protein phosphatase OS=Protopolys... [more]
A0A1I8HHA23.650e-9848.64Serine/threonine-protein phosphatase OS=Macrostomu... [more]
A0A267DD195.124e-9848.31Serine/threonine-protein phosphatase OS=Macrostomu... [more]
A0A267F2H65.410e-9848.31Serine/threonine-protein phosphatase OS=Macrostomu... [more]
A0A1J1GT871.112e-9749.67Serine/threonine-protein phosphatase OS=Plasmodium... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cb4.610e-9948.65serine/threonine-protein phosphatase PP1-beta cata... [more]
PPP1CB5.135e-9948.65serine/threonine-protein phosphatase PP1-beta cata... [more]
PPP1CB6.595e-9948.65serine/threonine-protein phosphatase PP1-beta cata... [more]
ppp1cb1.040e-9848.65serine/threonine-protein phosphatase PP1-beta cata... [more]
ENSAMXT00000056848.11.889e-9848.31serine/threonine-protein phosphatase PP1-beta cata... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1cab8.380e-9647.33protein phosphatase 1, catalytic subunit, alpha is... [more]
ENSPMAT00000010086.16.765e-8648.86pep scaffold:Pmarinus_7.0:GL479411:90249:92178:-1 ... [more]
ppp1cb1.227e-7047.96protein phosphatase 1, catalytic subunit, beta iso... [more]
ppp5c1.702e-4838.26protein phosphatase 5, catalytic subunit [Source:Z... [more]
ppp3cb1.568e-4432.96protein phosphatase 3, catalytic subunit, beta iso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
GLC76.752e-9746.62Type 1 S/T protein phosphatase (PP1) catalytic sub... [more]
PPQ18.111e-8647.35Protein phosphatase that regulates the mating resp... [more]
PPZ18.962e-8346.35Serine/threonine protein phosphatase Z, isoform of... [more]
PPZ25.055e-8146.01Serine/threonine protein phosphatase Z, isoform of... [more]
PPH31.233e-6338.77Catalytic subunit of protein phosphatase PP4 compl... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO446487.076e-9747.00Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO297591.760e-6437.50Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO499361.060e-6135.86Serine/threonine-protein phosphatase [Source:UniP... [more]
EDO400845.959e-5147.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362721.075e-4634.96Serine/threonine-protein phosphatase [Source:UniP... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP1CB6.554e-9948.65serine/threonine-protein phosphatase PP1-beta cata... [more]
ENSORLT00000013925.21.961e-9848.31serine/threonine-protein phosphatase PP1-beta cata... [more]
ENSORLT00000019964.24.846e-9647.00protein phosphatase 1 catalytic subunit gamma [Sou... [more]
ppp1cab7.003e-9647.10serine/threonine-protein phosphatase alpha-2 isofo... [more]
ppp1caa2.459e-9546.62serine/threonine-protein phosphatase alpha-2 isofo... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079155.10.000e+0100.00SMESG000079155.1[more]
SMESG000022539.13.776e-10951.32SMESG000022539.1[more]
SMESG000003447.12.647e-10147.54SMESG000003447.1[more]
SMESG000004381.11.420e-10050.17SMESG000004381.1[more]
SMESG000070492.13.424e-10045.57SMESG000070492.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017087 ID=SMED30017087|Name=Serine/threonine-protein phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=1225bp
TCAAAACCAAATCAATGAAATAAAAATAAATTTATCATAAGGATGAATAA
TGTAGAAATGCCACCTAGGGCACCAATAAATCCTGATCTCGATAAATTAA
AGAATGCTAGTAATGTTCAGATTGAACTAGATTTAGATTTGATTATAGAG
CGTTTATTAAAATTGAAAAAGCGCCCATTGGAAAGAATTGACCTTCCTGA
AGAATCTGTAAAAGCTTTATGCTTTTTAACAAGGCAAATTTATGCTAATC
AGCCTTTACTATTGGAAATTAAAGGTTCAATTATCATAATCGGCGACCTA
CATGGCCAATTTCACGATCTGCTGCGAATCTTTGAAGCCGTTGGTAACCC
TTCAACAAGAGCATTTTTGTTTTTAGGAGATTATGTAGACCGAGGTCATC
AGGGTCTTGAAATACTAGTATTGCTTCTTGCTTTTCAATTGAAATATCCA
AGAAAAGTATATTTACTTAGAGGAAACCATGAAAATCCAGAATTAAATAG
ATATTACGGTTTCCTTACGGAATTAGAGGAAAGATTTGAAGAAAGTGCTT
TAAAAGTTTGGAAATCCTTTTTAAGAATGTTCCAAGAGATGCCTTTAGCA
GCAATAATTGAAGAAAGTATATTTTGTGTACATGGCGGAATATCTCCTTT
AATGCTTGAGAAAAACTTTACATCTCTTCATGCGGAATTTAATCTCATAC
CAAGGCCTGTGAATGTTGACACGACAGGATTTGTTTGTGACTTACTCTGG
TCAGATCCGATGGATAAACCCGAAGAAGAATGTTCTGGCTGGGAACCCAA
TGATAGAGGTATCTCTTATGCATTTGGCGCTGATGTAATTGAGGAATTTT
GTGAAAAATTCAATCTTAATTTGATAATTCGGGGACATCAAGTTGTTGAA
GATGGTTATGAATTCTTTGCTAATCGAAAGGTAGTAACTTTATTTTCCGC
TCCTGGGTATTGTGGAACTTATGATAACGCCGGCGGTATGATAATTCTTG
AGAAAAGTGAAGATTTACAGAGCACTGGAGATCTTTTAAGAGCTAAATTT
AAAGTCATTCGACCTGAAAGACGTTTTCCAACGACTAAATGGTACAACGA
CAAAGATTTTGAAATAATTGATAACCATTCAAAATAAATAGTTATTTTAA
GTAATATTTTTTTATGAAGTATTATTTGGAGCCGTAAACTTGTAAGGTTT
CCTTTTTTTGAAATCAATATTTTAC
back to top

protein sequence of SMED30017087-orf-1

>SMED30017087-orf-1 ID=SMED30017087-orf-1|Name=SMED30017087-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=365bp
MNNVEMPPRAPINPDLDKLKNASNVQIELDLDLIIERLLKLKKRPLERID
LPEESVKALCFLTRQIYANQPLLLEIKGSIIIIGDLHGQFHDLLRIFEAV
GNPSTRAFLFLGDYVDRGHQGLEILVLLLAFQLKYPRKVYLLRGNHENPE
LNRYYGFLTELEERFEESALKVWKSFLRMFQEMPLAAIIEESIFCVHGGI
SPLMLEKNFTSLHAEFNLIPRPVNVDTTGFVCDLLWSDPMDKPEEECSGW
EPNDRGISYAFGADVIEEFCEKFNLNLIIRGHQVVEDGYEFFANRKVVTL
FSAPGYCGTYDNAGGMIILEKSEDLQSTGDLLRAKFKVIRPERRFPTTKW
YNDKDFEIIDNHSK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR006186Ser/Thr-sp_prot-phosphatase
IPR031675STPPase_N
IPR004843Calcineurin-like_PHP_ApaH
IPR029052Metallo-depent_PP-like
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0004721phosphoprotein phosphatase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation