LRRCC1

Overview
NameLRRCC1 (AFB74719.1)
Smed IDSMED30017079
Length (bp)2828
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LRRCC1 (SMED30017079) t-SNE clustered cells

Violin plots show distribution of expression levels for LRRCC1 (SMED30017079) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LRRCC1 (SMED30017079) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LRRCC1 (SMED30017079) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017079

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30017079SMESG000016752.1 SmedASXL_015082SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30017079SMESG000016752.1 dd_Smed_v4_10086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30017079SMESG000016752.1 dd_Smed_v4_10086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30017079SMESG000016752.1 dd_Smed_v4_10086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30017079SMESG000016752.1 dd_Smed_v4_10086_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30017079SMESG000016752.1 dd_Smed_v6_10086_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30017079SMESG000016752.1 SMESG000016751.1 SMESG000016750.1 SMESG000016749.1 SMESG000016748.1 Contig17129newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30017079SMESG000016752.1 SMESG000016751.1 SMESG000016750.1 SMESG000016749.1 SMESG000016748.1 Contig17129uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30017079SMESG000016752.1 dd_Smed_v4_10086_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LRRCC1 vs. Ensembl Human
Match: LRRCC1 (leucine rich repeat and coiled-coil centrosomal protein 1 [Source:HGNC Symbol;Acc:HGNC:29373])

HSP 1 Score: 225.713 bits (574), Expect = 1.246e-60
Identity = 199/622 (31.99%), Postives = 348/622 (55.95%), Query Frame = 1
Query: 1006 DGKIANLIKELDQERNKRL---DLENKLQLVINKYKDAQLMLTNDRKSKED----AIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHE--MNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNE-------AQEK----SDVLQRQLDSIEQKYKSQL-ELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEVDSD 2808
            D    +L+++LDQER KR      ENKL   I++       L      KED    A+ +TD+L     +E++ + +LE  VH LQ + K+  +EL + +   E     ++   +  EK+   K ++     R + E +L    A+  +  ++       +Q   L   L+ +E+E++  L  R      + +D + +++  A+ E  HE  +  ++ K+   + QY DLENEFR+AL +EA R++ ++  +  + TE    K  L    +K+ ES SLI +LT +VK+QK KL E+SK KQE+  N + +I TLE  +E+ +++ +Q EL K E  ++ ++L+A+ES++ GLRTERK+W  ELAQQG  L Q+R KLE +IE+ + E  CL+   E  +++L+ KCK +++QT  I ++K+ L EKD   K   +K+ E +K  + +++    ++    + + +  +RKE+LK  +   + +L+E   +   +N+KW +K EL+  LE+QV ++K  +E K  +L  ER++       A EK     D  +RQ+D+I + +++++ +LA + +  I   A+ +V  IE EMR LL+ET + KK + ++++ L  A+ E+  D
Sbjct:  400 DNTYQSLVEQLDQEREKRWRAEQAENKLMDYIDE-------LHKHANEKEDIHSLALLTTDRLKEIIFRERNSKGQLEVMVHKLQNEIKKLTVELMKAKDQQEDHLKHLRTLEKTLEKMERQKRQQQAAQIRLIQEVELKASAADREIYLLRTSLHREREQAQQLHQLLALKEQEHRKELETREFFTDADFQDALAKEI--AKEEKKHEQMIKEYQEKIDVLSQQYMDLENEFRIALTVEARRFQDVKDGFENVATELAKSKHALIWAQRKENESSSLIKDLTCMVKEQKTKLAEVSKLKQETAANLQNQINTLEILIEDDKQKSIQIELLKHEKVQLISELAAKESLIFGLRTERKVWGHELAQQGSSLAQNRGKLEAQIESLSRENECLRKTNESDSDALRIKCKIIDDQTETIRKLKDCLQEKDEHIKRLQEKITEIEKCTQEQLDEKSSQLDEVLEKLERHNERKEKLKQQLKGKEVELEEIRKAYSTLNRKWHDKGELLCHLETQVKEVKEKFENKEKKLKAERDKSIELQKNAMEKLHSMDDAFKRQVDAIVEAHQAEIAQLANEKQKCI-DSANLKVHQIEKEMRELLEETCKNKKTMEAKIKQLAFALNEIQQD 1011          

HSP 2 Score: 130.183 bits (326), Expect = 4.347e-30
Identity = 78/180 (43.33%), Postives = 108/180 (60.00%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL---EINILSDIPGLENFLEYLSSS 690
            N+I  I+ ++ + NL+HLDLSSN I++I GL+ L  L TLNLS N I K+EG+ +L  L +LNVS+N I D+SGL     +  H L  I++  N+I  I H+++    L  L  L L  +   NPVC  P YR  +L +L QL+ILD K+  G P+   EIN  S +  LE  L+ L SS
Sbjct:   33 NNISKIEAIDHIWNLQHLDLSSNQISRIEGLNTLTKLCTLNLSCNLITKVEGLEELINLTRLNVSYNHIDDLSGLIPLHGI-KHKLRYIDLHSNRIDSIHHLLQCMVGLHFLTNLILEKDGDDNPVCRLPGYRAVILQTLPQLRILDCKNIFGEPVNLTEINS-SQLQCLEGLLDNLVSS 210          
BLAST of LRRCC1 vs. Ensembl Human
Match: LRRCC1 (leucine rich repeat and coiled-coil centrosomal protein 1 [Source:HGNC Symbol;Acc:HGNC:29373])

HSP 1 Score: 225.328 bits (573), Expect = 1.895e-60
Identity = 199/622 (31.99%), Postives = 348/622 (55.95%), Query Frame = 1
Query: 1006 DGKIANLIKELDQERNKRL---DLENKLQLVINKYKDAQLMLTNDRKSKED----AIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHE--MNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNE-------AQEK----SDVLQRQLDSIEQKYKSQL-ELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEVDSD 2808
            D    +L+++LDQER KR      ENKL   I++       L      KED    A+ +TD+L     +E++ + +LE  VH LQ + K+  +EL + +   E     ++   +  EK+   K ++     R + E +L    A+  +  ++       +Q   L   L+ +E+E++  L  R      + +D + +++  A+ E  HE  +  ++ K+   + QY DLENEFR+AL +EA R++ ++  +  + TE    K  L    +K+ ES SLI +LT +VK+QK KL E+SK KQE+  N + +I TLE  +E+ +++ +Q EL K E  ++ ++L+A+ES++ GLRTERK+W  ELAQQG  L Q+R KLE +IE+ + E  CL+   E  +++L+ KCK +++QT  I ++K+ L EKD   K   +K+ E +K  + +++    ++    + + +  +RKE+LK  +   + +L+E   +   +N+KW +K EL+  LE+QV ++K  +E K  +L  ER++       A EK     D  +RQ+D+I + +++++ +LA + +  I   A+ +V  IE EMR LL+ET + KK + ++++ L  A+ E+  D
Sbjct:  420 DNTYQSLVEQLDQEREKRWRAEQAENKLMDYIDE-------LHKHANEKEDIHSLALLTTDRLKEIIFRERNSKGQLEVMVHKLQNEIKKLTVELMKAKDQQEDHLKHLRTLEKTLEKMERQKRQQQAAQIRLIQEVELKASAADREIYLLRTSLHREREQAQQLHQLLALKEQEHRKELETREFFTDADFQDALAKEI--AKEEKKHEQMIKEYQEKIDVLSQQYMDLENEFRIALTVEARRFQDVKDGFENVATELAKSKHALIWAQRKENESSSLIKDLTCMVKEQKTKLAEVSKLKQETAANLQNQINTLEILIEDDKQKSIQIELLKHEKVQLISELAAKESLIFGLRTERKVWGHELAQQGSSLAQNRGKLEAQIESLSRENECLRKTNESDSDALRIKCKIIDDQTETIRKLKDCLQEKDEHIKRLQEKITEIEKCTQEQLDEKSSQLDEVLEKLERHNERKEKLKQQLKGKEVELEEIRKAYSTLNRKWHDKGELLCHLETQVKEVKEKFENKEKKLKAERDKSIELQKNAMEKLHSMDDAFKRQVDAIVEAHQAEIAQLANEKQKCI-DSANLKVHQIEKEMRELLEETCKNKKTMEAKIKQLAFALNEIQQD 1031          

HSP 2 Score: 132.109 bits (331), Expect = 1.390e-30
Identity = 88/217 (40.55%), Postives = 127/217 (58.53%), Query Frame = 1
Query:   49 GESESENILEENYIDFGVKDILSXXXXXXXXXXXXXYNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL---EINILSDIPGLENFLEYLSSS 690
            G+S   ++    ++D G++ I  L L +    +NLH N+I  I+ ++ + NL+HLDLSSN I++I GL+ L  L TLNLS N I K+EG+ +L  L +LNVS+N I D+SGL     +  H L  I++  N+I  I H+++    L  L  L L  +   NPVC  P YR  +L +L QL+ILD K+  G P+   EIN  S +  LE  L+ L SS
Sbjct:   19 GDSSCGDVC---FMDKGLQSISELSLDSTLHAVNLHCNNISKIEAIDHIWNLQHLDLSSNQISRIEGLNTLTKLCTLNLSCNLITKVEGLEELINLTRLNVSYNHIDDLSGLIPLHGI-KHKLRYIDLHSNRIDSIHHLLQCMVGLHFLTNLILEKDGDDNPVCRLPGYRAVILQTLPQLRILDCKNIFGEPVNLTEINS-SQLQCLEGLLDNLVSS 230          
BLAST of LRRCC1 vs. Ensembl Human
Match: CNTRL (centriolin [Source:HGNC Symbol;Acc:HGNC:1858])

HSP 1 Score: 70.4774 bits (171), Expect = 1.451e-11
Identity = 57/153 (37.25%), Postives = 83/153 (54.25%), Query Frame = 1
Query:  175 IKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHV--IKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL 627
            I+ LE  + L  L+LS NLI KI  LD L+ LR LNLS N+I KIEGI  +  L KLN++ N+I  I  +     L S  L  + ++GN+I  +  +  +K  Q LI+   L L++    NPV + P Y +  +  L  L+ L+     G P+
Sbjct:  118 IENLEKCVKLEVLNLSYNLIGKIEKLDKLLKLRELNLSYNKISKIEGIENMCNLQKLNLAGNEIEHIP-VWLGKKLKS--LRVLNLKGNKISSLQDISKLKPLQDLIS---LILVE----NPVVTLPHYLQFTIFHLRSLESLE-----GQPV 255          
BLAST of LRRCC1 vs. Ensembl Human
Match: CNTRL (centriolin [Source:HGNC Symbol;Acc:HGNC:1858])

HSP 1 Score: 70.4774 bits (171), Expect = 1.451e-11
Identity = 57/153 (37.25%), Postives = 83/153 (54.25%), Query Frame = 1
Query:  175 IKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHV--IKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL 627
            I+ LE  + L  L+LS NLI KI  LD L+ LR LNLS N+I KIEGI  +  L KLN++ N+I  I  +     L S  L  + ++GN+I  +  +  +K  Q LI+   L L++    NPV + P Y +  +  L  L+ L+     G P+
Sbjct:  118 IENLEKCVKLEVLNLSYNLIGKIEKLDKLLKLRELNLSYNKISKIEGIENMCNLQKLNLAGNEIEHIP-VWLGKKLKS--LRVLNLKGNKISSLQDISKLKPLQDLIS---LILVE----NPVVTLPHYLQFTIFHLRSLESLE-----GQPV 255          
BLAST of LRRCC1 vs. Ensembl Human
Match: CNTRL (centriolin [Source:HGNC Symbol;Acc:HGNC:1858])

HSP 1 Score: 65.855 bits (159), Expect = 2.244e-10
Identity = 58/153 (37.91%), Postives = 84/153 (54.90%), Query Frame = 1
Query:  175 IKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHV--IKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILD-----TKDR 612
            I+ LE  + L  L+LS NLI KI  LD L+ LR LNLS N+I KIEGI  +  L KLN++ N+I  I  +     L S  L  + ++GN+I  +  +  +K  Q LI+   L L++    NPV + P Y +  +  L  L+ L+     T+DR
Sbjct:  118 IENLEKCVKLEVLNLSYNLIGKIEKLDKLLKLRELNLSYNKISKIEGIENMCNLQKLNLAGNEIEHIP-VWLGKKLKS--LRVLNLKGNKISSLQDISKLKPLQDLIS---LILVE----NPVVTLPHYLQFTIFHLRSLESLEGQPVTTQDR 260          
BLAST of LRRCC1 vs. Ensembl Celegans
Match: C06A8.6 (pep chromosome:WBcel235:II:7772499:7773914:1 gene:WBGene00015516.1 transcript:C06A8.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06A8.6)

HSP 1 Score: 57.7658 bits (138), Expect = 1.628e-8
Identity = 41/104 (39.42%), Postives = 57/104 (54.81%), Query Frame = 1
Query:  157 YNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLS-----EFSNLSSHPLTSIEMQGNQIKL 453
            +N I  I+ L+ L  L HL+   N ITK+  LD+L+ L +L+LS NRI KIE + KL +L  L    N I+ I GL      E+  L  + +  IE   N +KL
Sbjct:   63 WNLIKKIENLDCLTTLTHLEFYDNQITKVENLDSLVNLESLDLSFNRITKIENLEKLTKLKTLFFVHNKITKIEGLDTLTELEYLELGDNRIAKIENLDNNLKL 166          
BLAST of LRRCC1 vs. Ensembl Celegans
Match: sds-22 (Protein phosphatase 1 regulatory subunit SDS22 homolog [Source:UniProtKB/Swiss-Prot;Acc:P45969])

HSP 1 Score: 56.9954 bits (136), Expect = 2.493e-8
Identity = 49/136 (36.03%), Postives = 69/136 (50.74%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNL-----------------SSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLD 516
            N +  I  LESL+NL  LDLS N I +I+GLD L  L TL L +N+I+KIE +  L QL  L +  N I  I  +    NL                 +   L+ + + GN+I      I+N ++L NL++L L D
Sbjct:   91 NQLTEISHLESLVNLVSLDLSYNRIRQINGLDKLTKLETLYLVSNKIEKIENLEALTQLKLLELGDNRIKKIENIGHLVNLDELFIGKNKIRQLEGVETLQKLSVLSLPGNRIV----KIENVEQLNNLKELYLSD 222          

HSP 2 Score: 51.9878 bits (123), Expect = 1.193e-6
Identity = 40/107 (37.38%), Postives = 61/107 (57.01%), Query Frame = 1
Query:  184 LESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQL 504
            + SL+ L  LDL  N +T+IS L++L+ L +L+LS NRI++I G+ KL +L  L +  N I  I  L   + L       +E+  N+IK     I+N   L+NL +L
Sbjct:   77 ISSLVTLTSLDLYENQLTEISHLESLVNLVSLDLSYNRIRQINGLDKLTKLETLYLVSNKIEKIENLEALTQLK-----LLELGDNRIK----KIENIGHLVNLDEL 174          
BLAST of LRRCC1 vs. Ensembl Celegans
Match: K10D2.8 (pep chromosome:WBcel235:III:5188726:5190175:1 gene:WBGene00189952.1 transcript:K10D2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K10D2.8)

HSP 1 Score: 52.7582 bits (125), Expect = 6.231e-7
Identity = 55/162 (33.95%), Postives = 85/162 (52.47%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTS--IEMQGN--QIKLITHVI-----KNCQRLINLRQLTLLDNNSS-----NPVCSTP-DYRKKLLSSLMQLQILD 600
            N I  ++ L  L+NL  L L +N I KI GLD +  L+ L+L  N ++ IEG+  L  L  ++++ N I  I GLS  +NL S  L    IE   N  Q K I+ ++      NC +  ++RQL  L+N +      NP+ S+   YR ++   L  +++LD
Sbjct:  147 NRIQKMENLSHLVNLERLFLGANQIRKIEGLDGMAQLKELSLPGNALQIIEGLDTLSGLKSISLAQNGIRKIDGLSGLTNLKSLDLNDNIIEKLENVEQFKGISSLMIRKNKLNCWQ--DVRQLKKLENLTVLTMEMNPLYSSDYTYRNRVKEILPDVKLLD 306          

HSP 2 Score: 51.6026 bits (122), Expect = 1.590e-6
Identity = 36/100 (36.00%), Postives = 51/100 (51.00%), Query Frame = 1
Query:  157 YNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLI 456
            YN I  I+GL  LINL  L L  N I  I GL+    ++ L    NRI+K+E +S L  L +L +  N I  I GL   + L       + + GN +++I
Sbjct:  102 YNRITKIEGLSELINLEELHLVHNKIITIEGLETNTAMKYLEFGDNRIQKMENLSHLVNLERLFLGANQIRKIEGLDGMAQLK-----ELSLPGNALQII 196          

HSP 3 Score: 49.6766 bits (117), Expect = 6.998e-6
Identity = 33/76 (43.42%), Postives = 44/76 (57.89%), Query Frame = 1
Query:  175 IKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNL 402
            I   E+   +R L L  NL+ KI     L  L  LNL+ N+I+K+E +  L  LV L+VS+N I+ I GLSE  NL
Sbjct:   42 IWQFENTPGIRDLSLRWNLLKKIDHFQCLTSLTRLNLNDNQIEKLENLETLVNLVFLDVSYNRITKIEGLSELINL 117          
BLAST of LRRCC1 vs. Ensembl Fly
Match: dtr (gene:FBgn0023090 transcript:FBtr0081516)

HSP 1 Score: 72.0182 bits (175), Expect = 2.579e-12
Identity = 58/152 (38.16%), Postives = 87/152 (57.24%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIE--GISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCST-PDYRKKLLSSLMQLQILDTK 606
            N+I  I+GLE L  L+ L L +NLITKI  LD    L TLNLS+N I+KI+  G + L  L  L +S N + D   LS+   +    L+ +++  N+I  I  ++K  ++++NL+ L L      NPV S  P YRK L+ +  +L  LD++
Sbjct:   66 NAISEIQGLEKLSKLKCLFLQNNLITKIENLDPCRELDTLNLSSNHIRKIQNIGTNVLPVLNTLTISSNYLKDSESLSDL--IQCKTLSVLDLSNNRIDDIL-IVKIFEQMLNLKVLVL----QGNPVVSRLPQYRKTLILACKELTYLDSR 210          
BLAST of LRRCC1 vs. Ensembl Fly
Match: sds22 (gene:FBgn0028992 transcript:FBtr0083436)

HSP 1 Score: 61.6178 bits (148), Expect = 1.141e-9
Identity = 55/155 (35.48%), Postives = 79/155 (50.97%), Query Frame = 1
Query:  175 IKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQG----NQIKLITHVIKNCQRLINLRQLTLLDNNSS--------NPVCSTPDYRKKLLSSLMQLQILDT 603
            I+ +E L+NLR L L  N I KI  LD L+ L  L+L ANRI KIE + KL  L +L VS N +  I  LSE + L +  L    ++G     +++L+  +  N   + + + + LL  N +        NP+     YR KL   L QLQ +D 
Sbjct:  164 IENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDVRYRSKLRDILPQLQKIDA 318          

HSP 2 Score: 60.8474 bits (146), Expect = 1.990e-9
Identity = 48/118 (40.68%), Postives = 67/118 (56.78%), Query Frame = 1
Query:  157 YNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTL 510
            +N I  I+ L SL  L  L+L  N ITKI  LD+L  L  L++S NR+ KIE + KL +L K+    N I+ I  L   +N     LT +E+  N++K     I+N + L+NLRQL L
Sbjct:   70 WNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTN-----LTMLELGDNKLK----KIENIEMLVNLRQLFL 178          
BLAST of LRRCC1 vs. Ensembl Fly
Match: TbCMF46 (gene:FBgn0032163 transcript:FBtr0079898)

HSP 1 Score: 60.077 bits (144), Expect = 8.418e-9
Identity = 39/96 (40.62%), Postives = 58/96 (60.42%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQI 447
            N I +I+ LE L  L+ L+LS N IT+I  L+ L+ L  L+L +NRI+KIE I  L+ LV L++  N I  + G+     +SS  L  + ++GN I
Sbjct:   99 NKIEVIEHLEMLTALKDLNLSFNYITRIENLEKLVKLEKLSLFSNRIRKIENIHTLQNLVILSIGNNLIDTVEGIERLRFVSS--LKVLNLEGNPI 192          
BLAST of LRRCC1 vs. Ensembl Fly
Match: Ppr-Y (gene:FBgn0046697 transcript:FBtr0346721)

HSP 1 Score: 54.6842 bits (130), Expect = 3.287e-7
Identity = 37/96 (38.54%), Postives = 56/96 (58.33%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQI 447
            N I  I+ +E L NL+ L+LS N I KI  LD L+ L  L+L +N+I+ IE I  L  LV +++  N I  + G+  F  +++  L  I ++GN I
Sbjct:   91 NKIETIENIEMLTNLKDLNLSFNFIEKIENLDTLVNLEVLSLFSNKIEAIENIDMLTMLVIISLGNNLIDTVEGIERFRFMNN--LKIINLEGNPI 184          
BLAST of LRRCC1 vs. Ensembl Zebrafish
Match: lrrcc1 (leucine rich repeat and coiled-coil centrosomal protein 1 [Source:ZFIN;Acc:ZDB-GENE-041111-207])

HSP 1 Score: 239.195 bits (609), Expect = 2.707e-68
Identity = 165/466 (35.41%), Postives = 290/466 (62.23%), Query Frame = 1
Query: 1429 ASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQ-------EK----SDVLQRQLDSIEQKYKSQ-LELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAI 2790
            AS ++H   L+     L   L+ RE+ ++  L+ R      E K+ V ++++A       +    + K+ DA  QY  LE EFR+AL +EA+R+ ++++ + Q+  E   LKS L+Q  +K+++S SL+ ELT +VK+QK +L EL K K+E+    K R+ +LE+ LE+ ++  LQ EL +++  K+ ++L+AQES+++GLR ER++W +ELAQQG  L QDR +LE +IE   SE+   K + E+ ++SL+ K K +++QT  I ++KE L E+D + +  +D+ M++Q+ ++ ++E         +DSV +L+ RKEELK  + + + +LDE + +    ++KW+EK+E++ +LESQV +MK  ++ K   LIEER++A        EK     D  +RQL+S++  ++++ L LA   +  I ++A+ +V  +E+EMR+LL+ET   K+ +  ++R L + +
Sbjct:   92 ASSRQHKEKLQ----QLHELLASREEMHRKELSARLLPGGTEFKEAVAKEVAATEQRFAQKQTDLEEKIRDARRQYAALEEEFRMALTIEAKRFTEVKEGFDQVSGELQELKSILNQSQQKEKQSASLVQELTAMVKEQKTRLAELLKAKREAVSEFKTRVQSLESRLEDDKRLNLQVELLRKDKSKLISQLTAQESVIDGLRAERRIWGQELAQQGASLAQDRGRLEARIEVLLSELESQKKQSERDSDSLRIKAKIVDDQTETIRKLKEALLERDEQMRKVSDESMQEQRNLKQQLEEEKSSALELRDSVEQLSLRKEELKQQLFDKEAELDEVKETYRASSKKWQEKAEVLNRLESQVKRMKEAFDSKEKTLIEERDKASLAHRAAVEKLHCVDDAFRRQLESLQASHQAELLRLANDKQKQI-EKANQKVLQVEEEMRQLLEETESNKRVMEEKMRRLTQVL 552          
BLAST of LRRCC1 vs. Ensembl Zebrafish
Match: lrrcc1 (leucine rich repeat and coiled-coil centrosomal protein 1 [Source:ZFIN;Acc:ZDB-GENE-041111-207])

HSP 1 Score: 243.817 bits (621), Expect = 6.184e-67
Identity = 164/466 (35.19%), Postives = 292/466 (62.66%), Query Frame = 1
Query: 1429 ASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQ-------EK----SDVLQRQLDSIEQKYKSQ-LELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAI 2790
            AS ++H    ++++  L   L+ RE+ ++  L+ R      E K+ V ++++A       +    + K+ DA  QY  LE EFR+AL +EA+R+ ++++ + Q+  E   LKS L+Q  +K+++S SL+ ELT +VK+QK +L EL K K+E+    K R+ +LE+ LE+ ++  LQ EL +++  K+ ++L+AQES+++GLR ER++W +ELAQQG  L QDR +LE +IE   SE+   K + E+ ++SL+ K K +++QT  I ++KE L E+D + +  +D+ M++Q+ ++ ++E         +DSV +L+ RKEELK  + + + +LDE + +    ++KW+EK+E++ +LESQV +MK  ++ K   LIEER++A        EK     D  +RQL+S++  ++++ L LA   +  I ++A+ +V  +E+EMR+LL+ET   K+ +  ++R L + +
Sbjct:  534 ASSRQH----KEKLQQLHELLASREEMHRKELSARLLPGGTEFKEAVAKEVAATEQRFAQKQTDLEEKIRDARRQYAALEEEFRMALTIEAKRFTEVKEGFDQVSGELQELKSILNQSQQKEKQSASLVQELTAMVKEQKTRLAELLKAKREAVSEFKTRVQSLESRLEDDKRLNLQVELLRKDKSKLISQLTAQESVIDGLRAERRIWGQELAQQGASLAQDRGRLEARIEVLLSELESQKKQSERDSDSLRIKAKIVDDQTETIRKLKEALLERDEQMRKVSDESMQEQRNLKQQLEEEKSSALELRDSVEQLSLRKEELKQQLFDKEAELDEVKETYRASSKKWQEKAEVLNRLESQVKRMKEAFDSKEKTLIEERDKASLAHRAAVEKLHCVDDAFRRQLESLQASHQAELLRLANDKQKQI-EKANQKVLQVEEEMRQLLEETESNKRVMEEKMRRLTQVL 994          
BLAST of LRRCC1 vs. Ensembl Zebrafish
Match: lrrcc1 (leucine rich repeat and coiled-coil centrosomal protein 1 [Source:ZFIN;Acc:ZDB-GENE-041111-207])

HSP 1 Score: 243.817 bits (621), Expect = 6.184e-67
Identity = 164/466 (35.19%), Postives = 292/466 (62.66%), Query Frame = 1
Query: 1429 ASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQ-------EK----SDVLQRQLDSIEQKYKSQ-LELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAI 2790
            AS ++H    ++++  L   L+ RE+ ++  L+ R      E K+ V ++++A       +    + K+ DA  QY  LE EFR+AL +EA+R+ ++++ + Q+  E   LKS L+Q  +K+++S SL+ ELT +VK+QK +L EL K K+E+    K R+ +LE+ LE+ ++  LQ EL +++  K+ ++L+AQES+++GLR ER++W +ELAQQG  L QDR +LE +IE   SE+   K + E+ ++SL+ K K +++QT  I ++KE L E+D + +  +D+ M++Q+ ++ ++E         +DSV +L+ RKEELK  + + + +LDE + +    ++KW+EK+E++ +LESQV +MK  ++ K   LIEER++A        EK     D  +RQL+S++  ++++ L LA   +  I ++A+ +V  +E+EMR+LL+ET   K+ +  ++R L + +
Sbjct:  534 ASSRQH----KEKLQQLHELLASREEMHRKELSARLLPGGTEFKEAVAKEVAATEQRFAQKQTDLEEKIRDARRQYAALEEEFRMALTIEAKRFTEVKEGFDQVSGELQELKSILNQSQQKEKQSASLVQELTAMVKEQKTRLAELLKAKREAVSEFKTRVQSLESRLEDDKRLNLQVELLRKDKSKLISQLTAQESVIDGLRAERRIWGQELAQQGASLAQDRGRLEARIEVLLSELESQKKQSERDSDSLRIKAKIVDDQTETIRKLKEALLERDEQMRKVSDESMQEQRNLKQQLEEEKSSALELRDSVEQLSLRKEELKQQLFDKEAELDEVKETYRASSKKWQEKAEVLNRLESQVKRMKEAFDSKEKTLIEERDKASLAHRAAVEKLHCVDDAFRRQLESLQASHQAELLRLANDKQKQI-EKANQKVLQVEEEMRQLLEETESNKRVMEEKMRRLTQVL 994          
BLAST of LRRCC1 vs. Ensembl Zebrafish
Match: lrrcc1 (leucine rich repeat and coiled-coil centrosomal protein 1 [Source:ZFIN;Acc:ZDB-GENE-041111-207])

HSP 1 Score: 241.121 bits (614), Expect = 5.358e-66
Identity = 164/460 (35.65%), Postives = 290/460 (63.04%), Query Frame = 1
Query: 1429 ASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQ-------EK----SDVLQRQLDSIEQKYKSQ-LELAYKNRDFIRQEADDRVAAIEDEMRRLLQET--NEEKKRLNSR 2766
            AS ++H    ++++  L   L+ RE+ ++  L+ R      E K+ V ++++A       +    + K+ DA  QY  LE EFR+AL +EA+R+ ++++ + Q+  E   LKS L+Q  +K+++S SL+ ELT +VK+QK +L EL K K+E+    K R+ +LE+ LE+ ++  LQ EL +++  K+ ++L+AQES+++GLR ER++W +ELAQQG  L QDR +LE +IE   SE+   K + E+ ++SL+ K K +++QT  I ++KE L E+D + +  +D+ M++Q+ ++ ++E         +DSV +L+ RKEELK  + + + +LDE + +    ++KW+EK+E++ +LESQV +MK  ++ K   LIEER++A        EK     D  +RQL+S++  ++++ L LA   +  I ++A+ +V  +E+EMR+LL+ET  N+  + ++SR
Sbjct:  534 ASSRQH----KEKLQQLHELLASREEMHRKELSARLLPGGTEFKEAVAKEVAATEQRFAQKQTDLEEKIRDARRQYAALEEEFRMALTIEAKRFTEVKEGFDQVSGELQELKSILNQSQQKEKQSASLVQELTAMVKEQKTRLAELLKAKREAVSEFKTRVQSLESRLEDDKRLNLQVELLRKDKSKLISQLTAQESVIDGLRAERRIWGQELAQQGASLAQDRGRLEARIEVLLSELESQKKQSERDSDSLRIKAKIVDDQTETIRKLKEALLERDEQMRKVSDESMQEQRNLKQQLEEEKSSALELRDSVEQLSLRKEELKQQLFDKEAELDEVKETYRASSKKWQEKAEVLNRLESQVKRMKEAFDSKEKTLIEERDKASLAHRAAVEKLHCVDDAFRRQLESLQASHQAELLRLANDKQKQI-EKANQKVLQVEEEMRQLLEETESNKRPRAISSR 988          
BLAST of LRRCC1 vs. Ensembl Zebrafish
Match: lrguk (leucine-rich repeats and guanylate kinase domain containing [Source:ZFIN;Acc:ZDB-GENE-050419-232])

HSP 1 Score: 65.855 bits (159), Expect = 2.040e-10
Identity = 55/151 (36.42%), Postives = 79/151 (52.32%), Query Frame = 1
Query:  157 YNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGN---QIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILD 600
            +NS  +I+GLE    L HL L+ N I++I GLD+L  LR L L+ N I KIE +  L  L  L++S N I  ++GL     L      ++ ++ N   +IK   H+      LI LR++ LL     NPV    DYR  ++  L  L +LD
Sbjct:  125 HNSFSVIRGLEKCKRLSHLSLAHNNISRIRGLDHLP-LRELCLAGNMINKIENLQTLHNLQVLDLSCNRIQSLTGLQNLRFLG-----TVNLESNLITEIKEAAHL----HDLILLREINLL----KNPVQDHDDYRIAVIFLLQHLILLD 261          
BLAST of LRRCC1 vs. Ensembl Xenopus
Match: mfsd11 (major facilitator superfamily domain containing 11 [Source:Xenbase;Acc:XB-GENE-1003745])

HSP 1 Score: 352.829 bits (904), Expect = 6.438e-106
Identity = 298/953 (31.27%), Postives = 523/953 (54.88%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL---EINILSDIPGLENFLEYLSSSTDHYSETTLKESANS------IQHXXXXXXXXXXXXXEEHFKDDKESDSEL-------------KLRLRDLENKLASFVQKTE----EEKALNSKPIT-MKDEVSTETNKEN----------------ASKELKKAALNNKRDNSDGK----IANLIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKED----AIKSTDKLTAAFSKEKSFRQELENKVHILQTD----------FKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQ---VDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQEKS--------DVLQRQLDSIEQKYKSQL-ELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEV 2799
            N I  I+GL  L  L+HLDLSSNLITKI GLD+L  L++LNLS N++  +EG+ KL  L KLN+S+N I D++G        +H L+ + +  N I  I  V+++   L  L  LTL  N   NPVC+   YR+ +L +L QL  LD  DR+G P+   E++ + D+  L +FLEYL +      E  +KESA+       I      + K        +F  D  S SE              ++R++ LE++++  + K      E+  L +K  T    E  +E++K+N                ASK  K  A    +  S       +  L+++LDQER +R   E     V+ K  D+   L N  K ++D    A+ +TD++     KEKS + +L+  +H L+ +           K+KE + Q   K+++ +   ++ +              I Q + E+ + + A+++  +S   I    ++L  Q   V  L   L+ +E+ ++  L  R +L+  E +D + ++M+        E+++++ K+     QY DLE+EFR AL +EA R+K ++  +  +  E    K  +++ ++K+++S +LI ELT +VK+QK ++ E++K KQ+   + K +I +LE   EE R++ +Q EL KQE  K+ ++L+AQES+++GL+ ERK+W +EL QQG  L QDR +LE KIE  ++EI  LK + E+  ++L+ K K +++QT  I ++KEGL E+D   +   ++ ++ +K +  + +    ++   K+ + + T+RKEE+K ++ E + +L++ + +   +N+KW++K+EL+++LE+QV QMK  ++ K  +LIEER+++ + +        D  +RQL+S+   ++++L +LA   +  I + A++RV  +E+EMR+LL+ET   KK + ++++ L  A  ++
Sbjct:   43 NHISKIEGLGHLCYLQHLDLSSNLITKIEGLDSLTCLQSLNLSCNKLTWVEGLGKLFNLKKLNLSYNRIQDLTGFIPLHG-RNHKLSHLYLHSNCINNIEEVLQSMVGLNCLLHLTLEQNAKGNPVCNVLGYREIILENLPQLNSLDGIDRSGVPVTAHEVDSM-DLANL-DFLEYLINFDSGRKE--VKESASGPVKTARIDEVLTKYRKQRAASEAINFSTDITSSSEHDIARFHDNSNILREIRIKKLEDQISELLMKASCPISEQTTLKAKRDTDFTTESDSESSKDNRKGSTTRTPGCRKTSQASKHQKHQASQQSKGVSGLSTCIVLQALVQDLDQERERRWKAEQ----VVLKLTDSIKELQNQAKEEKDVNSMAVYTTDRIKELLFKEKSAKSKLQELIHHLKEENQKLADELKKLKDKEEDYQRAYKSMDDTLAKLETQR-------------IQQAALEMKQVQEAERKVSASQREIDLLRASLRQQKEKVHQLHELLTSKEQLHRKELEARVALNGPEFQDALAKEMAKEAHRHSQEIHSFQEKMNLLTRQYADLEDEFRAALIIEAGRFKDVKDGFDNVAAELAEHKEIVNRCLQKEKQSATLIQELTAMVKEQKARIAEITKAKQDIISDLKSKIHSLEKVAEEGRQKTVQIELLKQEKSKLISQLTAQESLIDGLKAERKIWGQELTQQGVSLAQDRGRLEAKIEVLSTEIESLKKQNERDTDTLRIKTKVVDDQTETIRKLKEGLQERDERIRKLREENIQLEKTLREQSDERTTQLEELKEKLERQTERKEEVKQLLEEKESELEDVKKAYSAMNKKWQDKAELLSQLETQVRQMKENFDAKERKLIEERDKSLQVTTEKLRSVDDAFRRQLESVLSAHQAELIKLASDKQKEI-EAANERVYQVEEEMRQLLKETANSKKIMEAKIKRLTGAFSDI 972          
BLAST of LRRCC1 vs. Ensembl Xenopus
Match: mfsd11 (major facilitator superfamily domain containing 11 [Source:Xenbase;Acc:XB-GENE-1003745])

HSP 1 Score: 248.44 bits (633), Expect = 2.930e-68
Identity = 189/620 (30.48%), Postives = 359/620 (57.90%), Query Frame = 1
Query: 1024 LIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKED----AIKSTDKLTAAFSKEKSFRQELENKVHILQTD----------FKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQ---VDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQEKSDVLQRQLDSIEQKYKSQLE--LAYKNRDFIR---------QEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEV 2799
            L+++LDQER +R   E     V+ K  D+   L N  K ++D    A+ +TD++     KEKS + +L+  +H L+ +           K+KE + Q   K+++ +   ++ +              I Q + E+ + + A+++  +S   I    ++L  Q   V  L   L+ +E+ ++  L  R +L+  E +D + ++M+        E+++++ K+     QY DLE+EFR AL +EA R+K ++  +  +  E    K  +++ ++K+++S +LI ELT +VK+QK ++ E++K KQ+   + K +I +LE   EE R++ +Q EL KQE  K+ ++L+AQES+++GL+ ERK+W +EL QQG  L QDR +LE KIE  ++EI  LK + E+  ++L+ K K +++QT  I ++KEGL E+D   +   ++ ++ +K +  + +    ++   K+ + + T+RKEE+K ++ E + +L++ + +   +N+KW++K+EL+++LE+QV QMK  ++ K  +LIEER+++ +   V   +L S++  ++ QLE  L+    + I+         + A++RV  +E+EMR+LL+ET   KK + ++++ L  A  ++
Sbjct:  431 LVQDLDQERERRWKAEQ----VVLKLTDSIKELQNQAKEEKDVNSMAVYTTDRIKELLFKEKSAKSKLQELIHHLKEENQKLADELKKLKDKEEDYQRAYKSMDDTLAKLETQR-------------IQQAALEMKQVQEAERKVSASQREIDLLRASLRQQKEKVHQLHELLTSKEQLHRKELEARVALNGPEFQDALAKEMAKEAHRHSQEIHSFQEKMNLLTRQYADLEDEFRAALIIEAGRFKDVKDGFDNVAAELAEHKEIVNRCLQKEKQSATLIQELTAMVKEQKARIAEITKAKQDIISDLKSKIHSLEKVAEEGRQKTVQIELLKQEKSKLISQLTAQESLIDGLKAERKIWGQELTQQGVSLAQDRGRLEAKIEVLSTEIESLKKQNERDTDTLRIKTKVVDDQTETIRKLKEGLQERDERIRKLREENIQLEKTLREQSDERTTQLEELKEKLERQTERKEEVKQLLEEKESELEDVKKAYSAMNKKWQDKAELLSQLETQVRQMKENFDAKERKLIEERDKSLQSQKVTTEKLRSVDDAFRRQLESVLSAHQAELIKLASDKQKEIEAANERVYQVEEEMRQLLKETANSKKIMEAKIKRLTGAFSDI 1033          

HSP 2 Score: 130.954 bits (328), Expect = 2.419e-30
Identity = 78/177 (44.07%), Postives = 109/177 (61.58%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL---EINILSDIPGLENFLEYL 681
            N I  I+GL  L  L+HLDLSSNLITKI GLD+L  L++LNLS N++  +EG+ KL  L KLN+S+N I D++G        +H L+ + +  N I  I  V+++   L  L  LTL  N   NPVC+   YR+ +L +L QL  LD  DR+G P+   E++ + D+  L +FLEYL
Sbjct:   43 NHISKIEGLGHLCYLQHLDLSSNLITKIEGLDSLTCLQSLNLSCNKLTWVEGLGKLFNLKKLNLSYNRIQDLTGFIPLHG-RNHKLSHLYLHSNCINNIEEVLQSMVGLNCLLHLTLEQNAKGNPVCNVLGYREIILENLPQLNSLDGIDRSGVPVTAHEVDSM-DLANL-DFLEYL 216          
BLAST of LRRCC1 vs. Ensembl Xenopus
Match: mfsd11 (major facilitator superfamily domain containing 11 [Source:Xenbase;Acc:XB-GENE-1003745])

HSP 1 Score: 248.44 bits (633), Expect = 3.149e-68
Identity = 189/620 (30.48%), Postives = 359/620 (57.90%), Query Frame = 1
Query: 1024 LIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKED----AIKSTDKLTAAFSKEKSFRQELENKVHILQTD----------FKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQ---VDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQEKSDVLQRQLDSIEQKYKSQLE--LAYKNRDFIR---------QEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEV 2799
            L+++LDQER +R   E     V+ K  D+   L N  K ++D    A+ +TD++     KEKS + +L+  +H L+ +           K+KE + Q   K+++ +   ++ +              I Q + E+ + + A+++  +S   I    ++L  Q   V  L   L+ +E+ ++  L  R +L+  E +D + ++M+        E+++++ K+     QY DLE+EFR AL +EA R+K ++  +  +  E    K  +++ ++K+++S +LI ELT +VK+QK ++ E++K KQ+   + K +I +LE   EE R++ +Q EL KQE  K+ ++L+AQES+++GL+ ERK+W +EL QQG  L QDR +LE KIE  ++EI  LK + E+  ++L+ K K +++QT  I ++KEGL E+D   +   ++ ++ +K +  + +    ++   K+ + + T+RKEE+K ++ E + +L++ + +   +N+KW++K+EL+++LE+QV QMK  ++ K  +LIEER+++ +   V   +L S++  ++ QLE  L+    + I+         + A++RV  +E+EMR+LL+ET   KK + ++++ L  A  ++
Sbjct:  426 LVQDLDQERERRWKAEQ----VVLKLTDSIKELQNQAKEEKDVNSMAVYTTDRIKELLFKEKSAKSKLQELIHHLKEENQKLADELKKLKDKEEDYQRAYKSMDDTLAKLETQR-------------IQQAALEMKQVQEAERKVSASQREIDLLRASLRQQKEKVHQLHELLTSKEQLHRKELEARVALNGPEFQDALAKEMAKEAHRHSQEIHSFQEKMNLLTRQYADLEDEFRAALIIEAGRFKDVKDGFDNVAAELAEHKEIVNRCLQKEKQSATLIQELTAMVKEQKARIAEITKAKQDIISDLKSKIHSLEKVAEEGRQKTVQIELLKQEKSKLISQLTAQESLIDGLKAERKIWGQELTQQGVSLAQDRGRLEAKIEVLSTEIESLKKQNERDTDTLRIKTKVVDDQTETIRKLKEGLQERDERIRKLREENIQLEKTLREQSDERTTQLEELKEKLERQTERKEEVKQLLEEKESELEDVKKAYSAMNKKWQDKAELLSQLETQVRQMKENFDAKERKLIEERDKSLQSQKVTTEKLRSVDDAFRRQLESVLSAHQAELIKLASDKQKEIEAANERVYQVEEEMRQLLKETANSKKIMEAKIKRLTGAFSDI 1028          

HSP 2 Score: 131.724 bits (330), Expect = 1.689e-30
Identity = 78/177 (44.07%), Postives = 109/177 (61.58%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL---EINILSDIPGLENFLEYL 681
            N I  I+GL  L  L+HLDLSSNLITKI GLD+L  L++LNLS N++  +EG+ KL  L KLN+S+N I D++G        +H L+ + +  N I  I  V+++   L  L  LTL  N   NPVC+   YR+ +L +L QL  LD  DR+G P+   E++ + D+  L +FLEYL
Sbjct:   38 NHISKIEGLGHLCYLQHLDLSSNLITKIEGLDSLTCLQSLNLSCNKLTWVEGLGKLFNLKKLNLSYNRIQDLTGFIPLHG-RNHKLSHLYLHSNCINNIEEVLQSMVGLNCLLHLTLEQNAKGNPVCNVLGYREIILENLPQLNSLDGIDRSGVPVTAHEVDSM-DLANL-DFLEYL 211          
BLAST of LRRCC1 vs. Ensembl Xenopus
Match: mfsd11 (major facilitator superfamily domain containing 11 [Source:Xenbase;Acc:XB-GENE-1003745])

HSP 1 Score: 248.44 bits (633), Expect = 3.149e-68
Identity = 189/620 (30.48%), Postives = 359/620 (57.90%), Query Frame = 1
Query: 1024 LIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKED----AIKSTDKLTAAFSKEKSFRQELENKVHILQTD----------FKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQ---VDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQEKSDVLQRQLDSIEQKYKSQLE--LAYKNRDFIR---------QEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEV 2799
            L+++LDQER +R   E     V+ K  D+   L N  K ++D    A+ +TD++     KEKS + +L+  +H L+ +           K+KE + Q   K+++ +   ++ +              I Q + E+ + + A+++  +S   I    ++L  Q   V  L   L+ +E+ ++  L  R +L+  E +D + ++M+        E+++++ K+     QY DLE+EFR AL +EA R+K ++  +  +  E    K  +++ ++K+++S +LI ELT +VK+QK ++ E++K KQ+   + K +I +LE   EE R++ +Q EL KQE  K+ ++L+AQES+++GL+ ERK+W +EL QQG  L QDR +LE KIE  ++EI  LK + E+  ++L+ K K +++QT  I ++KEGL E+D   +   ++ ++ +K +  + +    ++   K+ + + T+RKEE+K ++ E + +L++ + +   +N+KW++K+EL+++LE+QV QMK  ++ K  +LIEER+++ +   V   +L S++  ++ QLE  L+    + I+         + A++RV  +E+EMR+LL+ET   KK + ++++ L  A  ++
Sbjct:  426 LVQDLDQERERRWKAEQ----VVLKLTDSIKELQNQAKEEKDVNSMAVYTTDRIKELLFKEKSAKSKLQELIHHLKEENQKLADELKKLKDKEEDYQRAYKSMDDTLAKLETQR-------------IQQAALEMKQVQEAERKVSASQREIDLLRASLRQQKEKVHQLHELLTSKEQLHRKELEARVALNGPEFQDALAKEMAKEAHRHSQEIHSFQEKMNLLTRQYADLEDEFRAALIIEAGRFKDVKDGFDNVAAELAEHKEIVNRCLQKEKQSATLIQELTAMVKEQKARIAEITKAKQDIISDLKSKIHSLEKVAEEGRQKTVQIELLKQEKSKLISQLTAQESLIDGLKAERKIWGQELTQQGVSLAQDRGRLEAKIEVLSTEIESLKKQNERDTDTLRIKTKVVDDQTETIRKLKEGLQERDERIRKLREENIQLEKTLREQSDERTTQLEELKEKLERQTERKEEVKQLLEEKESELEDVKKAYSAMNKKWQDKAELLSQLETQVRQMKENFDAKERKLIEERDKSLQSQKVTTEKLRSVDDAFRRQLESVLSAHQAELIKLASDKQKEIEAANERVYQVEEEMRQLLKETANSKKIMEAKIKRLTGAFSDI 1028          

HSP 2 Score: 131.724 bits (330), Expect = 1.689e-30
Identity = 78/177 (44.07%), Postives = 109/177 (61.58%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL---EINILSDIPGLENFLEYL 681
            N I  I+GL  L  L+HLDLSSNLITKI GLD+L  L++LNLS N++  +EG+ KL  L KLN+S+N I D++G        +H L+ + +  N I  I  V+++   L  L  LTL  N   NPVC+   YR+ +L +L QL  LD  DR+G P+   E++ + D+  L +FLEYL
Sbjct:   38 NHISKIEGLGHLCYLQHLDLSSNLITKIEGLDSLTCLQSLNLSCNKLTWVEGLGKLFNLKKLNLSYNRIQDLTGFIPLHG-RNHKLSHLYLHSNCINNIEEVLQSMVGLNCLLHLTLEQNAKGNPVCNVLGYREIILENLPQLNSLDGIDRSGVPVTAHEVDSM-DLANL-DFLEYL 211          
BLAST of LRRCC1 vs. Ensembl Xenopus
Match: mfsd11 (major facilitator superfamily domain containing 11 [Source:Xenbase;Acc:XB-GENE-1003745])

HSP 1 Score: 241.506 bits (615), Expect = 1.092e-66
Identity = 185/615 (30.08%), Postives = 359/615 (58.37%), Query Frame = 1
Query: 1024 LIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKED----AIKSTDKLTAAFSKEKSFRQELENKVHILQTD----------FKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQEKS--------DVLQRQLDSIEQKYKSQL-ELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEV 2799
            L+++LDQER +R   E     V+ K  D+   L N  K ++D    A+ +TD++     KEKS + +L+  +H L+ +           K+KE + Q   K+++ +   ++ +              I Q  +++ E +     ++  +  ++      +++V  L   L+ +E+ ++  L  R +L+  E +D + ++M+        E+++++ K+     QY DLE+EFR AL +EA R+K ++  +  +  E    K  +++ ++K+++S +LI ELT +VK+QK ++ E++K KQ+   + K +I +LE   EE R++ +Q EL KQE  K+ ++L+AQES+++GL+ ERK+W +EL QQG  L QDR +LE KIE  ++EI  LK + E+  ++L+ K K +++QT  I ++KEGL E+D   +   ++ ++ +K +  + +    ++   K+ + + T+RKEE+K ++ E + +L++ + +   +N+KW++K+EL+++LE+QV QMK  ++ K  +LIEER+++ + +        D  +RQL+S+   ++++L +LA   +  I + A++RV  +E+EMR+LL+ET   KK + ++++ L  A  ++
Sbjct:  248 LVQDLDQERERRWKAEQ----VVLKLTDSIKELQNQAKEEKDVNSMAVYTTDRIKELLFKEKSAKSKLQELIHHLKEENQKLADELKKLKDKEEDYQRAYKSMDDTLAKLETQR-------------IQQAMKQVQEAERKVSASQREIDLLRASLRQQKEKVHQLHELLTSKEQLHRKELEARVALNGPEFQDALAKEMAKEAHRHSQEIHSFQEKMNLLTRQYADLEDEFRAALIIEAGRFKDVKDGFDNVAAELAEHKEIVNRCLQKEKQSATLIQELTAMVKEQKARIAEITKAKQDIISDLKSKIHSLEKVAEEGRQKTVQIELLKQEKSKLISQLTAQESLIDGLKAERKIWGQELTQQGVSLAQDRGRLEAKIEVLSTEIESLKKQNERDTDTLRIKTKVVDDQTETIRKLKEGLQERDERIRKLREENIQLEKTLREQSDERTTQLEELKEKLERQTERKEEVKQLLEEKESELEDVKKAYSAMNKKWQDKAELLSQLETQVRQMKENFDAKERKLIEERDKSLQVTTEKLRSVDDAFRRQLESVLSAHQAELIKLASDKQKEI-EAANERVYQVEEEMRQLLKETANSKKIMEAKIKRLTGAFSDI 844          

HSP 2 Score: 131.724 bits (330), Expect = 1.027e-30
Identity = 78/177 (44.07%), Postives = 109/177 (61.58%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL---EINILSDIPGLENFLEYL 681
            N I  I+GL  L  L+HLDLSSNLITKI GLD+L  L++LNLS N++  +EG+ KL  L KLN+S+N I D++G        +H L+ + +  N I  I  V+++   L  L  LTL  N   NPVC+   YR+ +L +L QL  LD  DR+G P+   E++ + D+  L +FLEYL
Sbjct:   41 NHISKIEGLGHLCYLQHLDLSSNLITKIEGLDSLTCLQSLNLSCNKLTWVEGLGKLFNLKKLNLSYNRIQDLTGFIPLHG-RNHKLSHLYLHSNCINNIEEVLQSMVGLNCLLHLTLEQNAKGNPVCNVLGYREIILENLPQLNSLDGIDRSGVPVTAHEVDSM-DLANL-DFLEYL 214          
BLAST of LRRCC1 vs. Ensembl Mouse
Match: Lrrcc1 (leucine rich repeat and coiled-coil domain containing 1 [Source:MGI Symbol;Acc:MGI:1918960])

HSP 1 Score: 224.942 bits (572), Expect = 1.924e-60
Identity = 189/616 (30.68%), Postives = 336/616 (54.55%), Query Frame = 1
Query:  988 NKRDNSDGKIANLIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEA-----------QEKSDVLQRQLDSIEQKYKSQ-LELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEV 2799
            N  DNS  +  +L+++LDQER  R   E   + +++   +        +     A+ +TD+L  A  KE+  + +LE  VH LQ + K+  IEL + R   E     ++      EK+   K+++     R + E +L    A+  +  ++      + QV  L   L+ +E+E++  +  R      E +D + +++     +   E+  ++ K+   N QY DLENEFR+AL +EA R+K ++  +  + TE    K  L    +K+ ES SLI +LT +VK+QK KL E+ K KQE+  N + +I TLE  +E+ +++ +Q EL K E  ++ ++L+A+ES++ GLRTERK+W +ELA Q   L+Q R KLE +IE+   E   L+   E   ++L+ KCK +E+Q   I ++K+ L EKD + K   +++   +K  + ++     ++ +  + + +  +RKE+LK  +   + +L+E   +   +N+KW +K EL++ LE QV ++K  +E K  +L  ER+++           Q   D  +RQ+D I + ++++ ++LA + + +I   A+ +V  +EDEMR LL ET + KK +  +++ L  AI E+
Sbjct:  394 NFSDNSTYR--SLVEQLDQEREMRWKAEQTEKKLMDYIDELHKQADEKKDVHSQALITTDRLKDAIFKERHCKAQLEIIVHRLQNEVKKLTIELMKARDQQEDHIRHLRTLERALEKMEKQKAQQQAAQIRLIQEVELKASAADREINLLRTSLHQEKQQVQQLHELLALKEQEHRQEIETRQFFTDAEFQDALTKRLCKEERKHEQEVKEYQEKIDILNQQYLDLENEFRIALTVEARRFKDVQDGFEDVATELAKSKHALIWAQRKENESSSLIKDLTCMVKEQKTKLSEVCKLKQEAAANLQNQINTLEILIEDDKQKSIQIELLKHEKTQLISELAAKESLIYGLRTERKVWGQELACQSSTLSQSRGKLEAQIESLCRENESLRKSHESDCDALRIKCKIIEDQNETIRKLKDSLQEKDGQIKLLQEQIALIEKCSQEQLNEKSSQLDSIVEKLERHNERKEKLKQQLKAKELELEEIRKAYSTLNKKWHDKGELLSHLEMQVKEVKEKFEDKERKLKAERDKSLELQKDAMEKLQNMDDAFRRQVDEIVEAHQAEIMQLANEKQKYI-DCANLKVQQVEDEMRGLLDETCKNKKMMEEKIKQLACAISEI 1006          

HSP 2 Score: 128.642 bits (322), Expect = 9.209e-30
Identity = 87/217 (40.09%), Postives = 125/217 (57.60%), Query Frame = 1
Query:   49 GESESENILEENYIDFGVKDILSXXXXXXXXXXXXXYNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL---EINILSDIPGLENFLEYLSSS 690
            G+S   ++    ++D G+  I  L L ++   +NLH N+I  I  ++ + NLRHLDLSSN I++I GL+ L  L TLNLS N I ++EG+  L  L KLN+S+N I+D+SGL     L  + L  I++  N I  I H+++    L  L  L L  +   NP+C  P YR  +L +L QL+ILD K+  G P+   EIN  S +  LE  L+ L SS
Sbjct:   14 GDSSCGDVC---FMDKGLHSISELSLDSSIHAINLHCNNISKISSIDHIWNLRHLDLSSNQISQIEGLNTLTKLCTLNLSCNLITRVEGLEALVNLTKLNLSYNHINDLSGLMPLHGL-KYKLRYIDLHSNYIDSIHHLLQCTVGLHFLTNLILEKDGEGNPICLIPGYRAIILQTLPQLRILDCKNIFGEPVSLEEINS-SHLQCLEGLLDNLVSS 225          
BLAST of LRRCC1 vs. Ensembl Mouse
Match: Lrrcc1 (leucine rich repeat and coiled-coil domain containing 1 [Source:MGI Symbol;Acc:MGI:1918960])

HSP 1 Score: 224.557 bits (571), Expect = 2.828e-60
Identity = 189/616 (30.68%), Postives = 336/616 (54.55%), Query Frame = 1
Query:  988 NKRDNSDGKIANLIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEA-----------QEKSDVLQRQLDSIEQKYKSQ-LELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEV 2799
            N  DNS  +  +L+++LDQER  R   E   + +++   +        +     A+ +TD+L  A  KE+  + +LE  VH LQ + K+  IEL + R   E     ++      EK+   K+++     R + E +L    A+  +  ++      + QV  L   L+ +E+E++  +  R      E +D + +++     +   E+  ++ K+   N QY DLENEFR+AL +EA R+K ++  +  + TE    K  L    +K+ ES SLI +LT +VK+QK KL E+ K KQE+  N + +I TLE  +E+ +++ +Q EL K E  ++ ++L+A+ES++ GLRTERK+W +ELA Q   L+Q R KLE +IE+   E   L+   E   ++L+ KCK +E+Q   I ++K+ L EKD + K   +++   +K  + ++     ++ +  + + +  +RKE+LK  +   + +L+E   +   +N+KW +K EL++ LE QV ++K  +E K  +L  ER+++           Q   D  +RQ+D I + ++++ ++LA + + +I   A+ +V  +EDEMR LL ET + KK +  +++ L  AI E+
Sbjct:  410 NFSDNSTYR--SLVEQLDQEREMRWKAEQTEKKLMDYIDELHKQADEKKDVHSQALITTDRLKDAIFKERHCKAQLEIIVHRLQNEVKKLTIELMKARDQQEDHIRHLRTLERALEKMEKQKAQQQAAQIRLIQEVELKASAADREINLLRTSLHQEKQQVQQLHELLALKEQEHRQEIETRQFFTDAEFQDALTKRLCKEERKHEQEVKEYQEKIDILNQQYLDLENEFRIALTVEARRFKDVQDGFEDVATELAKSKHALIWAQRKENESSSLIKDLTCMVKEQKTKLSEVCKLKQEAAANLQNQINTLEILIEDDKQKSIQIELLKHEKTQLISELAAKESLIYGLRTERKVWGQELACQSSTLSQSRGKLEAQIESLCRENESLRKSHESDCDALRIKCKIIEDQNETIRKLKDSLQEKDGQIKLLQEQIALIEKCSQEQLNEKSSQLDSIVEKLERHNERKEKLKQQLKAKELELEEIRKAYSTLNKKWHDKGELLSHLEMQVKEVKEKFEDKERKLKAERDKSLELQKDAMEKLQNMDDAFRRQVDEIVEAHQAEIMQLANEKQKYI-DCANLKVQQVEDEMRGLLDETCKNKKMMEEKIKQLACAISEI 1022          

HSP 2 Score: 128.257 bits (321), Expect = 1.204e-29
Identity = 87/217 (40.09%), Postives = 125/217 (57.60%), Query Frame = 1
Query:   49 GESESENILEENYIDFGVKDILSXXXXXXXXXXXXXYNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL---EINILSDIPGLENFLEYLSSS 690
            G+S   ++    ++D G+  I  L L ++   +NLH N+I  I  ++ + NLRHLDLSSN I++I GL+ L  L TLNLS N I ++EG+  L  L KLN+S+N I+D+SGL     L  + L  I++  N I  I H+++    L  L  L L  +   NP+C  P YR  +L +L QL+ILD K+  G P+   EIN  S +  LE  L+ L SS
Sbjct:   14 GDSSCGDVC---FMDKGLHSISELSLDSSIHAINLHCNNISKISSIDHIWNLRHLDLSSNQISQIEGLNTLTKLCTLNLSCNLITRVEGLEALVNLTKLNLSYNHINDLSGLMPLHGL-KYKLRYIDLHSNYIDSIHHLLQCTVGLHFLTNLILEKDGEGNPICLIPGYRAIILQTLPQLRILDCKNIFGEPVSLEEINS-SHLQCLEGLLDNLVSS 225          
BLAST of LRRCC1 vs. Ensembl Mouse
Match: Lrrcc1 (leucine rich repeat and coiled-coil domain containing 1 [Source:MGI Symbol;Acc:MGI:1918960])

HSP 1 Score: 204.527 bits (519), Expect = 9.356e-54
Identity = 172/573 (30.02%), Postives = 310/573 (54.10%), Query Frame = 1
Query:  988 NKRDNSDGKIANLIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEA-----------QEKSDVLQRQLDSIEQKYKSQ-LELAYKNRDFI 2670
            N  DNS  +  +L+++LDQER  R   E   + +++   +        +     A+ +TD+L  A  KE+  + +LE  VH LQ + K+  IEL + R   E     ++      EK+   K+++     R + E +L    A+  +  ++      + QV  L   L+ +E+E++  +  R      E +D + +++     +   E+  ++ K+   N QY DLENEFR+AL +EA R+K ++  +  + TE    K  L    +K+ ES SLI +LT +VK+QK KL E+ K KQE+  N + +I TLE  +E+ +++ +Q EL K E  ++ ++L+A+ES++ GLRTERK+W +ELA Q   L+Q R KLE +IE+   E   L+   E   ++L+ KCK +E+Q   I ++K+ L EKD + K   +++   +K  + ++     ++ +  + + +  +RKE+LK  +   + +L+E   +   +N+KW +K EL++ LE QV ++K  +E K  +L  ER+++           Q   D  +RQ+D I + ++++ ++LA + + +I
Sbjct:  410 NFSDNSTYR--SLVEQLDQEREMRWKAEQTEKKLMDYIDELHKQADEKKDVHSQALITTDRLKDAIFKERHCKAQLEIIVHRLQNEVKKLTIELMKARDQQEDHIRHLRTLERALEKMEKQKAQQQAAQIRLIQEVELKASAADREINLLRTSLHQEKQQVQQLHELLALKEQEHRQEIETRQFFTDAEFQDALTKRLCKEERKHEQEVKEYQEKIDILNQQYLDLENEFRIALTVEARRFKDVQDGFEDVATELAKSKHALIWAQRKENESSSLIKDLTCMVKEQKTKLSEVCKLKQEAAANLQNQINTLEILIEDDKQKSIQIELLKHEKTQLISELAAKESLIYGLRTERKVWGQELACQSSTLSQSRGKLEAQIESLCRENESLRKSHESDCDALRIKCKIIEDQNETIRKLKDSLQEKDGQIKLLQEQIALIEKCSQEQLNEKSSQLDSIVEKLERHNERKEKLKQQLKAKELELEEIRKAYSTLNKKWHDKGELLSHLEMQVKEVKEKFEDKERKLKAERDKSLELQKDAMEKLQNMDDAFRRQVDEIVEAHQAEIMQLANEKQKYI 980          

HSP 2 Score: 127.872 bits (320), Expect = 1.798e-29
Identity = 87/217 (40.09%), Postives = 125/217 (57.60%), Query Frame = 1
Query:   49 GESESENILEENYIDFGVKDILSXXXXXXXXXXXXXYNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL---EINILSDIPGLENFLEYLSSS 690
            G+S   ++    ++D G+  I  L L ++   +NLH N+I  I  ++ + NLRHLDLSSN I++I GL+ L  L TLNLS N I ++EG+  L  L KLN+S+N I+D+SGL     L  + L  I++  N I  I H+++    L  L  L L  +   NP+C  P YR  +L +L QL+ILD K+  G P+   EIN  S +  LE  L+ L SS
Sbjct:   14 GDSSCGDVC---FMDKGLHSISELSLDSSIHAINLHCNNISKISSIDHIWNLRHLDLSSNQISQIEGLNTLTKLCTLNLSCNLITRVEGLEALVNLTKLNLSYNHINDLSGLMPLHGL-KYKLRYIDLHSNYIDSIHHLLQCTVGLHFLTNLILEKDGEGNPICLIPGYRAIILQTLPQLRILDCKNIFGEPVSLEEINS-SHLQCLEGLLDNLVSS 225          
BLAST of LRRCC1 vs. Ensembl Mouse
Match: Lrrcc1 (leucine rich repeat and coiled-coil domain containing 1 [Source:MGI Symbol;Acc:MGI:1918960])

HSP 1 Score: 192.971 bits (489), Expect = 8.318e-52
Identity = 160/519 (30.83%), Postives = 287/519 (55.30%), Query Frame = 1
Query: 1150 AIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEA-----------QEKSDVLQRQLDSIEQKYKSQ-LELAYKNRDFI 2670
            A+ +TD+L  A  KE+  + +LE  VH LQ + K+  IEL + R   E     ++      EK+   K+++     R + E +L    A+  +  ++      + QV  L   L+ +E+E++  +  R      E +D + +++     +   E+  ++ K+   N QY DLENEFR+AL +EA R+K ++  +  + TE    K  L    +K+ ES SLI +LT +VK+QK KL E+ K KQE+  N + +I TLE  +E+ +++ +Q EL K E  ++ ++L+A+ES++ GLRTERK+W +ELA Q   L+Q R KLE +IE+   E   L+   E   ++L+ KCK +E+Q   I ++K+ L EKD + K   +++   +K  + ++     ++ +  + + +  +RKE+LK  +   + +L+E   +   +N+KW +K EL++ LE QV ++K  +E K  +L  ER+++           Q   D  +RQ+D I + ++++ ++LA + + +I
Sbjct:   41 ALITTDRLKDAIFKERHCKAQLEIIVHRLQNEVKKLTIELMKARDQQEDHIRHLRTLERALEKMEKQKAQQQAAQIRLIQEVELKASAADREINLLRTSLHQEKQQVQQLHELLALKEQEHRQEIETRQFFTDAEFQDALTKRLCKEERKHEQEVKEYQEKIDILNQQYLDLENEFRIALTVEARRFKDVQDGFEDVATELAKSKHALIWAQRKENESSSLIKDLTCMVKEQKTKLSEVCKLKQEAAANLQNQINTLEILIEDDKQKSIQIELLKHEKTQLISELAAKESLIYGLRTERKVWGQELACQSSTLSQSRGKLEAQIESLCRENESLRKSHESDCDALRIKCKIIEDQNETIRKLKDSLQEKDGQIKLLQEQIALIEKCSQEQLNEKSSQLDSIVEKLERHNERKEKLKQQLKAKELELEEIRKAYSTLNKKWHDKGELLSHLEMQVKEVKEKFEDKERKLKAERDKSLELQKDAMEKLQNMDDAFRRQVDEIVEAHQAEIMQLANEKQKYI 559          
BLAST of LRRCC1 vs. Ensembl Mouse
Match: Lrrcc1 (leucine rich repeat and coiled-coil domain containing 1 [Source:MGI Symbol;Acc:MGI:1918960])

HSP 1 Score: 176.407 bits (446), Expect = 2.132e-45
Identity = 138/424 (32.55%), Postives = 231/424 (54.48%), Query Frame = 1
Query:  988 NKRDNSDGKIANLIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKD 2259
            N  DNS  +  +L+++LDQER  R   E   + +++   +        +     A+ +TD+L  A  KE+  + +LE  VH LQ + K+  IEL + R   E     ++      EK+   K+++     R + E +L    A+  +  ++      + QV  L   L+ +E+E++  +  R      E +D + +++     +   E+  ++ K+   N QY DLENEFR+AL +EA R+K ++  +  + TE    K  L    +K+ ES SLI +LT +VK+QK KL E+ K KQE+  N + +I TLE  +E+ +++ +Q EL K E  ++ ++L+A+ES++ GLRTERK+W +ELA Q   L+Q R KLE +IE+   E   L+   E   ++L+ KCK +E+Q   I ++K+ L EKD
Sbjct:  288 NFSDNSTYR--SLVEQLDQEREMRWKAEQTEKKLMDYIDELHKQADEKKDVHSQALITTDRLKDAIFKERHCKAQLEIIVHRLQNEVKKLTIELMKARDQQEDHIRHLRTLERALEKMEKQKAQQQAAQIRLIQEVELKASAADREINLLRTSLHQEKQQVQQLHELLALKEQEHRQEIETRQFFTDAEFQDALTKRLCKEERKHEQEVKEYQEKIDILNQQYLDLENEFRIALTVEARRFKDVQDGFEDVATELAKSKHALIWAQRKENESSSLIKDLTCMVKEQKTKLSEVCKLKQEAAANLQNQINTLEILIEDDKQKSIQIELLKHEKTQLISELAAKESLIYGLRTERKVWGQELACQSSTLSQSRGKLEAQIESLCRENESLRKSHESDCDALRIKCKIIEDQNETIRKLKDSLQEKD 709          

HSP 2 Score: 55.4546 bits (132), Expect = 3.396e-7
Identity = 36/95 (37.89%), Postives = 50/95 (52.63%), Query Frame = 1
Query:  415 LTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL---EINILSDIPGLENFLEYLSSS 690
            L  I++  N I  I H+++    L  L  L L  +   NP+C  P YR  +L +L QL+ILD K+  G P+   EIN  S +  LE  L+ L SS
Sbjct:   10 LRYIDLHSNYIDSIHHLLQCTVGLHFLTNLILEKDGEGNPICLIPGYRAIILQTLPQLRILDCKNIFGEPVSLEEINS-SHLQCLEGLLDNLVSS 103          
BLAST of LRRCC1 vs. UniProt/SwissProt
Match: sp|Q6NRC9|LRCC1_XENLA (Leucine-rich repeat and coiled-coil domain-containing protein 1 OS=Xenopus laevis OX=8355 GN=lrrcc1 PE=2 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 2.769e-64
Identity = 187/620 (30.16%), Postives = 359/620 (57.90%), Query Frame = 1
Query: 1024 LIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKVHILQTD----------FKEKEIELQEFRKN-------IETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQEKSDVLQRQLDSIEQKYKSQLE--LAYKNRDFIR---------QEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEV 2799
            L++ELDQER +R   E  +  +    K+ Q     ++     A+ +TD++     KEK+ + +L+  +H L+ +           K KE + Q+  K+       +ET N+    K  L+ K +     ++    RE+D  ++A ++ +              ++V+ L   L+ +E+ ++  L +R +L+  E +  + ++M+        ++++++ K+     QY DLE+EFR AL +EAER+K+++  +  + +E    K  + +  +K+++S +L+ ELTT+VK+QK ++ E++K KQE   + K +I +LE   EE R++ +Q EL K+E  K+ ++L+AQES+++GL+ ERK+W +EL QQG  L QDR +LE KIE  ++EI  LK + E+ A++L+ K K +++QT  I ++KEGL E+D   +   ++ +E +K ++ + +    ++   K  + + T+RKEE+K ++ E + +L++ + +   +N+KW++K+EL++ LE+QV QMK  ++ K ++LIEER+++ +   V+  +L S++  ++ QLE  L+    + I+         + A++RV  +E+EMR LL+ET   KK +  +++ L  A+ ++
Sbjct:  424 LVQELDQERERRWKAEQVVLKLTENIKELQSQAKEEKGINSMAVYTTDRIKELLLKEKNAKSKLQELIHHLREENEKLMDELKKLKCKEEDYQKAYKSMEDTLAKLETQNI---QKQALEMKQVQETERKVSASQREIDLLRVALRQQK--------------EKVNQLHEVLTSKEQLHRKELESRVALNGPEFQYALAQEMAKEEHHHSQQIHSFQEKINLLTQQYADLEDEFRAALIIEAERFKEVKDGFDNVASELAEHKETVHRCRQKEKQSATLMQELTTMVKEQKARIAEITKAKQEIISDLKSKIHSLEKVAEEGRQKTVQTELLKKEKSKLISQLTAQESLIDGLKAERKIWGQELTQQGVSLAQDRGRLEAKIEVLSNEIESLKKQNERDADALRIKTKIVDDQTETIRKLKEGLQERDERIRKLREENIELEKVLQEQSDERTAQLEELKQKLERQTERKEEVKQLLEEKEAELEDVKKAYSAMNKKWQDKAELLSHLETQVRQMKENFDAKENKLIEERDKSLQCQKVITEKLRSVDDAFRRQLESVLSAHQAELIKLASDKQKEIEAANERVYQVEEEMRHLLKETANSKKIMEEKIKRLTGALSDI 1026          

HSP 2 Score: 136.732 bits (343), Expect = 2.322e-31
Identity = 79/177 (44.63%), Postives = 111/177 (62.71%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL---EINILSDIPGLENFLEYL 681
            N I  I+GL  L  L+HLDLSSNLITKI GLD+L  L++LNLS N++ ++EG+ KL  L KLN+S+N I D++GL       +H L+ + +  N I  I  V+++   L  L  LTL  N   NPVC    YR+ +L +L QL  LD  DR+G+P+   E++ + D+  L +FLEYL
Sbjct:   38 NQISKIEGLRHLCYLQHLDLSSNLITKIEGLDSLASLQSLNLSCNKLTRVEGLEKLFNLKKLNLSYNSIQDLTGLIPLHGW-NHKLSHLYLHSNCINSIDEVLQSTVGLNCLLHLTLEQNAKGNPVCHALGYREIILENLPQLNSLDGLDRSGDPVTAHEVDSM-DLANL-DFLEYL 211          
BLAST of LRRCC1 vs. UniProt/SwissProt
Match: sp|Q9C099|LRCC1_HUMAN (Leucine-rich repeat and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRRCC1 PE=1 SV=2)

HSP 1 Score: 225.328 bits (573), Expect = 9.103e-60
Identity = 199/622 (31.99%), Postives = 348/622 (55.95%), Query Frame = 1
Query: 1006 DGKIANLIKELDQERNKRL---DLENKLQLVINKYKDAQLMLTNDRKSKED----AIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHE--MNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNE-------AQEK----SDVLQRQLDSIEQKYKSQL-ELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEVDSD 2808
            D    +L+++LDQER KR      ENKL   I++       L      KED    A+ +TD+L     +E++ + +LE  VH LQ + K+  +EL + +   E     ++   +  EK+   K ++     R + E +L    A+  +  ++       +Q   L   L+ +E+E++  L  R      + +D + +++  A+ E  HE  +  ++ K+   + QY DLENEFR+AL +EA R++ ++  +  + TE    K  L    +K+ ES SLI +LT +VK+QK KL E+SK KQE+  N + +I TLE  +E+ +++ +Q EL K E  ++ ++L+A+ES++ GLRTERK+W  ELAQQG  L Q+R KLE +IE+ + E  CL+   E  +++L+ KCK +++QT  I ++K+ L EKD   K   +K+ E +K  + +++    ++    + + +  +RKE+LK  +   + +L+E   +   +N+KW +K EL+  LE+QV ++K  +E K  +L  ER++       A EK     D  +RQ+D+I + +++++ +LA + +  I   A+ +V  IE EMR LL+ET + KK + ++++ L  A+ E+  D
Sbjct:  420 DNTYQSLVEQLDQEREKRWRAEQAENKLMDYIDE-------LHKHANEKEDIHSLALLTTDRLKEIIFRERNSKGQLEVMVHKLQNEIKKLTVELMKAKDQQEDHLKHLRTLEKTLEKMERQKRQQQAAQIRLIQEVELKASAADREIYLLRTSLHREREQAQQLHQLLALKEQEHRKELETREFFTDADFQDALAKEI--AKEEKKHEQMIKEYQEKIDVLSQQYMDLENEFRIALTVEARRFQDVKDGFENVATELAKSKHALIWAQRKENESSSLIKDLTCMVKEQKTKLAEVSKLKQETAANLQNQINTLEILIEDDKQKSIQIELLKHEKVQLISELAAKESLIFGLRTERKVWGHELAQQGSSLAQNRGKLEAQIESLSRENECLRKTNESDSDALRIKCKIIDDQTETIRKLKDCLQEKDEHIKRLQEKITEIEKCTQEQLDEKSSQLDEVLEKLERHNERKEKLKQQLKGKEVELEEIRKAYSTLNRKWHDKGELLCHLETQVKEVKEKFENKEKKLKAERDKSIELQKNAMEKLHSMDDAFKRQVDAIVEAHQAEIAQLANEKQKCI-DSANLKVHQIEKEMRELLEETCKNKKTMEAKIKQLAFALNEIQQD 1031          

HSP 2 Score: 132.109 bits (331), Expect = 6.675e-30
Identity = 88/217 (40.55%), Postives = 127/217 (58.53%), Query Frame = 1
Query:   49 GESESENILEENYIDFGVKDILSXXXXXXXXXXXXXYNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL---EINILSDIPGLENFLEYLSSS 690
            G+S   ++    ++D G++ I  L L +    +NLH N+I  I+ ++ + NL+HLDLSSN I++I GL+ L  L TLNLS N I K+EG+ +L  L +LNVS+N I D+SGL     +  H L  I++  N+I  I H+++    L  L  L L  +   NPVC  P YR  +L +L QL+ILD K+  G P+   EIN  S +  LE  L+ L SS
Sbjct:   19 GDSSCGDVC---FMDKGLQSISELSLDSTLHAVNLHCNNISKIEAIDHIWNLQHLDLSSNQISRIEGLNTLTKLCTLNLSCNLITKVEGLEELINLTRLNVSYNHIDDLSGLIPLHGI-KHKLRYIDLHSNRIDSIHHLLQCMVGLHFLTNLILEKDGDDNPVCRLPGYRAVILQTLPQLRILDCKNIFGEPVNLTEINS-SQLQCLEGLLDNLVSS 230          
BLAST of LRRCC1 vs. UniProt/SwissProt
Match: sp|Q69ZB0|LRCC1_MOUSE (Leucine-rich repeat and coiled-coil domain-containing protein 1 OS=Mus musculus OX=10090 GN=Lrrcc1 PE=2 SV=2)

HSP 1 Score: 224.942 bits (572), Expect = 1.432e-59
Identity = 189/616 (30.68%), Postives = 336/616 (54.55%), Query Frame = 1
Query:  988 NKRDNSDGKIANLIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEA-----------QEKSDVLQRQLDSIEQKYKSQ-LELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEV 2799
            N  DNS  +  +L+++LDQER  R   E   + +++   +        +     A+ +TD+L  A  KE+  + +LE  VH LQ + K+  IEL + R   E     ++      EK+   K+++     R + E +L    A+  +  ++      + QV  L   L+ +E+E++  +  R      E +D + +++     +   E+  ++ K+   N QY DLENEFR+AL +EA R+K ++  +  + TE    K  L    +K+ ES SLI +LT +VK+QK KL E+ K KQE+  N + +I TLE  +E+ +++ +Q EL K E  ++ ++L+A+ES++ GLRTERK+W +ELA Q   L+Q R KLE +IE+   E   L+   E   ++L+ KCK +E+Q   I ++K+ L EKD + K   +++   +K  + ++     ++ +  + + +  +RKE+LK  +   + +L+E   +   +N+KW +K EL++ LE QV ++K  +E K  +L  ER+++           Q   D  +RQ+D I + ++++ ++LA + + +I   A+ +V  +EDEMR LL ET + KK +  +++ L  AI E+
Sbjct:  410 NFSDNSTYR--SLVEQLDQEREMRWKAEQTEKKLMDYIDELHKQADEKKDVHSQALITTDRLKDAIFKERHCKAQLEIIVHRLQNEVKKLTIELMKARDQQEDHIRHLRTLERALEKMEKQKAQQQAAQIRLIQEVELKASAADREINLLRTSLHQEKQQVQQLHELLALKEQEHRQEIETRQFFTDAEFQDALTKRLCKEERKHEQEVKEYQEKIDILNQQYLDLENEFRIALTVEARRFKDVQDGFEDVATELAKSKHALIWAQRKENESSSLIKDLTCMVKEQKTKLSEVCKLKQEAAANLQNQINTLEILIEDDKQKSIQIELLKHEKTQLISELAAKESLIYGLRTERKVWGQELACQSSTLSQSRGKLEAQIESLCRENESLRKSHESDCDALRIKCKIIEDQNETIRKLKDSLQEKDGQIKLLQEQIALIEKCSQEQLNEKSSQLDSIVEKLERHNERKEKLKQQLKAKELELEEIRKAYSTLNKKWHDKGELLSHLEMQVKEVKEKFEDKERKLKAERDKSLELQKDAMEKLQNMDDAFRRQVDEIVEAHQAEIMQLANEKQKYI-DCANLKVQQVEDEMRGLLDETCKNKKMMEEKIKQLACAISEI 1022          

HSP 2 Score: 128.257 bits (321), Expect = 8.209e-29
Identity = 87/217 (40.09%), Postives = 125/217 (57.60%), Query Frame = 1
Query:   49 GESESENILEENYIDFGVKDILSXXXXXXXXXXXXXYNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL---EINILSDIPGLENFLEYLSSS 690
            G+S   ++    ++D G+  I  L L ++   +NLH N+I  I  ++ + NLRHLDLSSN I++I GL+ L  L TLNLS N I ++EG+  L  L KLN+S+N I+D+SGL     L  + L  I++  N I  I H+++    L  L  L L  +   NP+C  P YR  +L +L QL+ILD K+  G P+   EIN  S +  LE  L+ L SS
Sbjct:   14 GDSSCGDVC---FMDKGLHSISELSLDSSIHAINLHCNNISKISSIDHIWNLRHLDLSSNQISQIEGLNTLTKLCTLNLSCNLITRVEGLEALVNLTKLNLSYNHINDLSGLMPLHGL-KYKLRYIDLHSNYIDSIHHLLQCTVGLHFLTNLILEKDGEGNPICLIPGYRAIILQTLPQLRILDCKNIFGEPVSLEEINS-SHLQCLEGLLDNLVSS 225          
BLAST of LRRCC1 vs. UniProt/SwissProt
Match: sp|A2AL36|CNTRL_MOUSE (Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 7.093e-12
Identity = 57/152 (37.50%), Postives = 84/152 (55.26%), Query Frame = 1
Query:  175 IKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFS-NLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL 627
            I+ LE  + L  L+LS NLI KI  +D L+ LR LNLS N+I KIEG+  +  L KLN++ N+I  I     F+  L S  L  + ++GN+I  +  V K  + L +L  L L+D    NPV + P Y + ++  L  L+ L+     G P+
Sbjct:  118 IENLEKCVKLEVLNLSYNLIVKIEKVDKLLRLRELNLSYNKISKIEGLENMCNLQKLNLAGNEIEHIPVW--FAKKLKS--LRVLNLKGNKISSLQDVSK-LKPLQDLTSLVLID----NPVVALPHYLQFIIFHLRSLESLE-----GQPV 255          

HSP 2 Score: 64.3142 bits (155), Expect = 6.613e-9
Identity = 45/131 (34.35%), Postives = 72/131 (54.96%), Query Frame = 1
Query:  157 YNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIE--GISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCS 543
            YN I+ I+ ++ L+ LR L+LS N I+KI GL+N+  L+ LNL+ N I+ I      KL+ L  LN+  N IS +  +S+   L    LTS+ +  N +  + H ++    + +LR L  L+     PV +
Sbjct:  134 YNLIVKIEKVDKLLRLRELNLSYNKISKIEGLENMCNLQKLNLAGNEIEHIPVWFAKKLKSLRVLNLKGNKISSLQDVSKLKPLQD--LTSLVLIDNPVVALPHYLQFI--IFHLRSLESLEG---QPVTT 257          
BLAST of LRRCC1 vs. UniProt/SwissProt
Match: sp|Q8INT5|DAAF1_DROME (Dynein assembly factor 1, axonemal homolog OS=Drosophila melanogaster OX=7227 GN=dtr PE=2 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 2.585e-11
Identity = 58/152 (38.16%), Postives = 87/152 (57.24%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIE--GISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCST-PDYRKKLLSSLMQLQILDTK 606
            N+I  I+GLE L  L+ L L +NLITKI  LD    L TLNLS+N I+KI+  G + L  L  L +S N + D   LS+   +    L+ +++  N+I  I  ++K  ++++NL+ L L      NPV S  P YRK L+ +  +L  LD++
Sbjct:   66 NAISEIQGLEKLSKLKCLFLQNNLITKIENLDPCRELDTLNLSSNHIRKIQNIGTNVLPVLNTLTISSNYLKDSESLSDL--IQCKTLSVLDLSNNRIDDIL-IVKIFEQMLNLKVLVL----QGNPVVSRLPQYRKTLILACKELTYLDSR 210          
BLAST of LRRCC1 vs. TrEMBL
Match: H6WA37 (LRRCC1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1404.04 bits (3633), Expect = 0.000e+0
Identity = 743/743 (100.00%), Postives = 743/743 (100.00%), Query Frame = 1
Query:  166 IIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPLEINILSDIPGLENFLEYLSSSTDHYSETTLKESANSIQHXXXXXXXXXXXXXEEHFKDDKESDSELKLRLRDLENKLASFVQKTEEEKALNSKPITMKDEVSTETNKENASKELKKAALNNKRDNSDGKIANLIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEEL 2394
            IIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPLEINILSDIPGLENFLEYLSSSTDHYSETTLKESANSIQHTKKTFNKDFNKKTEEHFKDDKESDSELKLRLRDLENKLASFVQKTEEEKALNSKPITMKDEVSTETNKENASKELKKAALNNKRDNSDGKIANLIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEIELQEFRKNIETSNVDIKLKLELKEKLLMSKSEEIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEEL
Sbjct:    1 IIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPLEINILSDIPGLENFLEYLSSSTDHYSETTLKESANSIQHTKKTFNKDFNKKTEEHFKDDKESDSELKLRLRDLENKLASFVQKTEEEKALNSKPITMKDEVSTETNKENASKELKKAALNNKRDNSDGKIANLIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEIELQEFRKNIETSNVDIKLKLELKEKLLMSKSEEIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEEL 743          
BLAST of LRRCC1 vs. TrEMBL
Match: A0A4W3I6C6 (Uncharacterized protein OS=Callorhinchus milii OX=7868 GN=lrrcc1 PE=4 SV=1)

HSP 1 Score: 387.111 bits (993), Expect = 9.097e-116
Identity = 297/920 (32.28%), Postives = 500/920 (54.35%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILD--------TKDRNGNPLEINILSDIPGLENFLEYLSSSTDHYSETTLKESANSIQHXXXXXXXXXXXXXEEHFKDDKESDSELK-----------LRLRDLENKLASFVQKTEEEKA-LNSK-PITMKDEVSTETNKENASKELKKAALNNKR---DNSDGKIA--NLIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEI--ELQEFRKN-IETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQEKSDVLQRQLDSIEQKYKSQLELA--YKNRDFIRQE---------ADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEV 2799
            N I  ++GL  L  LRHLDLSSN I +I GL NLI LRTLNLS N I ++EG++ L  L KLN+S+N I+D+SG   + + + H L+ +++  N I    H+++    L  L  LTL+ +   NPVC TP YR+ LL SL QL +LD             G PL      DIPGLE++ EYL SS D  +    + +   I      +++            D E+ S  K           +R++ LE +++  +Q+     + L +K  I        E  KEN  K  ++  L   +   + S+  I    LI+ELD ER KR   E  ++ ++   K  Q  +   +  ++ A+ +TD+L     KEK  +++LE  VH  +   K +E+  EL   R +  E   V   L+  + +        + ++M R + E +L    A   V  ++      +++V  LQ  L+ RE+E++  + +R +L   E +D + R+++        ++  ++ K+   N QY +LE+EFR+AL +EA R+K+++  +  ++ E    K  L +  +K+++S+ LI ELT +VK+QK K+ EL+K+KQ +    K RI TLE   EE +K+ +Q EL K E  K+ ++L+AQES+++GLR ER++W +ELAQQG  L QDR +LE +IE   SEI  +K +  +  ++LK K K +++QT  I ++KEGL E+D + +   ++ ++ Q+  + +++       + K+ V +L++RK +LK  + + + +L+E++ +   +N+KW++K+EL+ KLE QV QMK  ++    +L+EERN+A +       +L S++  ++ Q E     +    I+ E         A ++V  +E+EMR+LLQET + KK +  ++R L  A+ ++
Sbjct:   26 NQISKLEGLSHLWQLRHLDLSSNQIVRIEGLGNLISLRTLNLSCNLITQVEGLNGLVNLTKLNLSYNGITDLSGFL-YLHGAGHKLSFLDLHSNCISTFDHLLQCMTGLCCLSDLTLVKDGRGNPVCQTPGYRELLLQSLPQLALLDGISHSGKRVHSSEGGPL------DIPGLEDYAEYLVSS-DSSASVEPQLTTPRIDEVLAQYHQRTTVPDPAATMSDTEASSSPKQTKTAVSLYNEIRIKKLEQQISQLLQQVPTASSTLKAKRDIDHSSGSEIENCKENHKKGTRRTKLQGYQQMTETSNKYICFQALIQELDLEREKRWKAEQAVKPLMEHIKSLQNQVNEKQDVRDIAVHTTDRLKDLLLKEKEAKKQLE--VHAAELRIKVEELTEELANSRSSEKEQRKVLKSLEETISKTEARRLQHKTMEMKR-IQEAELKASVAHREVELLQIALRQEKEKVHQLQELLTSREQEHRKEVDSRVTLSGPEFRDALSRELAKEEERHSQQLKEYQEKINVLNQQYVNLEDEFRVALTIEANRFKEVKDGFDHVVAELADHKHTLARSQQKEKQSRKLIQELTAMVKEQKAKIAELAKSKQGTTSELKSRIRTLEHVAEEDKKKTVQIELLKLEKSKLISQLTAQESVIDGLRAERRIWGQELAQQGSSLAQDRGRLEARIEVLTSEIESIKKQNVRDIDALKIKNKIVDDQTETIRKLKEGLQERDEQIRKVREENLQTQRRFQEQLDDEAIISQDLKERVERLSERKNDLKQQLEDKEAELEETKKAYSAVNKKWQDKAELLTKLEIQVKQMKENFDANEKKLVEERNKALQAQKATVEKLHSMDDAFRRQHETVQAAQQAQLIQLENQKQKEIEAAKEKVYQVEEEMRQLLQETAKSKKNMEEKIRKLTHALSDI 934          
BLAST of LRRCC1 vs. TrEMBL
Match: A0A4W3I562 (Uncharacterized protein OS=Callorhinchus milii OX=7868 GN=lrrcc1 PE=4 SV=1)

HSP 1 Score: 386.726 bits (992), Expect = 1.450e-115
Identity = 297/920 (32.28%), Postives = 500/920 (54.35%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILD--------TKDRNGNPLEINILSDIPGLENFLEYLSSSTDHYSETTLKESANSIQHXXXXXXXXXXXXXEEHFKDDKESDSELK-----------LRLRDLENKLASFVQKTEEEKA-LNSK-PITMKDEVSTETNKENASKELKKAALNNKR---DNSDGKIA--NLIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEI--ELQEFRKN-IETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQEKSDVLQRQLDSIEQKYKSQLELA--YKNRDFIRQE---------ADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEV 2799
            N I  ++GL  L  LRHLDLSSN I +I GL NLI LRTLNLS N I ++EG++ L  L KLN+S+N I+D+SG   + + + H L+ +++  N I    H+++    L  L  LTL+ +   NPVC TP YR+ LL SL QL +LD             G PL      DIPGLE++ EYL SS D  +    + +   I      +++            D E+ S  K           +R++ LE +++  +Q+     + L +K  I        E  KEN  K  ++  L   +   + S+  I    LI+ELD ER KR   E  ++ ++   K  Q  +   +  ++ A+ +TD+L     KEK  +++LE  VH  +   K +E+  EL   R +  E   V   L+  + +        + ++M R + E +L    A   V  ++      +++V  LQ  L+ RE+E++  + +R +L   E +D + R+++        ++  ++ K+   N QY +LE+EFR+AL +EA R+K+++  +  ++ E    K  L +  +K+++S+ LI ELT +VK+QK K+ EL+K+KQ +    K RI TLE   EE +K+ +Q EL K E  K+ ++L+AQES+++GLR ER++W +ELAQQG  L QDR +LE +IE   SEI  +K +  +  ++LK K K +++QT  I ++KEGL E+D + +   ++ ++ Q+  + +++       + K+ V +L++RK +LK  + + + +L+E++ +   +N+KW++K+EL+ KLE QV QMK  ++    +L+EERN+A +       +L S++  ++ Q E     +    I+ E         A ++V  +E+EMR+LLQET + KK +  ++R L  A+ ++
Sbjct:   41 NQISKLEGLSHLWQLRHLDLSSNQIVRIEGLGNLISLRTLNLSCNLITQVEGLNGLVNLTKLNLSYNGITDLSGFL-YLHGAGHKLSFLDLHSNCISTFDHLLQCMTGLCCLSDLTLVKDGRGNPVCQTPGYRELLLQSLPQLALLDGISHSGKRVHSSEGGPL------DIPGLEDYAEYLVSS-DSSASVEPQLTTPRIDEVLAQYHQRTTVPDPAATMSDTEASSSPKQTKTAVSLYNEIRIKKLEQQISQLLQQVPTASSTLKAKRDIDHSSGSEIENCKENHKKGTRRTKLQGYQQMTETSNKYICFQALIQELDLEREKRWKAEQAVKPLMEHIKSLQNQVNEKQDVRDIAVHTTDRLKDLLLKEKEAKKQLE--VHAAELRIKVEELTEELANSRSSEKEQRKVLKSLEETISKTEARRLQHKTMEMKR-IQEAELKASVAHREVELLQIALRQEKEKVHQLQELLTSREQEHRKEVDSRVTLSGPEFRDALSRELAKEEERHSQQLKEYQEKINVLNQQYVNLEDEFRVALTIEANRFKEVKDGFDHVVAELADHKHTLARSQQKEKQSRKLIQELTAMVKEQKAKIAELAKSKQGTTSELKSRIRTLEHVAEEDKKKTVQIELLKLEKSKLISQLTAQESVIDGLRAERRIWGQELAQQGSSLAQDRGRLEARIEVLTSEIESIKKQNVRDIDALKIKNKIVDDQTETIRKLKEGLQERDEQIRKVREENLQTQRRFQEQLDDEAIISQDLKERVERLSERKNDLKQQLEDKEAELEETKKAYSAVNKKWQDKAELLTKLEIQVKQMKENFDANEKKLVEERNKALQAQKATVEKLHSMDDAFRRQHETVQAAQQAQLIQLENQKQKEIEAAKEKVYQVEEEMRQLLQETAKSKKNMEEKIRKLTHALSDI 949          
BLAST of LRRCC1 vs. TrEMBL
Match: A0A4W3I544 (Uncharacterized protein OS=Callorhinchus milii OX=7868 GN=lrrcc1 PE=4 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 8.438e-114
Identity = 287/922 (31.13%), Postives = 507/922 (54.99%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILD--------TKDRNGNPLEINILSDIPGLENFLEYLSSSTDHYSETTLKESANSIQHXX---XXXXXXXXXXXEEHFKDDKESDSELKLRLRDLENKLASFVQKTEEEKALNSKPIT--MKDEVSTETNKEN-------------ASKELKKAALNNKRDN--SDGKIANLIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEI--ELQEFRKN-IETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQEKSDVLQRQLDSIEQKYKSQLELA--YKNRDFIRQE---------ADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEV 2799
            N I  ++GL  L  LRHLDLSSN I +I GL NLI LRTLNLS N I ++EG++ L  L KLN+S+N I+D+SG   + + + H L+ +++  N I    H+++    L  L  LTL+ +   NPVC TP YR+ LL SL QL +LD             G PL      DIPGLE++ EYL SS    +   +  ++++++  +    +   +     E H K  + +  +   ++ +   + +  +Q+ ++ ++ + +P    +K   +  T +E+              S+ +++   ++K+ N   +     LI+ELD ER KR   E  ++ ++   K  Q  +   +  ++ A+ +TD+L     KEK  +++LE  VH  +   K +E+  EL   R +  E   V   L+  + +        + ++M R + E +L    A   V  ++      +++V  LQ  L+ RE+E++  + +R +L   E +D + R+++        ++  ++ K+   N QY +LE+EFR+AL +EA R+K+++  +  ++ E    K  L +  +K+++S+ LI ELT +VK+QK K+ EL+K+KQ +    K RI TLE   EE +K+ +Q EL K E  K+ ++L+AQES+++GLR ER++W +ELAQQG  L QDR +LE +IE   SEI  +K +  +  ++LK K K +++QT  I ++KEGL E+D + +   ++ ++ Q+  + +++       + K+ V +L++RK +LK  + + + +L+E++ +   +N+KW++K+EL+ KLE QV QMK  ++    +L+EERN+A +       +L S++  ++ Q E     +    I+ E         A ++V  +E+EMR+LLQET + KK +  ++R L  A+ ++
Sbjct:   38 NQISKLEGLSHLWQLRHLDLSSNQIVRIEGLGNLISLRTLNLSCNLITQVEGLNGLVNLTKLNLSYNGITDLSGFL-YLHGAGHKLSFLDLHSNCISTFDHLLQCMTGLCCLSDLTLVKDGRGNPVCQTPGYRELLLQSLPQLALLDGISHSGKRVHSSEGGPL------DIPGLEDYAEYLVSSDSSVNPEKVPTASSTLKAKRDIDHSSGSEIENCKENHKKGTRRTKLQGYQQMTETSKRRSGTLQRNKKSESDHEQPRGRKLKSSNTQPTRREDLSGSSSIGSRKSSTSQTIEQGTQDSKKTNVAEESTYRALIQELDLEREKRWKAEQAVKPLMEHIKSLQNQVNEKQDVRDIAVHTTDRLKDLLLKEKEAKKQLE--VHAAELRIKVEELTEELANSRSSEKEQRKVLKSLEETISKTEARRLQHKTMEMKR-IQEAELKASVAHREVELLQIALRQEKEKVHQLQELLTSREQEHRKEVDSRVTLSGPEFRDALSRELAKEEERHSQQLKEYQEKINVLNQQYVNLEDEFRVALTIEANRFKEVKDGFDHVVAELADHKHTLARSQQKEKQSRKLIQELTAMVKEQKAKIAELAKSKQGTTSELKSRIRTLEHVAEEDKKKTVQIELLKLEKSKLISQLTAQESVIDGLRAERRIWGQELAQQGSSLAQDRGRLEARIEVLTSEIESIKKQNVRDIDALKIKNKIVDDQTETIRKLKEGLQERDEQIRKVREENLQTQRRFQEQLDDEAIISQDLKERVERLSERKNDLKQQLEDKEAELEETKKAYSAVNKKWQDKAELLTKLEIQVKQMKENFDANEKKLVEERNKALQAQKATVEKLHSMDDAFRRQHETVQAAQQAQLIQLENQKQKEIEAAKEKVYQVEEEMRQLLQETAKSKKNMEEKIRKLTHALSDI 949          
BLAST of LRRCC1 vs. TrEMBL
Match: A0A5G3LGQ2 (UNC93-like protein MFSD11 OS=Xenopus tropicalis OX=8364 GN=mfsd11 PE=4 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 1.011e-102
Identity = 298/953 (31.27%), Postives = 523/953 (54.88%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL---EINILSDIPGLENFLEYLSSSTDHYSETTLKESANS------IQHXXXXXXXXXXXXXEEHFKDDKESDSEL-------------KLRLRDLENKLASFVQKTE----EEKALNSKPIT-MKDEVSTETNKEN----------------ASKELKKAALNNKRDNSDGK----IANLIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKED----AIKSTDKLTAAFSKEKSFRQELENKVHILQTD----------FKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQ---VDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQEKS--------DVLQRQLDSIEQKYKSQL-ELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEV 2799
            N I  I+GL  L  L+HLDLSSNLITKI GLD+L  L++LNLS N++  +EG+ KL  L KLN+S+N I D++G        +H L+ + +  N I  I  V+++   L  L  LTL  N   NPVC+   YR+ +L +L QL  LD  DR+G P+   E++ + D+  L +FLEYL +      E  +KESA+       I      + K        +F  D  S SE              ++R++ LE++++  + K      E+  L +K  T    E  +E++K+N                ASK  K  A    +  S       +  L+++LDQER +R   E     V+ K  D+   L N  K ++D    A+ +TD++     KEKS + +L+  +H L+ +           K+KE + Q   K+++ +   ++ +              I Q + E+ + + A+++  +S   I    ++L  Q   V  L   L+ +E+ ++  L  R +L+  E +D + ++M+        E+++++ K+     QY DLE+EFR AL +EA R+K ++  +  +  E    K  +++ ++K+++S +LI ELT +VK+QK ++ E++K KQ+   + K +I +LE   EE R++ +Q EL KQE  K+ ++L+AQES+++GL+ ERK+W +EL QQG  L QDR +LE KIE  ++EI  LK + E+  ++L+ K K +++QT  I ++KEGL E+D   +   ++ ++ +K +  + +    ++   K+ + + T+RKEE+K ++ E + +L++ + +   +N+KW++K+EL+++LE+QV QMK  ++ K  +LIEER+++ + +        D  +RQL+S+   ++++L +LA   +  I + A++RV  +E+EMR+LL+ET   KK + ++++ L  A  ++
Sbjct:   43 NHISKIEGLGHLCYLQHLDLSSNLITKIEGLDSLTCLQSLNLSCNKLTWVEGLGKLFNLKKLNLSYNRIQDLTGFIPLHG-RNHKLSHLYLHSNCINNIEEVLQSMVGLNCLLHLTLEQNAKGNPVCNVLGYREIILENLPQLNSLDGIDRSGVPVTAHEVDSM-DLANL-DFLEYLINFDSGRKE--VKESASGPVKTARIDEVLTKYRKQRAASEAINFSTDITSSSEHDIARFHDNSNILREIRIKKLEDQISELLMKASCPISEQTTLKAKRDTDFTTESDSESSKDNRKGSTTRTPGCRKTSQASKHQKHQASQQSKGVSGLSTCIVLQALVQDLDQERERRWKAEQ----VVLKLTDSIKELQNQAKEEKDVNSMAVYTTDRIKELLFKEKSAKSKLQELIHHLKEENQKLADELKKLKDKEEDYQRAYKSMDDTLAKLETQR-------------IQQAALEMKQVQEAERKVSASQREIDLLRASLRQQKEKVHQLHELLTSKEQLHRKELEARVALNGPEFQDALAKEMAKEAHRHSQEIHSFQEKMNLLTRQYADLEDEFRAALIIEAGRFKDVKDGFDNVAAELAEHKEIVNRCLQKEKQSATLIQELTAMVKEQKARIAEITKAKQDIISDLKSKIHSLEKVAEEGRQKTVQIELLKQEKSKLISQLTAQESLIDGLKAERKIWGQELTQQGVSLAQDRGRLEAKIEVLSTEIESLKKQNERDTDTLRIKTKVVDDQTETIRKLKEGLQERDERIRKLREENIQLEKTLREQSDERTTQLEELKEKLERQTERKEEVKQLLEEKESELEDVKKAYSAMNKKWQDKAELLSQLETQVRQMKENFDAKERKLIEERDKSLQVTTEKLRSVDDAFRRQLESVLSAHQAELIKLASDKQKEI-EAANERVYQVEEEMRQLLKETANSKKIMEAKIKRLTGAFSDI 972          
BLAST of LRRCC1 vs. Ensembl Cavefish
Match: lrrcc1 (leucine rich repeat and coiled-coil centrosomal protein 1 [Source:ZFIN;Acc:ZDB-GENE-041111-207])

HSP 1 Score: 251.906 bits (642), Expect = 1.644e-69
Identity = 160/480 (33.33%), Postives = 300/480 (62.50%), Query Frame = 1
Query: 1387 DECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQEKS-----------DVLQRQLDSIEQKYKSQ-LELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAI 2790
            ++C + ++  +   AS+++H    +D++  LQ  L+ RE+ ++  L+ R +    E ++ V ++++A            + KL++A  QY  LE+EFR+AL +EA+R+ ++++ +  +  + + +K+ L++   K ++S SL+ ELT++VK+QK ++ EL K+K+++    K R+ TLEA  EE R+  +Q EL K+E  ++ ++L+AQES++EGLR ER+LW +ELAQQG  L QDR +LE +IE  ++E+   K + EK  ++L+ K K +++QT  I ++KE + E+D + +A  ++ +E Q+  + + E     +S  +D+V KLT RKEELK  + + + ++DE + +    ++KW++K++L+ +LESQV +MK  ++ K   L++ER++A +             D  +RQL+S++  ++++ L+LA + +  I Q A+ RV  +E+EMR+LL+ET   K+ +  ++R L   +
Sbjct:  579 NKCAVLKREVDILRASLRQH----KDKLQQLQELLTSREEAHRKELSTRLAPGGAEFREAVGKEVAAVEQRHNQRYAEMEQKLSEARQQYTSLEDEFRMALTIEAKRFSEVKEGFELVSAQLSEVKAALNESQAKAKQSGSLVQELTSMVKEQKARIAELIKSKRDAVTELKTRVRTLEAGAEEDRRLNVQLELLKKEKSRLISQLTAQESVIEGLRVERRLWGQELAQQGASLAQDRGRLEARIEVLSTELESQKKQNEKDNDALRIKAKIVDDQTETIRKLKEAVQERDEQLRALREENLETQRRFQQQREEEKASVSELQDTVEKLTLRKEELKQQLFDKESEMDELKQAYSASSRKWQDKADLLTRLESQVKRMKEGFDAKERALLDERDKASQAHKAAVEKLHSVDDAFRRQLESLQASHQAELLQLANEKQKHIEQ-ANQRVFQVEEEMRQLLEETESNKRAMEEKMRRLTSVL 1053          

HSP 2 Score: 152.91 bits (385), Expect = 2.115e-37
Identity = 77/179 (43.02%), Postives = 116/179 (64.80%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGN--PLEINILSDIPGLENFLEYLSSS 690
            N +  I+GL +  ++RHLDLSSN I++I GL  L  LRTLNLS N I K+EG++ L  + +LN+S+N I+D++GL  + + + + L  +++ GN +  I H+++    L NLR +TL  +   NPVCS P YR+ +L SL Q+  LD +DR GN  P       D+PGLE+F+E+L S+
Sbjct:   33 NRLSKIEGLTTAWHIRHLDLSSNHISRIEGLGALTSLRTLNLSCNSITKVEGLNGLTNVTRLNLSYNQINDLTGLL-YLHGTEYKLKHLQLHGNHLDNINHLLQCMVGLRNLRDMTLRRDGVDNPVCSLPGYREMVLQSLQQISTLDGEDRLGNWVPSGDESPLDVPGLEDFVEFLISA 210          
BLAST of LRRCC1 vs. Ensembl Cavefish
Match: lrrcc1 (leucine rich repeat and coiled-coil centrosomal protein 1 [Source:ZFIN;Acc:ZDB-GENE-041111-207])

HSP 1 Score: 249.595 bits (636), Expect = 2.269e-69
Identity = 160/478 (33.47%), Postives = 298/478 (62.34%), Query Frame = 1
Query: 1393 CKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQEKS-----------DVLQRQLDSIEQKYKSQ-LELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAI 2790
            C + ++  +   AS+++H    +D++  LQ  L+ RE+ ++  L+ R +    E ++ V ++++A            + KL++A  QY  LE+EFR+AL +EA+R+ ++++ +  +  + + +K+ L++   K ++S SL+ ELT++VK+QK ++ EL K+K+++    K R+ TLEA  EE R+  +Q EL K+E  ++ ++L+AQES++EGLR ER+LW +ELAQQG  L QDR +LE +IE  ++E+   K + EK  ++L+ K K +++QT  I ++KE + E+D + +A  ++ +E Q+  + + E     +S  +D+V KLT RKEELK  + + + ++DE + +    ++KW++K++L+ +LESQV +MK  ++ K   L++ER++A +             D  +RQL+S++  ++++ L+LA + +  I Q A+ RV  +E+EMR+LL+ET   K+ +  ++R L   +
Sbjct:  451 CAVLKREVDILRASLRQH----KDKLQQLQELLTSREEAHRKELSTRLAPGGAEFREAVGKEVAAVEQRHNQRYAEMEQKLSEARQQYTSLEDEFRMALTIEAKRFSEVKEGFELVSAQLSEVKAALNESQAKAKQSGSLVQELTSMVKEQKARIAELIKSKRDAVTELKTRVRTLEAGAEEDRRLNVQLELLKKEKSRLISQLTAQESVIEGLRVERRLWGQELAQQGASLAQDRGRLEARIEVLSTELESQKKQNEKDNDALRIKAKIVDDQTETIRKLKEAVQERDEQLRALREENLETQRRFQQQREEEKASVSELQDTVEKLTLRKEELKQQLFDKESEMDELKQAYSASSRKWQDKADLLTRLESQVKRMKEGFDAKERALLDERDKASQAHKAAVEKLHSVDDAFRRQLESLQASHQAELLQLANEKQKHIEQ-ANQRVFQVEEEMRQLLEETESNKRAMEEKMRRLTSVL 923          
BLAST of LRRCC1 vs. Ensembl Cavefish
Match: lrguk (leucine rich repeats and guanylate kinase domain containing [Source:NCBI gene;Acc:103023555])

HSP 1 Score: 71.633 bits (174), Expect = 2.450e-12
Identity = 59/148 (39.86%), Postives = 78/148 (52.70%), Query Frame = 1
Query:  157 YNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILD 600
            YNSI  IKG+E   +L H  ++ N I++ISGL+NL  L+ L L  N IKKIE +  LR L  L++S N I  +SGL     L      SI  + N I  I  V      ++ LR+L L      NPV   PDYR  ++  L +L  LD
Sbjct:  122 YNSITEIKGVEKCSSLIHFSIAHNKISRISGLNNLP-LKHLCLRGNLIKKIENLHTLRALQFLDISSNRIHSLSGLQNLPLLG-----SINFESNMISEIKEV-SYLHDILLLRELNL----KRNPVQEQPDYRMMVIFLLNRLTELD 258          
BLAST of LRRCC1 vs. Ensembl Cavefish
Match: lrguk (leucine rich repeats and guanylate kinase domain containing [Source:NCBI gene;Acc:103023555])

HSP 1 Score: 67.3958 bits (163), Expect = 6.094e-11
Identity = 58/152 (38.16%), Postives = 77/152 (50.66%), Query Frame = 1
Query:  157 YNSIIIIKGLESLINLRHLDLSSNLITKISGLDNL----IFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILD 600
            YNSI  IKG+E   +L H  ++ N I++ISGL+NL    + L T     N IKKIE +  LR L  L++S N I  +SGL     L      SI  + N I  I  V      ++ LR+L L      NPV   PDYR  ++  L +L  LD
Sbjct:  122 YNSITEIKGVEKCSSLIHFSIAHNKISRISGLNNLPLKHLCLGTAADRGNLIKKIENLHTLRALQFLDISSNRIHSLSGLQNLPLLG-----SINFESNMISEIKEV-SYLHDILLLRELNL----KRNPVQEQPDYRMMVIFLLNRLTELD 263          
BLAST of LRRCC1 vs. Ensembl Cavefish
Match: drc3 (dynein regulatory complex subunit 3 [Source:ZFIN;Acc:ZDB-GENE-061103-349])

HSP 1 Score: 63.5438 bits (153), Expect = 6.664e-10
Identity = 55/169 (32.54%), Postives = 85/169 (50.30%), Query Frame = 1
Query:  157 YNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSL-----MQLQILDTKDRNGNPLEINILSD 648
            Y  I+ I  L    +L  L L++N I KI GL+ L  L  L+LS N+IK IEG+  L +L  L++S N I  I  +    +L    L       N I  I +VI   +R  NLR L L    + NP+C   +Y+  +++ L     +  +++D + R     EIN+++D
Sbjct:   52 YKKILQIDHLWEFTSLTKLQLNNNSIEKIQGLEKLTNLLWLDLSFNKIKMIEGLEALVKLQTLSLSNNQIPAIEKMDTLEHLEILSLGE-----NVISQIDNVIY-LRRFKNLRSLNL----ARNPICQETNYKIFVVAYLPDLVYLDFRLVDEQTRERALTEINVMTD 210          
BLAST of LRRCC1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006793.1 (pep scaffold:Pmarinus_7.0:GL478186:28720:41038:-1 gene:ENSPMAG00000006137.1 transcript:ENSPMAT00000006793.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.293 bits (251), Expect = 1.456e-24
Identity = 66/185 (35.68%), Postives = 101/185 (54.59%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDI--SGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL----EINILSDIPGLENFLEYLSSSTD 696
            N I  ++GL  L  L HLDLSSN + +I GL +L  LRTLNLS N +  ++G+  L  +  LNVS+N I+D+  SGL +      + L+ +E  GN++  +  ++     L  L  L L  +  +NPVC    YR+++  +++ LQ LD  D  G  L    E   L+++  LE+FL+ L    D
Sbjct:   21 NQIARLEGLGRLPQLAHLDLSSNRLERIEGLASLACLRTLNLSCNHLTSVQGLQGLACMHWLNVSYNRITDLVGSGLRDLHG-PDYQLSHLEAHGNRLADVDALVAALGGLHCLSVLVLRKDGQANPVCRVTGYRERVFEAVLSLQSLDGHDALGTELSSSREEPRLAELRDLEDFLDVLDHCDD 204          
BLAST of LRRCC1 vs. Ensembl Sea Lamprey
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 63.5438 bits (153), Expect = 6.300e-11
Identity = 52/169 (30.77%), Postives = 86/169 (50.89%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSS---------------------NPVCSTPDYRKKLLSSLMQLQILDT 603
            N I +I+ +E+L NL  L +  N ITK+  LD+L  L  L++ +NRI KIEG+S L  L +L +S N I  I GL      ++  LT++++  N+++     I+N   L  L++  + DN  S                     NP+   P YR+K++ +L  ++ +D 
Sbjct:  176 NRIRVIENIETLKNLDSLFIGKNKITKLQNLDSLTNLTVLSIQSNRITKIEGLSSLVNLQELYLSHNGIEVIEGLE-----NNKKLTTLDIAANRVRR----IENVGHLTELQEFWMNDNQISNWNDVDELKNARGLQTVYLERNPLQRDPQYRRKIMLALPWVRQIDA 335          

HSP 2 Score: 59.3066 bits (142), Expect = 1.389e-9
Identity = 39/102 (38.24%), Postives = 61/102 (59.80%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHV 465
            N I  I+ LESL  LR LDL  N++ KI  LD L+ L  L++S N ++KIEG+  LR++ KL +  N I+ I  L+  + L       +E+  N+I++I ++
Sbjct:   88 NMIAQIENLESLTTLRELDLYDNVLKKIENLDTLVNLEMLDISFNVLRKIEGLDTLRKVRKLFLVSNKITKIENLNSLTELR-----MLEVASNRIRVIENI 184          

HSP 3 Score: 55.0694 bits (131), Expect = 3.466e-8
Identity = 43/118 (36.44%), Postives = 67/118 (56.78%), Query Frame = 1
Query:  157 YNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTL 510
            +N +  I+GL++L  +R L L SN ITKI  L++L  LR L +++NRI+ IE I  L+ L  L +  N I+ +  L   +N     LT + +Q N+I      I+    L+NL++L L
Sbjct:  131 FNVLRKIEGLDTLRKVRKLFLVSNKITKIENLNSLTELRMLEVASNRIRVIENIETLKNLDSLFIGKNKITKLQNLDSLTN-----LTVLSIQSNRIT----KIEGLSSLVNLQELYL 239          
BLAST of LRRCC1 vs. Ensembl Sea Lamprey
Match: cep97 (centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-031030-11])

HSP 1 Score: 62.3882 bits (150), Expect = 3.408e-10
Identity = 51/177 (28.81%), Postives = 86/177 (48.59%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLI----THVIK---------------------NCQRLINLRQLTLLDNNS-----SNPVCSTPDYRKKLLSSLMQLQILD 600
            NS++ + G+  L +L+ L+L  N I  I GL +L  L+ LNL+ N IK IE ++    L  +++S N+IS +  +S+ SNL      ++ + GN +  +    TH+                       +C R  +L QL+++ N       S P C   D+R  +LS  + L++LD
Sbjct:   67 NSLVRMGGVARLSSLKQLNLPRNSIPAIEGLKDLCHLQWLNLAGNSIKTIEHLNGCTSLTYVDLSDNNISHLGDMSKLSNLR-----TLLLHGNMVTSLRTAPTHLPPQLGILSLAENEITDLTEMSHLSCLR--SLEQLSVMKNPCMLSAPSAPAC---DHRPYVLSWCLTLRVLD 233          
BLAST of LRRCC1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005086.1 (pep scaffold:Pmarinus_7.0:GL477410:204878:243212:-1 gene:ENSPMAG00000004613.1 transcript:ENSPMAT00000005086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 1.901e-9
Identity = 60/156 (38.46%), Postives = 81/156 (51.92%), Query Frame = 1
Query:  166 IIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDI--SGLSEFSNLSSHPLTSIEMQGNQI---KLITHVIKNCQRLINLRQLTLLDNNSSNPVCST---PDYRKKLLSSLMQLQILDTKD 609
            + +IKGLE    LR L L SN I +I GL++L  L  L L+ N I  IE +  L+ L +LN++ N I  I   G S  SNL    L  + + GN+I   K +TH+     RL  L +L+L D   +   CS     +Y   LL  L QL+ LDT D
Sbjct:   80 VTVIKGLEPCRELRKLYLYSNNIARIEGLESLPLLEVLWLNNNCIAAIENLHCLQHLKELNLADNQIEFIVSKGHSLDSNLE---LERLNLSGNKISCFKELTHL----SRLPALTELSLQDPLYAP--CSVSLLCNYATHLLYHLPQLRRLDTID 226          
BLAST of LRRCC1 vs. Ensembl Sea Lamprey
Match: LRRC49 (leucine rich repeat containing 49 [Source:HGNC Symbol;Acc:HGNC:25965])

HSP 1 Score: 52.7582 bits (125), Expect = 2.952e-7
Identity = 47/151 (31.13%), Postives = 71/151 (47.02%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNS--SNPVCSTPDYRKKLLSSLMQLQILDTK 606
            N I  I  LESL  L  LDL  N I +I  L +L  LR LNL+ N+I  ++ +  L  L +LN+  N+IS +  +    +L             ++ L  + I N   ++ LR+   L   +   NP+     YR+  L  + QL+ LD K
Sbjct:  106 NRIRKITSLESLTKLDVLDLHGNQIVRIENLSHLSELRVLNLAGNQITHVDSLRGLHSLAELNLRRNNISSMKEVDCLPSL------------QRLFLSYNNIANFDGIVCLREAPSLCEVALDGNPLAQEACYRQTALRHMGQLRQLDMK 244          

HSP 2 Score: 50.0618 bits (118), Expect = 2.487e-6
Identity = 48/125 (38.40%), Postives = 65/125 (52.00%), Query Frame = 1
Query:  157 YNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSN 531
            +N I   + L  L  L  LDL +N + +ISGL NL  LR L L  NRI+KI  +  L +L  L++  N I  I  LS  S L       + + GNQ   ITHV  + + L +L +L L  NN S+
Sbjct:   61 HNLIRRAQHLSHLRRLVFLDLYANELEEISGLYNLRSLRVLMLGKNRIRKITSLESLTKLDVLDLHGNQIVRIENLSHLSELR-----VLNLAGNQ---ITHV-DSLRGLHSLAELNLRRNNISS 176          
BLAST of LRRCC1 vs. Ensembl Nematostella
Match: EDO35299 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLU3])

HSP 1 Score: 139.043 bits (349), Expect = 3.000e-36
Identity = 78/178 (43.82%), Postives = 113/178 (63.48%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPLEINILSDIPGLENFLEYLSSST 693
            N I  I+GL+ L NLRHLDLSSN I+ I GL +L +LR LNLS NRI  +EG+  LR+L KL++S+N I ++SGL +    + + LT++ + GN+I  + H I +    I+L++LTL      N VC+   YR  +LS++  L +LD  DR G    +N   DIP LE +++YL SS+
Sbjct:   44 NHISKIEGLQHLQNLRHLDLSSNQISHIEGLTSLGYLRVLNLSCNRIYLVEGLENLRKLTKLDLSYNFIENVSGLKDLHG-NGYSLTTLYLHGNRIASLEHFISSVIGCISLKELTLQMYGEGNHVCNVSGYRDGVLSAMPGLAVLDGYDRTGRAAALNDDLDIPELEEYIQYLQSSS 220          
BLAST of LRRCC1 vs. Ensembl Nematostella
Match: EDO38071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDZ3])

HSP 1 Score: 73.1738 bits (178), Expect = 1.793e-13
Identity = 54/150 (36.00%), Postives = 82/150 (54.67%), Query Frame = 1
Query:  157 YNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTK 606
            + +I+ I  L S +NL  L L +N+I KI GLD L+ L+ L+LS N I+ IEG+ KL +L  L +  N I+ I  +   +NL  H  +   +  N +K + +VI   +R  NLR L L    S NP C    Y++ +++ L  L  LD +
Sbjct:   52 FKNILKIDNLWSFVNLTTLQLDNNIIEKIEGLDMLVNLQWLDLSFNNIEVIEGLDKLTKLKDLTLYNNRITKIENMDSLTNL--HVFS---IGNNSLKQLDNVIY-LRRFKNLRTLNL----SFNPFCEDSKYKEYVIAHLPDLVYLDFR 191          
BLAST of LRRCC1 vs. Ensembl Nematostella
Match: EDO32449 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUZ9])

HSP 1 Score: 62.7734 bits (151), Expect = 1.919e-11
Identity = 55/189 (29.10%), Postives = 97/189 (51.32%), Query Frame = 1
Query: 2242 GLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQEKSDVLQRQLDSIEQKYKSQLELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEVDSD 2808
             LSE++ E K   D+  +   ++E ++ + +   +  +D V  L +RK+ELK  + + Q++L++++     +  KW+EKS LI ++ES+VVQM++ +++K   L EER++A                        A +N + +       +  +EDEMR+LLQE    KK L  R+  L  A  E+  D
Sbjct:    1 ALSERENEIKRIRDENAKQVADLEQKLASELTTSTELQDEVDALRQRKDELKTQLRDSQEELEKTKDGLRSLRSKWQEKSGLITQMESEVVQMRDNFKEKEKTLTEERDKAI----------------------TAARNSNHV-------MTQVEDEMRQLLQENALTKKTLEKRINKLTSAFTEIQQD 160          
BLAST of LRRCC1 vs. Ensembl Nematostella
Match: EDO49856 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REV6])

HSP 1 Score: 62.003 bits (149), Expect = 3.894e-10
Identity = 56/157 (35.67%), Postives = 79/157 (50.32%), Query Frame = 1
Query:  202 LRHLDLSSNLITKISGLD-----------------------NLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIK-NCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILD 600
            L HL+LS N I ++SGLD                       NL  LR L L+AN I+K+EG+ +L  L KL++  N I  + G SE  N+ +  L  + ++GN I     V K  C  L  LR L L++    NPV    DYR ++L +L +L+ LD
Sbjct:  143 LEHLNLSMNEIVEVSGLDPGKLSRLAILELRGNKLMTTTGMNLENLRELYLAANTIRKVEGLDRLEHLTKLHLRDNQIDSLEGFSE--NMKN--LQYLNLRGNSISSNKEVQKLKCLPL--LRALVLME----NPVSDEDDYRIEVLIALRRLERLD 289          
BLAST of LRRCC1 vs. Ensembl Nematostella
Match: EDO44937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU20])

HSP 1 Score: 55.8398 bits (133), Expect = 2.728e-8
Identity = 49/169 (28.99%), Postives = 79/169 (46.75%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNN---------------------SSNPVCSTPDYRKKLLSSLMQLQILDT 603
            N I +++GLE L  L  L +  N IT++  L  L  L+ L++ +NRI +++G+  L  L +L +S N I +I GL   + L++  L S     N+IK I+    N   L+NL +    DN                        NP+     YR+K+  +L  L+ +D 
Sbjct:  147 NKIRVLEGLEHLTKLESLFVGKNKITELQNLSGLCSLKVLSIQSNRIVELKGLEHLDSLEELYISHNGIEEIKGLESLTKLNTLDLAS-----NRIKRIS----NVGHLLNLEEFWFNDNQLEHWEDLDELAKCPKLHTVYLERNPLSRDTAYRRKVKLALPALKQIDA 306          

HSP 2 Score: 50.8322 bits (120), Expect = 1.109e-6
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSS 408
            N I  I+ L+ L+NLR LDLS N+I  I  L++L  L  L L  N+I +IEG+  L +L  + +  N I  + GL   + L S
Sbjct:   81 NQISKIENLDRLVNLRILDLSFNVIKVIENLNSLTKLEKLYLVQNKIGRIEGLEHLTELTMVELGANKIRVLEGLEHLTKLES 163          

HSP 3 Score: 49.6766 bits (117), Expect = 2.627e-6
Identity = 34/97 (35.05%), Postives = 54/97 (55.67%), Query Frame = 1
Query:  157 YNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTS---IEMQG 438
            +N I +I+ L SL  L  L L  N I +I GL++L  L  + L AN+I+ +EG+  L +L  L V  N I+++  LS   +L    + S   +E++G
Sbjct:  102 FNVIKVIENLNSLTKLEKLYLVQNKIGRIEGLEHLTELTMVELGANKIRVLEGLEHLTKLESLFVGKNKITELQNLSGLCSLKVLSIQSNRIVELKG 198          
BLAST of LRRCC1 vs. Ensembl Medaka
Match: lrrcc1 (leucine rich repeat and coiled-coil centrosomal protein 1 [Source:NCBI gene;Acc:101165006])

HSP 1 Score: 225.713 bits (574), Expect = 7.056e-61
Identity = 180/591 (30.46%), Postives = 330/591 (55.84%), Query Frame = 1
Query: 1078 LQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXX-XXXXXIIQMSRELD-ECKLAQKRAESSV--ASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEA-----------QEKSDVLQRQLDSIEQKYKSQLELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEVDS 2805
            LQ  +++ KD Q M          A+ +TD+L     KE+S R EL+N+V  L+        +L+  R N E S   ++   E           ++  +M R  D E K A  + E  +  A++ +H    ++++  L   L+ RE+E++  L  R      + ++ V +Q+S+A           + K+ +   +Y  LE+EFRLAL +EA R+ +++++Y +L  E   +++ L Q+ +K++ S SL+ ELT VVK+QK ++ EL K K+++    K R+ +LEA +E  R+  LQ E+ K+E  ++ ++++AQES+++GLR+ER++W +ELAQQG  L QDR +LE +IE  ASE+   + + ++  ++LK K K +++QT  I ++KE L E+D   +   ++  E QK +  ++E    + +  ++ + +L+ RKEELK  + + + +L E + S     ++W+EK +L+ +LE QV  MK  ++ K  +L+EER++A           +   D  + QL+S+   ++++L      +    + A+ +V  +E+EMR+LLQET   K+ +  ++R L+  +++  S
Sbjct:  436 LQTKVSEEKDLQSM----------ALHTTDRLKDLLLKERSGRSELQNRVEELEGRLLSLIQQLEVTRSNEEKSKAALQRAEESISHADALRAGQQAEEMKRRQDMENKAAALKRELDIQRAAVNQH----KEKLQQLHELLASREQEHRKQLDLRLQPGGADFREAVAQQVSSAERRHAQREAELQEKVAEGRKRYAALEDEFRLALTIEATRFSEVKEAYDRLTEEMVEVRAALSQWQQKEKRSGSLVQELTAVVKEQKSRIAELIKAKKDAVCGLKSRLRSLEAEVEGDRRLDLQLEVLKKEKARLLSQVTAQESVIDGLRSERRIWGQELAQQGASLAQDRGRLEARIEVLASELEAQRKQADRNQDALKIKTKIVDDQTETIRKLKESLQERDDRIRRLKNEAAEAQKRLHLQLEEDRVQQAELQERLERLSLRKEELKQQLEDKEAELHEVKTSHRESRRRWQEKEDLLTQLEVQVKGMKENFDSKERQLLEERDKAADAHKAALQKLRRADDAFRAQLESVHAAHRAELLQLADEKQQQTERANRKVLEVEEEMRQLLQETQTSKRVMEEKVRRLSSVLKDFHS 1012          

HSP 2 Score: 112.464 bits (280), Expect = 7.134e-25
Identity = 97/291 (33.33%), Postives = 156/291 (53.61%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPLEINI--LSDIPGLENFLEY-LSSSTDHY-----------SETTLKESANSIQHXXXXXXXXXXXXXEEHFKDDKESDSELKLRLRDLENKLASFVQKTE-EEKALN-----SKPITMK---DEVS---TETNKEN 954
            N I  I+GL S  NLR+LDLSSN I+KI GL +L  LRTLNLS N I K+EG++ L  L +LN+S N I++++GL  + + + + L  + + GN +  I H+++    L  LR +TL  +  SNP+C++  +   ++ SL Q+ +LD  DR  +P    +  + DIPGLE+++++ LSS T H+           S      S+  +           ++       D  ++D+E   R+R LE++++  +Q+    EK  N      KP+  K   D VS    ++ KEN
Sbjct:   33 NLIPRIEGLTSSWNLRNLDLSSNRISKIEGLSSLSSLRTLNLSCNLITKVEGLNGLVNLTRLNLSCNQINNLTGLL-YLHGTEYKLKHLSLHGNHLDSIDHLLQCLLGLQGLRNVTLRRDGQSNPLCASAGFWDAVMESLPQIFVLDGLDRLRHPSSPGLSSICDIPGLEDYMDFLLSSDTSHHEKVKGAVSPPRSGAGTHTSSEEVAQPTSQPVGRRSRTLSSSGPDPADADNE--ERIRKLEHQVSRLIQQVPTGEKPANLSRTAGKPLKAKRDTDRVSESDGDSGKEN 320          
BLAST of LRRCC1 vs. Ensembl Medaka
Match: lrrcc1 (leucine rich repeat and coiled-coil centrosomal protein 1 [Source:NCBI gene;Acc:101165006])

HSP 1 Score: 224.942 bits (572), Expect = 8.070e-61
Identity = 181/591 (30.63%), Postives = 328/591 (55.50%), Query Frame = 1
Query: 1078 LQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXX-XXXXXIIQMSRELD-ECKLAQKRAESSV--ASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEA-----------QEKSDVLQRQLDSIEQKYKSQLELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEVDS 2805
            LQ  +++ KD Q M          A+ +TD+L     KE+S R EL+N+V  L+        +L+  R N E S   ++   E           ++  +M R  D E K A  + E  +  A++ +H   L+     L   L+ RE+E++  L  R      + ++ V +Q+S+A           + K+ +   +Y  LE+EFRLAL +EA R+ +++++Y +L  E   +++ L Q+ +K++ S SL+ ELT VVK+QK ++ EL K K+++    K R+ +LEA +E  R+  LQ E+ K+E  ++ ++++AQES+++GLR+ER++W +ELAQQG  L QDR +LE +IE  ASE+   + + ++  ++LK K K +++QT  I ++KE L E+D   +   ++  E QK +  ++E    + +  ++ + +L+ RKEELK  + + + +L E + S     ++W+EK +L+ +LE QV  MK  ++ K  +L+EER++A           +   D  + QL+S+   ++++L      +    + A+ +V  +E+EMR+LLQET   K+ +  ++R L+  +++  S
Sbjct:  365 LQTKVSEEKDLQSM----------ALHTTDRLKDLLLKERSGRSELQNRVEELEGRLLSLIQQLEVTRSNEEKSKAALQRAEESISHADALRAGQQAEEMKRRQDMENKAAALKRELDIQRAAVNQHKEKLQ----QLHELLASREQEHRKQLDLRLQPGGADFREAVAQQVSSAERRHAQREAELQEKVAEGRKRYAALEDEFRLALTIEATRFSEVKEAYDRLTEEMVEVRAALSQWQQKEKRSGSLVQELTAVVKEQKSRIAELIKAKKDAVCGLKSRLRSLEAEVEGDRRLDLQLEVLKKEKARLLSQVTAQESVIDGLRSERRIWGQELAQQGASLAQDRGRLEARIEVLASELEAQRKQADRNQDALKIKTKIVDDQTETIRKLKESLQERDDRIRRLKNEAAEAQKRLHLQLEEDRVQQAELQERLERLSLRKEELKQQLEDKEAELHEVKTSHRESRRRWQEKEDLLTQLEVQVKGMKENFDSKERQLLEERDKAADAHKAALQKLRRADDAFRAQLESVHAAHRAELLQLADEKQQQTERANRKVLEVEEEMRQLLQETQTSKRVMEEKVRRLSSVLKDFHS 941          

HSP 2 Score: 79.7221 bits (195), Expect = 9.343e-15
Identity = 66/240 (27.50%), Postives = 119/240 (49.58%), Query Frame = 1
Query:  313 GISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPLEINILS--DIPGLENFLEY-LSSSTDHY-----------SETTLKESANSIQHXXXXXXXXXXXXXEEHFKDDKESDSELKLRLRDLENKLASFVQKTE-EEKALN-----SKPITMK---DEVS---TETNKEN 954
            G++ L  L +LN+S N I++++GL  + + + + L  + + GN +  I H+++    L  LR +TL  +  SNP+C++  +   ++ SL Q+ +LD  DR  +P    + S  DIPGLE+++++ LSS T H+           S      S+  +           ++       D  ++D+E   R+R LE++++  +Q+    EK  N      KP+  K   D VS    ++ KEN
Sbjct:   13 GLNGLVNLTRLNLSCNQINNLTGLL-YLHGTEYKLKHLSLHGNHLDSIDHLLQCLLGLQGLRNVTLRRDGQSNPLCASAGFWDAVMESLPQIFVLDGLDRLRHPSSPGLSSICDIPGLEDYMDFLLSSDTSHHEKVKGAVSPPRSGAGTHTSSEEVAQPTSQPVGRRSRTLSSSGPDPADADNE--ERIRKLEHQVSRLIQQVPTGEKPANLSRTAGKPLKAKRDTDRVSESDGDSGKEN 249          
BLAST of LRRCC1 vs. Ensembl Medaka
Match: drc3 (dynein regulatory complex subunit 3 [Source:NCBI gene;Acc:101162841])

HSP 1 Score: 65.0846 bits (157), Expect = 1.927e-10
Identity = 51/150 (34.00%), Postives = 84/150 (56.00%), Query Frame = 1
Query:  157 YNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTK 606
            Y +I  I  L+   +L  LDL++NLI KI GLD+LI L  LNLS NRI+KI+G++ L++L  LN+S N I+ I  +    NL +H      +  NQ++ + + +K  ++L+++           N   +  DY+  +++    L +LD K
Sbjct:   45 YQNIQRIDSLQEYTSLVRLDLNNNLIKKIQGLDSLINLTWLNLSFNRIEKIQGLTSLQKLKVLNLSNNQITVIENMDTLDNL-THFFIGCNL-LNQLENVLY-LKRFKKLVHIYM-------KGNLFSNEDDYQFFIVAFFPNLTVLDNK 184          
BLAST of LRRCC1 vs. Ensembl Medaka
Match: drc3 (dynein regulatory complex subunit 3 [Source:NCBI gene;Acc:101162841])

HSP 1 Score: 64.6994 bits (156), Expect = 2.587e-10
Identity = 49/144 (34.03%), Postives = 81/144 (56.25%), Query Frame = 1
Query:  175 IKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTK 606
            I  L+   +L  LDL++NLI KI GLD+LI L  LNLS NRI+KI+G++ L++L  LN+S N I+ I  +    NL +H      +  NQ++ + + +K  ++L+++           N   +  DY+  +++    L +LD K
Sbjct:   39 IDSLQEYTSLVRLDLNNNLIKKIQGLDSLINLTWLNLSFNRIEKIQGLTSLQKLKVLNLSNNQITVIENMDTLDNL-THFFIGCNLL-NQLENVLY-LKRFKKLVHIYM-------KGNLFSNEDDYQFFIVAFFPNLTVLDNK 172          
BLAST of LRRCC1 vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 61.2326 bits (147), Expect = 2.097e-9
Identity = 47/148 (31.76%), Postives = 71/148 (47.97%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDT 603
            N I  I+GL++L+NL+ L LS N I  I GL+N   L TL+++ANR+KKIE IS L +L +  ++ N I + S L E  N  S     +E                                 NP+   P YR+K++ +L  ++ +D 
Sbjct:  226 NRITKIEGLQNLVNLKELYLSHNGIEVIEGLENNKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIENWSDLDELKNAKSLETVYLE--------------------------------RNPLQKDPQYRRKIMLALPSVRQIDA 341          

HSP 2 Score: 58.9214 bits (141), Expect = 1.032e-8
Identity = 46/112 (41.07%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  175 IKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTL 510
            I+ LESL +LR LDL  N I K+  LDNL  L  L++S N ++KIE + +L QL KL +  N I+ I+ L  FS L       +E+  N+I+    VI+N   L +L  L L
Sbjct:   99 IENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLE-----MLELGSNRIR----VIENLDGLTSLTSLFL 201          

HSP 3 Score: 51.6026 bits (122), Expect = 2.067e-6
Identity = 42/122 (34.43%), Postives = 62/122 (50.82%), Query Frame = 1
Query:  157 YNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNN 522
            +N +  I+ LE L  L+ L L  N IT I+ L++  FL  L L +NRI+ IE +  L  L  L +  N I+ +  L    NLS      + +Q N+I      I+  Q L+NL++L L  N 
Sbjct:  137 FNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLS-----VLSIQSNRIT----KIEGLQNLVNLKELYLSHNG 249          
BLAST of LRRCC1 vs. Planmine SMEST
Match: SMESG000016752.1 (SMESG000016752.1)

HSP 1 Score: 1738.01 bits (4500), Expect = 0.000e+0
Identity = 928/930 (99.78%), Postives = 929/930 (99.89%), Query Frame = 1
Query:   28 MINMFSSGESESENILEENYIDFGVKDILSXXXXXXXXXXXXXYNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPLEINILSDIPGLENFLEYLSSSTDHYSETTLKESANSIQHXXXXXXXXXXXXXEEHFKDDKESDSELKLRLRDLENKLASFVQKTEEEKALNSKPITMKDEVSTETNKENASKELKKAALNNKRDNSDGKIANLIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEIELQEFRKNIETSNVDIXXXXXXXXXXXXXXXXXIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQEKSDVLQRQLDSIEQKYKSQLELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEVDSDRRK 2817
            MINMFSSGESESENILEENYIDFGVKDILSLHLKTNTTTLNLHYNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPLEINILSDIPGLENFLEYLSSSTDHYSETTLKESANS+QHTKKTFNKDFNKKTEEH KDDKESDSELKLRLRDLENKLASFVQKTEEEKALNSKPITMKDEVSTETNKENASKELKKAALNNKRDNSDGKIANLIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEIELQEFRKNIETSNVDIKLKLELKEKLLMSKSEEIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQEKSDVLQRQLDSIEQKYKSQLELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEVDSDRRK
Sbjct:    1 MINMFSSGESESENILEENYIDFGVKDILSLHLKTNTTTLNLHYNSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPLEINILSDIPGLENFLEYLSSSTDHYSETTLKESANSLQHTKKTFNKDFNKKTEEHLKDDKESDSELKLRLRDLENKLASFVQKTEEEKALNSKPITMKDEVSTETNKENASKELKKAALNNKRDNSDGKIANLIKELDQERNKRLDLENKLQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKVHILQTDFKEKEIELQEFRKNIETSNVDIKLKLELKEKLLMSKSEEIIQMSRELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLTNRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEFRLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELTTVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEAQASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAFTDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKLDESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQEKSDVLQRQLDSIEQKYKSQLELAYKNRDFIRQEADDRVAAIEDEMRRLLQETNEEKKRLNSRLRILNKAIEEVDSDRRK 930          
BLAST of LRRCC1 vs. Planmine SMEST
Match: SMESG000047633.1 (SMESG000047633.1)

HSP 1 Score: 60.077 bits (144), Expect = 2.087e-9
Identity = 47/144 (32.64%), Postives = 66/144 (45.83%), Query Frame = 1
Query:  175 IKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTK 606
            I GL  LI+L+ LDLS N I  I G+D+L+ +  L L  NRIKK+E +  L+QL  L++  N I D++ L       S  L +I + G                              NP C   ++R  +L+ L QL  LD K
Sbjct:   80 ISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVLSIGNNLIDDLNNLKYLRTFKS--LKAINLSG------------------------------NPCCEKDEFRVVVLAYLPQLIYLDYK 191          
BLAST of LRRCC1 vs. Planmine SMEST
Match: SMESG000041551.1 (SMESG000041551.1)

HSP 1 Score: 61.2326 bits (147), Expect = 2.665e-9
Identity = 63/177 (35.59%), Postives = 84/177 (47.46%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPL----------------TSIEMQG---NQIKLITHVIKNCQRLINLRQLTLLDNNSSNPVCSTP------DYRKKLLSSLMQLQILDTKDRN 615
            N II I GL  L NL  LDLS N I  I G+ +L  L  LNLS NRIK IE +    QL  L++S N I+ IS +S  S L +  +                 SIE+     NQI  +T  I     L NL+QL++      NP           DYR  +++  + L+ILD ++ N
Sbjct:   52 NQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTE-ISYLHSLFNLKQLSI----KENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEIN 223          
BLAST of LRRCC1 vs. Planmine SMEST
Match: SMESG000026105.1 (SMESG000026105.1)

HSP 1 Score: 58.151 bits (139), Expect = 1.172e-8
Identity = 40/96 (41.67%), Postives = 58/96 (60.42%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQI 447
            N I  I GL++LINL  L LS N I+KI  L NL  L TL+LS+NRI K+E +S L+ L +   + N+++D + + E  NL    L ++  + N I
Sbjct:  189 NRITQIDGLDNLINLEQLYLSHNGISKIENLGNLTKLTTLDLSSNRISKVENLSHLKILEEFWFNDNNLADWNSIDELVNLEK--LATVYFERNPI 282          

HSP 2 Score: 56.225 bits (134), Expect = 5.565e-8
Identity = 57/189 (30.16%), Postives = 84/189 (44.44%), Query Frame = 1
Query:  160 NSIIIIKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSN-----LSSHPLTSIEMQGNQIKLIT--------HVIKNCQRLINLRQLTLLDNNSS---------------------NPVCSTPD-------YRKKLLSSLMQLQILDT 603
            N I  I+ L SL+N+  L+L SN I +I  LD+L  L  L L  N+I K+E +  ++ L  L++  N I+ I GL    N     LS + ++ IE  GN  KL T          ++N   L  L +    DNN +                     NP+  TPD       YR+K+   L +L+ +D 
Sbjct:  123 NKIRTIENLNSLVNIEMLELGSNSIKRIENLDSLTKLDQLYLGKNKISKLENLDFMKNLTVLSIQGNRITQIDGLDNLINLEQLYLSHNGISKIENLGNLTKLTTLDLSSNRISKVENLSHLKILEEFWFNDNNLADWNSIDELVNLEKLATVYFERNPIWYTPDRSKEDPNYRRKIRLLLPKLKQIDA 311          

HSP 3 Score: 50.0618 bits (118), Expect = 4.279e-6
Identity = 44/103 (42.72%), Postives = 52/103 (50.49%), Query Frame = 1
Query:  202 LRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNCQRLINLRQLTL 510
            L  LDL  N ITKI  LD L+ L  L+LS NRIK IE I KL +L KL    N I  I  L+   N+       +E+  N IK     I+N   L  L QL L
Sbjct:   71 LEELDLYDNQITKIENLDKLVNLSILDLSFNRIKLIENIDKLIKLTKLYFVNNKIRTIENLNSLVNIE-----MLELGSNSIK----RIENLDSLTKLDQLYL 164          
BLAST of LRRCC1 vs. Planmine SMEST
Match: SMESG000021671.1 (SMESG000021671.1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.292e-8
Identity = 63/192 (32.81%), Postives = 97/192 (50.52%), Query Frame = 1
Query:  175 IKGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKLRQLVKLNVSFNDISDISGLSEFSNL---SSHP-----LTSIEMQGNQIKLITHVIKNC-------QRLINLRQLTLLDNNSSNPVCS-TPDYRKKLLSSLMQLQILD-----------TKDRNGNPLEINILSDIPGLENF 669
            I  +E L NL++L LS+N ITKI GLDNL+ L  L L  N I KIE +SKL++L K++++ N I+ +  L    NL   S H         ++  GN ++L  +   NC         L +L  L + D   +NP+   + +YR  ++ +L  L+ LD           +KD  G  L +  +SD  G E++
Sbjct:  844 ISNIEKLENLKYLTLSNNCITKIEGLDNLVHLEELILDNNAIVKIENLSKLQKLKKISLNENFINSVLFLKNLPNLQIISIHTNKLISFNGLDGCGNLMEL--YAANNCINDPSEISTLKSLNNLIIFD-IQNNPITEISKNYRLNMIFNLKHLKGLDGVCVDSSEIFHSKDILGGRLNLEYISDKIGNEDY 1032          
The following BLAST results are available for this feature:
BLAST of LRRCC1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRRCC11.246e-6031.99leucine rich repeat and coiled-coil centrosomal pr... [more]
LRRCC11.895e-6031.99leucine rich repeat and coiled-coil centrosomal pr... [more]
CNTRL1.451e-1137.25centriolin [Source:HGNC Symbol;Acc:HGNC:1858][more]
CNTRL1.451e-1137.25centriolin [Source:HGNC Symbol;Acc:HGNC:1858][more]
CNTRL2.244e-1037.91centriolin [Source:HGNC Symbol;Acc:HGNC:1858][more]
back to top
BLAST of LRRCC1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C06A8.61.628e-839.42pep chromosome:WBcel235:II:7772499:7773914:1 gene:... [more]
sds-222.493e-836.03Protein phosphatase 1 regulatory subunit SDS22 hom... [more]
K10D2.86.231e-733.95pep chromosome:WBcel235:III:5188726:5190175:1 gene... [more]
back to top
BLAST of LRRCC1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dtr2.579e-1238.16gene:FBgn0023090 transcript:FBtr0081516[more]
sds221.141e-935.48gene:FBgn0028992 transcript:FBtr0083436[more]
TbCMF468.418e-940.63gene:FBgn0032163 transcript:FBtr0079898[more]
Ppr-Y3.287e-738.54gene:FBgn0046697 transcript:FBtr0346721[more]
back to top
BLAST of LRRCC1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrcc12.707e-6835.41leucine rich repeat and coiled-coil centrosomal pr... [more]
lrrcc16.184e-6735.19leucine rich repeat and coiled-coil centrosomal pr... [more]
lrrcc16.184e-6735.19leucine rich repeat and coiled-coil centrosomal pr... [more]
lrrcc15.358e-6635.65leucine rich repeat and coiled-coil centrosomal pr... [more]
lrguk2.040e-1036.42leucine-rich repeats and guanylate kinase domain c... [more]
back to top
BLAST of LRRCC1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mfsd116.438e-10631.27major facilitator superfamily domain containing 11... [more]
mfsd112.930e-6830.48major facilitator superfamily domain containing 11... [more]
mfsd113.149e-6830.48major facilitator superfamily domain containing 11... [more]
mfsd113.149e-6830.48major facilitator superfamily domain containing 11... [more]
mfsd111.092e-6630.08major facilitator superfamily domain containing 11... [more]
back to top
BLAST of LRRCC1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrrcc11.924e-6030.68leucine rich repeat and coiled-coil domain contain... [more]
Lrrcc12.828e-6030.68leucine rich repeat and coiled-coil domain contain... [more]
Lrrcc19.356e-5430.02leucine rich repeat and coiled-coil domain contain... [more]
Lrrcc18.318e-5230.83leucine rich repeat and coiled-coil domain contain... [more]
Lrrcc12.132e-4532.55leucine rich repeat and coiled-coil domain contain... [more]
back to top
BLAST of LRRCC1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NRC9|LRCC1_XENLA2.769e-6430.16Leucine-rich repeat and coiled-coil domain-contain... [more]
sp|Q9C099|LRCC1_HUMAN9.103e-6031.99Leucine-rich repeat and coiled-coil domain-contain... [more]
sp|Q69ZB0|LRCC1_MOUSE1.432e-5930.68Leucine-rich repeat and coiled-coil domain-contain... [more]
sp|A2AL36|CNTRL_MOUSE7.093e-1237.50Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 ... [more]
sp|Q8INT5|DAAF1_DROME2.585e-1138.16Dynein assembly factor 1, axonemal homolog OS=Dros... [more]
back to top
BLAST of LRRCC1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H6WA370.000e+0100.00LRRCC1 (Fragment) OS=Schmidtea mediterranea OX=793... [more]
A0A4W3I6C69.097e-11632.28Uncharacterized protein OS=Callorhinchus milii OX=... [more]
A0A4W3I5621.450e-11532.28Uncharacterized protein OS=Callorhinchus milii OX=... [more]
A0A4W3I5448.438e-11431.13Uncharacterized protein OS=Callorhinchus milii OX=... [more]
A0A5G3LGQ21.011e-10231.27UNC93-like protein MFSD11 OS=Xenopus tropicalis OX... [more]
back to top
BLAST of LRRCC1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrcc11.644e-6933.33leucine rich repeat and coiled-coil centrosomal pr... [more]
lrrcc12.269e-6933.47leucine rich repeat and coiled-coil centrosomal pr... [more]
lrguk2.450e-1239.86leucine rich repeats and guanylate kinase domain c... [more]
lrguk6.094e-1138.16leucine rich repeats and guanylate kinase domain c... [more]
drc36.664e-1032.54dynein regulatory complex subunit 3 [Source:ZFIN;A... [more]
back to top
BLAST of LRRCC1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006793.11.456e-2435.68pep scaffold:Pmarinus_7.0:GL478186:28720:41038:-1 ... [more]
ppp1r76.300e-1130.77protein phosphatase 1, regulatory (inhibitor) subu... [more]
cep973.408e-1028.81centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSPMAT00000005086.11.901e-938.46pep scaffold:Pmarinus_7.0:GL477410:204878:243212:-... [more]
LRRC492.952e-731.13leucine rich repeat containing 49 [Source:HGNC Sym... [more]
back to top
BLAST of LRRCC1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LRRCC1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352993.000e-3643.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380711.793e-1336.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324491.919e-1129.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498563.894e-1035.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449372.728e-828.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LRRCC1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrcc17.056e-6130.46leucine rich repeat and coiled-coil centrosomal pr... [more]
lrrcc18.070e-6130.63leucine rich repeat and coiled-coil centrosomal pr... [more]
drc31.927e-1034.00dynein regulatory complex subunit 3 [Source:NCBI g... [more]
drc32.587e-1034.03dynein regulatory complex subunit 3 [Source:NCBI g... [more]
ppp1r72.097e-931.76protein phosphatase 1 regulatory subunit 7 [Source... [more]
back to top
BLAST of LRRCC1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016752.10.000e+099.78SMESG000016752.1[more]
SMESG000047633.12.087e-932.64SMESG000047633.1[more]
SMESG000041551.12.665e-935.59SMESG000041551.1[more]
SMESG000026105.11.172e-841.67SMESG000026105.1[more]
SMESG000021671.11.292e-832.81SMESG000021671.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30017079
GenBankAFB74719.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017079 ID=SMED30017079|Name=LRRCC1|organism=Schmidtea mediterranea sexual|type=transcript|length=2828bp
TTCAATTAAATTTATATTTAATGCTATATGATAAATATGTTTTCATCTGG
AGAGTCTGAATCAGAAAACATTTTAGAAGAAAATTACATTGATTTTGGAG
TGAAAGATATTTTAAGTCTTCATTTGAAAACTAATACAACAACTTTAAAT
TTGCACTATAATAGTATCATTATAATCAAAGGACTTGAAAGTCTCATTAA
TTTAAGACATTTGGATTTGTCTTCAAACTTGATTACTAAAATATCTGGAC
TTGATAACTTAATATTTCTACGAACATTAAATCTATCTGCTAATCGCATC
AAGAAAATTGAAGGAATTTCTAAACTAAGACAATTAGTGAAATTAAATGT
ATCATTTAATGACATCAGTGACATCTCTGGACTAAGTGAATTCTCGAATT
TATCAAGCCATCCGCTTACATCAATTGAGATGCAAGGAAACCAAATCAAA
TTAATTACGCATGTTATTAAAAATTGTCAGCGGTTGATAAATTTAAGACA
ACTGACTTTACTTGATAACAATTCTTCTAATCCAGTTTGCAGTACTCCAG
ACTATCGGAAAAAACTTTTGTCAAGTCTAATGCAATTGCAAATTCTCGAT
ACTAAAGACAGAAATGGAAATCCTCTAGAAATAAATATTTTATCTGATAT
TCCTGGCTTAGAGAATTTTTTGGAATATTTATCGAGCTCTACAGACCATT
ATTCTGAAACCACGCTTAAAGAATCTGCCAATTCAATACAACATACAAAG
AAAACTTTTAATAAGGACTTTAATAAAAAAACAGAAGAGCATTTCAAAGA
TGACAAAGAAAGTGATTCGGAATTAAAATTAAGACTGAGAGACCTAGAAA
ACAAATTAGCTTCCTTTGTTCAAAAAACCGAGGAAGAAAAAGCTCTGAAT
TCGAAACCGATAACAATGAAAGATGAAGTCTCAACAGAAACTAATAAGGA
AAATGCGTCAAAAGAATTGAAGAAAGCAGCATTGAACAATAAACGAGATA
ATTCCGATGGAAAAATAGCCAATCTTATTAAAGAACTTGATCAAGAACGA
AATAAAAGACTAGATTTAGAAAATAAACTCCAATTGGTCATTAACAAATA
TAAAGATGCGCAATTGATGCTAACAAATGACAGAAAAAGCAAAGAAGATG
CAATAAAATCAACAGACAAATTAACGGCGGCATTTTCAAAAGAAAAGTCA
TTTCGACAAGAATTGGAAAATAAAGTTCATATTTTACAAACCGATTTCAA
AGAAAAAGAAATAGAATTGCAGGAATTCAGAAAGAATATCGAAACATCGA
ATGTTGACATAAAATTGAAATTGGAATTAAAAGAAAAACTTTTGATGAGT
AAATCTGAGGAAATTATCCAGATGAGTAGAGAATTAGATGAATGCAAATT
AGCTCAGAAAAGGGCAGAAAGCAGTGTAGCCTCCATTAAAAAGCACTGCT
CTAATTTAGAGGACCAAGTTGATAATTTACAATCGACTCTGAGCAGAAGA
GAAAAAGAATATCAAATGAGTTTGACTAATAGATATTCCCTTGATAGCAA
CGAATTGAAAGATTACGTGGAGAGGCAAATGAGCGCTGCCAGAGCTGAAG
CTATCCATGAAATGAATGCTTGGAAATCCAAACTTACTGATGCTAATAAT
CAGTATAAGGATCTTGAAAATGAATTTCGATTAGCACTTCATATGGAGGC
AGAACGTTACAAAAAGCTTGAGCAGTCGTATTTCCAACTGTTAACTGAGT
CGAATTGTTTGAAATCTAAATTGGATCAGTTTATGAAAAAGGATGAGGAA
TCCAAATCATTGATATCAGAACTGACAACAGTGGTTAAAGATCAAAAGGT
GAAACTCGTGGAATTAAGCAAGAACAAGCAAGAGTCCAATCGGAATAATA
AGGAACGCATTATGACACTTGAAGCGCATCTTGAAGAAGCCCGTAAACAA
ATGCTTCAATTCGAACTAACTAAACAAGAAAATAAAAAGGTTCAAGCTAA
ATTATCAGCTCAAGAATCAATTTTAGAGGGTCTGCGGACCGAGAGAAAGT
TATGGAGTGAAGAGTTAGCCCAGCAAGGATATTTGCTGACTCAGGACCGA
TCAAAACTCGAATGTAAAATTGAAGCCCAAGCATCCGAAATCAGTTGCCT
GAAAATGGAACTGGAAAAACAAGCAGAATCTTTAAAATCGAAATGTAAAT
CGCTTGAAGAGCAAACTGGAGCAATATTGAGAATAAAAGAAGGCCTCAGT
GAGAAGGATTTAGAATCAAAAGCGTTTACTGATAAGTTAATGGAAGACCA
GAAAGAAATGGAAAGTAGAATAGAAACTTTGATGAAAGAAATTTCAAATT
ACAAAGATTCAGTGACAAAGCTTACCAAGAGGAAAGAAGAATTGAAAGAT
GTAATTGTTGAATTGCAAGACAAACTTGACGAATCCGAAGCTTCAAGAGA
AATGATCAATCAGAAATGGAGGGAAAAATCTGAGTTGATAGCGAAATTGG
AAAGCCAGGTTGTGCAAATGAAAAACTTTTGGGAAAAAAAAACTTCTGAA
CTAATCGAAGAAAGAAATGAAGCTCAAGAGAAATCAGATGTTTTACAAAG
GCAACTTGATTCGATTGAACAAAAATATAAATCGCAATTAGAATTGGCGT
ATAAAAATCGAGATTTCATTCGTCAAGAAGCTGATGATAGAGTAGCTGCT
ATAGAGGATGAGATGAGGCGCTTGCTACAAGAAACAAATGAGGAAAAGAA
AAGATTAAATTCTCGTTTAAGAATCTTAAATAAAGCTATTGAAGAAGTAG
ATTCAGATCGGAGGAAGTGATTCGAGAT
back to top

protein sequence of SMED30017079-orf-1

>SMED30017079-orf-1 ID=SMED30017079-orf-1|Name=SMED30017079-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=931bp
MINMFSSGESESENILEENYIDFGVKDILSLHLKTNTTTLNLHYNSIIII
KGLESLINLRHLDLSSNLITKISGLDNLIFLRTLNLSANRIKKIEGISKL
RQLVKLNVSFNDISDISGLSEFSNLSSHPLTSIEMQGNQIKLITHVIKNC
QRLINLRQLTLLDNNSSNPVCSTPDYRKKLLSSLMQLQILDTKDRNGNPL
EINILSDIPGLENFLEYLSSSTDHYSETTLKESANSIQHTKKTFNKDFNK
KTEEHFKDDKESDSELKLRLRDLENKLASFVQKTEEEKALNSKPITMKDE
VSTETNKENASKELKKAALNNKRDNSDGKIANLIKELDQERNKRLDLENK
LQLVINKYKDAQLMLTNDRKSKEDAIKSTDKLTAAFSKEKSFRQELENKV
HILQTDFKEKEIELQEFRKNIETSNVDIKLKLELKEKLLMSKSEEIIQMS
RELDECKLAQKRAESSVASIKKHCSNLEDQVDNLQSTLSRREKEYQMSLT
NRYSLDSNELKDYVERQMSAARAEAIHEMNAWKSKLTDANNQYKDLENEF
RLALHMEAERYKKLEQSYFQLLTESNCLKSKLDQFMKKDEESKSLISELT
TVVKDQKVKLVELSKNKQESNRNNKERIMTLEAHLEEARKQMLQFELTKQ
ENKKVQAKLSAQESILEGLRTERKLWSEELAQQGYLLTQDRSKLECKIEA
QASEISCLKMELEKQAESLKSKCKSLEEQTGAILRIKEGLSEKDLESKAF
TDKLMEDQKEMESRIETLMKEISNYKDSVTKLTKRKEELKDVIVELQDKL
DESEASREMINQKWREKSELIAKLESQVVQMKNFWEKKTSELIEERNEAQ
EKSDVLQRQLDSIEQKYKSQLELAYKNRDFIRQEADDRVAAIEDEMRRLL
QETNEEKKRLNSRLRILNKAIEEVDSDRRK*
back to top
Aliases
The feature 'LRRCC1' has the following synonyms
Synonym
LRRCC1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005814centriole
GO:0005856cytoskeleton
Vocabulary: biological process
TermDefinition
GO:0007049cell cycle
GO:0007067mitotic nuclear division
GO:0051301cell division
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 882..927
NoneNo IPR availableCOILSCoilCoilcoord: 467..494
NoneNo IPR availableCOILSCoilCoilcoord: 652..672
NoneNo IPR availableCOILSCoilCoilcoord: 316..357
NoneNo IPR availableCOILSCoilCoilcoord: 393..420
NoneNo IPR availableCOILSCoilCoilcoord: 702..729
NoneNo IPR availableCOILSCoilCoilcoord: 751..813
NoneNo IPR availableCOILSCoilCoilcoord: 256..290
NoneNo IPR availableCOILSCoilCoilcoord: 522..556
NoneNo IPR availableCOILSCoilCoilcoord: 603..648
NoneNo IPR availableCOILSCoilCoilcoord: 832..866
NoneNo IPR availableSMARTSM00365LRR_sd22_2coord: 56..77
e-value: 0.0013
score: 28.0
coord: 127..148
e-value: 270.0
score: 3.9
coord: 100..121
e-value: 51.0
score: 9.8
coord: 78..99
e-value: 3.2
score: 16.7
NoneNo IPR availablePANTHERPTHR45973:SF13coord: 238..894
NoneNo IPR availablePANTHERPTHR45973FAMILY NOT NAMEDcoord: 238..894
NoneNo IPR availablePANTHERPTHR45973FAMILY NOT NAMEDcoord: 20..210
NoneNo IPR availablePANTHERPTHR45973:SF13coord: 20..210
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 41..197
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 131..208
e-value: 2.1E-6
score: 28.8
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 14..130
e-value: 8.6E-19
score: 69.2
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 58..79
score: 10.269
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 129..150
score: 4.686
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 36..57
score: 6.857
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 80..101
score: 9.352
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 102..123
score: 7.935