Ubiquitin-conjugating enzyme E2 G2

Overview
NameUbiquitin-conjugating enzyme E2 G2
Smed IDSMED30017077
Length (bp)630
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin-conjugating enzyme E2 G2 (SMED30017077) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin-conjugating enzyme E2 G2 (SMED30017077) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin-conjugating enzyme E2 G2 (SMED30017077) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin-conjugating enzyme E2 G2 (SMED30017077) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017077

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017077SMESG000015438.1 Contig466uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017077SMESG000015438.1 Contig466newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017077SMESG000015438.1 Contig3860uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017077SMESG000015438.1 Contig3860newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017077SMESG000074424.1 Contig466uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017077SMESG000074424.1 Contig466newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30017077SMESG000015438.1 dd_Smed_v4_1316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017077SMESG000015438.1 dd_Smed_v4_1316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30017077SMESG000015438.1 dd_Smed_v4_1316_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017077SMESG000022726.1 Contig4070GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017077SMESG000015438.1 Contig4070GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Human
Match: UBE2G2 (ubiquitin conjugating enzyme E2 G2 [Source:HGNC Symbol;Acc:HGNC:12483])

HSP 1 Score: 275.789 bits (704), Expect = 4.146e-95
Identity = 131/165 (79.39%), Postives = 148/165 (89.70%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNL 585
            MAG ALKRLM+EYKQLTLNPPEGIV+GP++EENFFEWEALI GPE T FE GVF A LSFP+DYPL+PPKM+F  ++FHPNIYPDGRVCISILHAPG+DP GYESSAERWSPVQSVEKILLSVVSMLAEPNDES ANVDA+  WRDDR++F  +A++ V+KSL L
Sbjct:    1 MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL 165          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Human
Match: UBE2G2 (ubiquitin conjugating enzyme E2 G2 [Source:HGNC Symbol;Acc:HGNC:12483])

HSP 1 Score: 223.016 bits (567), Expect = 1.144e-74
Identity = 106/137 (77.37%), Postives = 121/137 (88.32%), Query Frame = 1
Query:  175 IDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNL 585
            ++EENFFEWEALI GPE T FE GVF A LSFP+DYPL+PPKM+F  ++FHPNIYPDGRVCISILHAPG+DP GYESSAERWSPVQSVEKILLSVVSMLAEPNDES ANVDA+  WRDDR++F  +A++ V+KSL L
Sbjct:    1 MNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL 137          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Human
Match: UBE2G1 (ubiquitin conjugating enzyme E2 G1 [Source:HGNC Symbol;Acc:HGNC:12482])

HSP 1 Score: 178.333 bits (451), Expect = 1.500e-56
Identity = 85/155 (54.84%), Postives = 108/155 (69.68%), Query Frame = 1
Query:  115 LMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQ-KFNDMAEKSVRKS 576
            L  +  +L  NP EG  +G ID+ + + WE LI GP  T +EGGVF A L+FP DYPL PPKMKFI++I+HPN+  +G VCISILH PG D  GYE   ERW P+ +VE I++SV+SMLA+PN +S ANVDAA  WR+DR  +F     + VRKS
Sbjct:   10 LRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKS 164          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Human
Match: UBE2R2 (ubiquitin conjugating enzyme E2 R2 [Source:HGNC Symbol;Acc:HGNC:19907])

HSP 1 Score: 152.525 bits (384), Expect = 1.315e-45
Identity = 77/161 (47.83%), Postives = 103/161 (63.98%), Query Frame = 1
Query:  109 KRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAI---TWRDDRQKFNDMAEKSVRKSLN 582
            K LM E K L   P EG     +DE + + WE  I GP  T +EGG F A + FP+DYP +PP  +F++ ++HPNIY +G VCISILH P +DP   E  +ERW+P Q+V  ILLSV+S+L EPN  S ANVDA++    WRD + K  + AE  +RK ++
Sbjct:   11 KALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAE-IIRKQVS 170          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Human
Match: CDC34 (cell division cycle 34 [Source:HGNC Symbol;Acc:HGNC:1734])

HSP 1 Score: 147.132 bits (370), Expect = 1.591e-43
Identity = 76/163 (46.63%), Postives = 102/163 (62.58%), Query Frame = 1
Query:  100 NALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWR-------DDRQKFNDMAEKSV 567
            ++ K L+ E K L   P EG     +DE + + WE  I GP  T +EGG F ARL FP+DYP +PP  +F++ ++HPNIY  G VCISILH P +DP   E  +ERW+P Q+V  ILLSV+S+L EPN  S ANVDA++ +R        DR+ + D+  K V
Sbjct:    8 SSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDRE-YTDIIRKQV 169          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Celegans
Match: ubc-14 (UBiquitin Conjugating enzyme [Source:UniProtKB/TrEMBL;Acc:Q9U1Q1])

HSP 1 Score: 259.996 bits (663), Expect = 3.729e-89
Identity = 122/166 (73.49%), Postives = 138/166 (83.13%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNLP 588
            MAG ALKRLM+EYK+LT  PPEGI++ PIDE+NFFEWE LI GPE T F  GVF AR++FP DYPL+PPKM+F   IFHPNIY DGRVCISILHAPG+DPTGYE S ERWSPVQS+EKILLSVVSMLAEPNDES ANV AA  WR+DR +F  +A+  VRK+L LP
Sbjct:    1 MAGYALKRLMTEYKELTTRPPEGIIAAPIDEDNFFEWECLITGPEETCFANGVFPARITFPQDYPLSPPKMRFTCGIFHPNIYADGRVCISILHAPGDDPTGYELSNERWSPVQSIEKILLSVVSMLAEPNDESPANVSAAKMWREDRAQFEKIADSLVRKTLCLP 166          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Celegans
Match: ubc-7 (Probable ubiquitin-conjugating enzyme E2 7 [Source:UniProtKB/Swiss-Prot;Acc:P34477])

HSP 1 Score: 163.31 bits (412), Expect = 3.308e-51
Identity = 80/157 (50.96%), Postives = 108/157 (68.79%), Query Frame = 1
Query:  106 LKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKS 576
            LK+ +++ +++   P +G  +G +D+ + ++WE L+ GP  T +EGG F A L FP DYP  PPKMKFIS+I+HPNI  +G VCISILH PG+D  GYE   ERW PV +VE ILLSV+SML +PN ES ANVDAA   R++  +F     + VR+S
Sbjct:    8 LKKQLADMRRV---PVDGFSAGLVDDNDIYKWEVLVIGPPDTLYEGGFFKAILDFPRDYPQKPPKMKFISEIWHPNIDKEGNVCISILHDPGDDKWGYERPEERWLPVHTVETILLSVISMLTDPNFESPANVDAAKMQRENYAEFKKKVAQCVRRS 161          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Celegans
Match: ubc-3 (UBiquitin Conjugating enzyme [Source:UniProtKB/TrEMBL;Acc:W6RY98])

HSP 1 Score: 145.976 bits (367), Expect = 2.307e-43
Identity = 73/165 (44.24%), Postives = 104/165 (63.03%), Query Frame = 1
Query:   94 AGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAI---TWRDDRQ-KFNDMAEKSVRKS 576
            +  AL+ L  E K L   P EG     ++E+N F W   I GP  T ++GG F A + FP +YP +PP MKF + ++HPN+Y +G +CISILH+P +DP   E + ERW+P QSV  ILLSV+S+L EPN  S ANVDA++    W++D+  ++  +  K V +S
Sbjct:    8 SSGALRALTMELKNLQSQPVEGFTID-VNEDNLFVWTVGIYGPPKTLYQGGYFKASIRFPSNYPYSPPSMKFTTKVWHPNVYENGDLCISILHSPIDDPQSGELACERWNPTQSVRTILLSVISLLNEPNTSSPANVDASVMYRKWKEDQDPEYAKIVTKQVEES 171          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Celegans
Match: ubc-3 (UBiquitin Conjugating enzyme [Source:UniProtKB/TrEMBL;Acc:W6RY98])

HSP 1 Score: 145.976 bits (367), Expect = 2.307e-43
Identity = 73/165 (44.24%), Postives = 104/165 (63.03%), Query Frame = 1
Query:   94 AGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAI---TWRDDRQ-KFNDMAEKSVRKS 576
            +  AL+ L  E K L   P EG     ++E+N F W   I GP  T ++GG F A + FP +YP +PP MKF + ++HPN+Y +G +CISILH+P +DP   E + ERW+P QSV  ILLSV+S+L EPN  S ANVDA++    W++D+  ++  +  K V +S
Sbjct:    8 SSGALRALTMELKNLQSQPVEGFTID-VNEDNLFVWTVGIYGPPKTLYQGGYFKASIRFPSNYPYSPPSMKFTTKVWHPNVYENGDLCISILHSPIDDPQSGELACERWNPTQSVRTILLSVISLLNEPNTSSPANVDASVMYRKWKEDQDPEYAKIVTKQVEES 171          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Celegans
Match: ubc-1 (Ubiquitin-conjugating enzyme E2 1 [Source:UniProtKB/Swiss-Prot;Acc:P52478])

HSP 1 Score: 128.257 bits (321), Expect = 3.783e-37
Identity = 67/162 (41.36%), Postives = 94/162 (58.02%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKS 576
            M   + +RLM ++K+L  +PP G VSG   E+N   WEA+I GP+ TPFE G F   L F  +YP  PP +KFIS +FHPN+Y DG +C+ IL               RWSP   V  IL S+ S+L EPN  S AN  AA  ++++R+++    ++ V +S
Sbjct:    1 MTTPSRRRLMRDFKKLQEDPPAG-VSGAPTEDNILTWEAIIFGPQETPFEDGTFKLSLEFTEEYPNKPPTVKFISKMFHPNVYADGSICLDILQ-------------NRWSPTYDVAAILTSIQSLLDEPNPNSPANSLAAQLYQENRREYEKRVQQIVEQS 148          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Fly
Match: Ubc7 (gene:FBgn0267384 transcript:FBtr0340157)

HSP 1 Score: 279.641 bits (714), Expect = 5.912e-97
Identity = 132/166 (79.52%), Postives = 147/166 (88.55%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNLP 588
            MAG+AL+RLM+EYKQLTL+PPEGIV+GPI E+NFFEWEALI GPEGT FEGGVF ARL FP DYPL+PPKMKF  D+FHPNI+ DGRVCISILHAPG+DP GYE SAERWSPVQSVEKILLSVVSMLAEPNDES ANVDAAI WR+ R +FN +A + VRK+L LP
Sbjct:    1 MAGSALRRLMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGPEGTCFEGGVFPARLIFPTDYPLSPPKMKFTCDMFHPNIFADGRVCISILHAPGDDPMGYELSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDAAIMWREQRDEFNAIARRLVRKTLGLP 166          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Fly
Match: Ubc7 (gene:FBgn0267384 transcript:FBtr0074283)

HSP 1 Score: 279.641 bits (714), Expect = 5.912e-97
Identity = 132/166 (79.52%), Postives = 147/166 (88.55%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNLP 588
            MAG+AL+RLM+EYKQLTL+PPEGIV+GPI E+NFFEWEALI GPEGT FEGGVF ARL FP DYPL+PPKMKF  D+FHPNI+ DGRVCISILHAPG+DP GYE SAERWSPVQSVEKILLSVVSMLAEPNDES ANVDAAI WR+ R +FN +A + VRK+L LP
Sbjct:    1 MAGSALRRLMAEYKQLTLDPPEGIVAGPISEDNFFEWEALIAGPEGTCFEGGVFPARLIFPTDYPLSPPKMKFTCDMFHPNIFADGRVCISILHAPGDDPMGYELSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDAAIMWREQRDEFNAIARRLVRKTLGLP 166          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Fly
Match: CG40045 (gene:FBgn0058045 transcript:FBtr0111163)

HSP 1 Score: 181.8 bits (460), Expect = 2.733e-58
Identity = 86/154 (55.84%), Postives = 107/154 (69.48%), Query Frame = 1
Query:  115 LMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKS 576
            L  +  +L  NP EG  +G IDE + F WE LI GP  T +EGG F A L FP +YPL PP+MKF+++I+HPNI  +G VCISILH PG+D  GYE ++ERW PV +VE IL+SV+SMLA+PNDES ANVDAA  WR+    F     + VRKS
Sbjct:   10 LKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPPRMKFVTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDESPANVDAAKEWRESYTDFKRKVARCVRKS 163          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Fly
Match: CG40045 (gene:FBgn0058045 transcript:FBtr0331586)

HSP 1 Score: 177.178 bits (448), Expect = 1.563e-56
Identity = 86/154 (55.84%), Postives = 106/154 (68.83%), Query Frame = 1
Query:  115 LMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKS 576
            L  +  +L  NP EG  +G IDE + F WE LI GP  T  EGG F A L FP +YPL PP+MKF+++I+HPNI  +G VCISILH PG+D  GYE ++ERW PV +VE IL+SV+SMLA+PNDES ANVDAA  WR+    F     + VRKS
Sbjct:   10 LKKQLAELNKNPVEGFSAGLIDENDIFRWEVLIIGPPDT-LEGGFFKAHLYFPKEYPLRPPRMKFVTEIWHPNIEKNGDVCISILHEPGDDKWGYEKASERWLPVHTVETILISVISMLADPNDESPANVDAAKEWRESYTDFKRKVARCVRKS 162          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Fly
Match: Ubc87F (gene:FBgn0267383 transcript:FBtr0082838)

HSP 1 Score: 174.481 bits (441), Expect = 2.045e-55
Identity = 86/163 (52.76%), Postives = 111/163 (68.10%), Query Frame = 1
Query:   88 IMAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKS 576
            + A   L R +SE   L  +P EG  +G + + + F+WE +I GP  T +EGG F A L FP +YPL PPKMKFI++I+HPNI   G VCISILH PG+D  GYE + ERW PV +VE ILLSV+SML +PNDESAANVDAA  +R++  +F     + VR+S
Sbjct:    4 LQASLLLNRQLSE---LQRHPVEGFSAGLVSDSDIFKWEVVIIGPPDTLYEGGFFKAHLIFPKEYPLRPPKMKFITEIWHPNIDKAGDVCISILHEPGDDKWGYEKAEERWLPVHTVETILLSVISMLTDPNDESAANVDAAKEYRENYAEFKRKVTRCVRRS 163          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Zebrafish
Match: ube2g2 (ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-050417-288])

HSP 1 Score: 283.493 bits (724), Expect = 2.738e-98
Identity = 135/165 (81.82%), Postives = 149/165 (90.30%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNL 585
            MAG ALKRLM+EYKQLTLNPPEGIV+GP++EENFFEWEALI GPE T FEGGVF A LSFP DYPL+PPKMKF  D+FHPNIYPDGRVCISILHAPG+DP GYESSAERWSPVQSVEKILLSVVSMLAEPNDES ANVDA+  WR+DR++FN +A++ VRKSL L
Sbjct:    1 MAGTALKRLMAEYKQLTLNPPEGIVAGPVNEENFFEWEALIMGPEDTCFEGGVFPAILSFPSDYPLSPPKMKFTCDMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWREDREQFNRLAKQIVRKSLGL 165          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Zebrafish
Match: ube2g1a (ubiquitin-conjugating enzyme E2G 1a (UBC7 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-030131-6065])

HSP 1 Score: 178.333 bits (451), Expect = 8.101e-57
Identity = 85/155 (54.84%), Postives = 108/155 (69.68%), Query Frame = 1
Query:  115 LMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQ-KFNDMAEKSVRKS 576
            L  +  +L  NP EG  +G ID+ + + WE LI GP  T +EGGVF A L+FP DYPL PPKMKFI++I+HPN+  +G VCISILH PG D  GYE   ERW P+ +VE I++SV+SMLA+PN +S ANVDAA  WR+DR  +F     + VRKS
Sbjct:   10 LRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRHGEFKRKVARCVRKS 164          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Zebrafish
Match: ube2g1a (ubiquitin-conjugating enzyme E2G 1a (UBC7 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-030131-6065])

HSP 1 Score: 178.333 bits (451), Expect = 8.101e-57
Identity = 85/155 (54.84%), Postives = 108/155 (69.68%), Query Frame = 1
Query:  115 LMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQ-KFNDMAEKSVRKS 576
            L  +  +L  NP EG  +G ID+ + + WE LI GP  T +EGGVF A L+FP DYPL PPKMKFI++I+HPN+  +G VCISILH PG D  GYE   ERW P+ +VE I++SV+SMLA+PN +S ANVDAA  WR+DR  +F     + VRKS
Sbjct:   10 LRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRHGEFKRKVARCVRKS 164          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Zebrafish
Match: ube2g1b (ubiquitin-conjugating enzyme E2G 1b (UBC7 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-2939])

HSP 1 Score: 176.022 bits (445), Expect = 7.255e-56
Identity = 83/158 (52.53%), Postives = 109/158 (68.99%), Query Frame = 1
Query:  115 LMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDD-RQKFNDMAEKSVRKSLNL 585
            L  +  +L  NP EG  +G ID+++ ++WE ++ GP+ T FEGG F A L FP DYPL PPKMKFI++I+HPN+  +G VCISILH PG D  GYE   ERW P+ +VE I++SV+SMLA+PN +S ANVDAA  WRDD   +F     + VRKS  +
Sbjct:    9 LRKQLAELNKNPVEGFSAGLIDDDDIYQWEVVVIGPQDTMFEGGFFKAHLIFPHDYPLRPPKMKFITEIWHPNVAKNGDVCISILHEPGEDKFGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWRDDPNGEFKRKVARCVRKSQEM 166          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Zebrafish
Match: cdc34a (cell division cycle 34 homolog (S. cerevisiae) a [Source:ZFIN;Acc:ZDB-GENE-040426-713])

HSP 1 Score: 153.68 bits (387), Expect = 3.119e-46
Identity = 78/165 (47.27%), Postives = 105/165 (63.64%), Query Frame = 1
Query:   94 AGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAI---TWRDDRQKFNDMAEKSVRKSL 579
              ++ K LM E K L   P EG     +DE + + WE  I GP  T +EGG F AR+ FP+DYP +PP  +F++ ++HPNIY +G VCISILH P +DP   E  +ERW+P Q+V  ILLSV+S+L EPN  S ANVDA++    WRD + K  + AE  +RK +
Sbjct:    9 VASSQKALMLELKSLQDEPVEGFKITLVDESDLYNWEVAIFGPPNTHYEGGYFKARIKFPIDYPYSPPAFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWRDSKGKDREYAE-IIRKQV 172          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Xenopus
Match: ube2g2 (ubiquitin conjugating enzyme E2 G2 [Source:NCBI gene;Acc:549952])

HSP 1 Score: 280.026 bits (715), Expect = 8.391e-97
Identity = 132/165 (80.00%), Postives = 149/165 (90.30%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNL 585
            MAG ALKRLM+EYKQLTLNPPEGIV+GPI+EENFFEWEALI GPE T FE GVF A LSFP+DYPL+PPKM+F  ++FHPNIYPDGRVCISILHAPG+DP GYESSAERWSPVQSVEKILLSVVSMLAEPNDES ANVDA+  WR+DR++FN +A ++V+KSL L
Sbjct:    1 MAGTALKRLMAEYKQLTLNPPEGIVAGPINEENFFEWEALIMGPEDTCFECGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWREDREQFNKIARQTVQKSLGL 165          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Xenopus
Match: ube2g2 (ubiquitin conjugating enzyme E2 G2 [Source:NCBI gene;Acc:549952])

HSP 1 Score: 204.912 bits (520), Expect = 3.179e-67
Identity = 107/165 (64.85%), Postives = 125/165 (75.76%), Query Frame = 1
Query:   94 AGNALKR-LMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNL 585
            +G  LKR  M E  Q+ LN      S  + E  F  +     GPE T FE GVF A LSFP+DYPL+PPKM+F  ++FHPNIYPDGRVCISILHAPG+DP GYESSAERWSPVQSVEKILLSVVSMLAEPNDES ANVDA+  WR+DR++FN +A ++V+KSL L
Sbjct:    1 SGMTLKRRFMLENPQIKLNYNN---SAKMIEVFFILFAC--RGPEDTCFECGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWREDREQFNKIARQTVQKSLGL 160          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Xenopus
Match: ube2g1 (ubiquitin conjugating enzyme E2 G1 [Source:NCBI gene;Acc:394648])

HSP 1 Score: 178.333 bits (451), Expect = 1.232e-56
Identity = 85/155 (54.84%), Postives = 108/155 (69.68%), Query Frame = 1
Query:  115 LMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQ-KFNDMAEKSVRKS 576
            L  +  +L  NP EG  +G ID+ + + WE LI GP  T +EGGVF A L+FP DYPL PPKMKFI++I+HPN+  +G VCISILH PG D  GYE   ERW P+ +VE I++SV+SMLA+PN +S ANVDAA  WR+DR  +F     + VRKS
Sbjct:   10 LRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPRDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKS 164          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Xenopus
Match: ube2g1 (ubiquitin conjugating enzyme E2 G1 [Source:NCBI gene;Acc:394648])

HSP 1 Score: 176.407 bits (446), Expect = 6.832e-56
Identity = 84/151 (55.63%), Postives = 107/151 (70.86%), Query Frame = 1
Query:  127 YKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQ-KFNDMAEKSVRKS 576
            + +L  NP EG  +G ID+ + + WE LI GP  T +EGGVF A L+FP DYPL PPKMKFI++I+HPN+  +G VCISILH PG D  GYE   ERW P+ +VE I++SV+SMLA+PN +S ANVDAA  WR+DR  +F     + VRKS
Sbjct:   13 FAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPRDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKS 163          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Xenopus
Match: ube2r2 (ubiquitin conjugating enzyme E2 R2 [Source:NCBI gene;Acc:780159])

HSP 1 Score: 152.525 bits (384), Expect = 1.154e-45
Identity = 77/161 (47.83%), Postives = 103/161 (63.98%), Query Frame = 1
Query:  109 KRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAI---TWRDDRQKFNDMAEKSVRKSLN 582
            K LM E K L   P EG     +DE + + WE  I GP  T +EGG F A + FP+DYP +PP  +F++ ++HPNIY +G VCISILH P +DP   E  +ERW+P Q+V  ILLSV+S+L EPN  S ANVDA++    WRD + K  + AE  +RK ++
Sbjct:   11 KALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAE-IIRKQVS 170          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Mouse
Match: Ube2g2 (ubiquitin-conjugating enzyme E2G 2 [Source:MGI Symbol;Acc:MGI:1343188])

HSP 1 Score: 275.789 bits (704), Expect = 2.846e-95
Identity = 131/165 (79.39%), Postives = 148/165 (89.70%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNL 585
            MAG ALKRLM+EYKQLTLNPPEGIV+GP++EENFFEWEALI GPE T FE GVF A LSFP+DYPL+PPKM+F  ++FHPNIYPDGRVCISILHAPG+DP GYESSAERWSPVQSVEKILLSVVSMLAEPNDES ANVDA+  WRDDR++F  +A++ V+KSL L
Sbjct:    1 MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL 165          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Mouse
Match: Ube2g1 (ubiquitin-conjugating enzyme E2G 1 [Source:MGI Symbol;Acc:MGI:1914378])

HSP 1 Score: 178.333 bits (451), Expect = 1.030e-56
Identity = 85/155 (54.84%), Postives = 108/155 (69.68%), Query Frame = 1
Query:  115 LMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQ-KFNDMAEKSVRKS 576
            L  +  +L  NP EG  +G ID+ + + WE LI GP  T +EGGVF A L+FP DYPL PPKMKFI++I+HPN+  +G VCISILH PG D  GYE   ERW P+ +VE I++SV+SMLA+PN +S ANVDAA  WR+DR  +F     + VRKS
Sbjct:   10 LRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKS 164          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Mouse
Match: Ube2r2 (ubiquitin-conjugating enzyme E2R 2 [Source:MGI Symbol;Acc:MGI:1914865])

HSP 1 Score: 152.525 bits (384), Expect = 9.027e-46
Identity = 77/161 (47.83%), Postives = 103/161 (63.98%), Query Frame = 1
Query:  109 KRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAI---TWRDDRQKFNDMAEKSVRKSLN 582
            K LM E K L   P EG     +DE + + WE  I GP  T +EGG F A + FP+DYP +PP  +F++ ++HPNIY +G VCISILH P +DP   E  +ERW+P Q+V  ILLSV+S+L EPN  S ANVDA++    WRD + K  + AE  +RK ++
Sbjct:   11 KALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAE-IIRKQVS 170          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Mouse
Match: Cdc34 (cell division cycle 34 [Source:MGI Symbol;Acc:MGI:102657])

HSP 1 Score: 147.132 bits (370), Expect = 1.029e-43
Identity = 76/163 (46.63%), Postives = 102/163 (62.58%), Query Frame = 1
Query:  100 NALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWR-------DDRQKFNDMAEKSV 567
            ++ K L+ E K L   P EG     +DE + + WE  I GP  T +EGG F ARL FP+DYP +PP  +F++ ++HPNIY  G VCISILH P +DP   E  +ERW+P Q+V  ILLSV+S+L EPN  S ANVDA++ +R        DR+ + D+  K V
Sbjct:    8 SSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDRE-YTDIIRKQV 169          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Mouse
Match: Cdc34 (cell division cycle 34 [Source:MGI Symbol;Acc:MGI:102657])

HSP 1 Score: 147.132 bits (370), Expect = 1.029e-43
Identity = 76/163 (46.63%), Postives = 102/163 (62.58%), Query Frame = 1
Query:  100 NALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWR-------DDRQKFNDMAEKSV 567
            ++ K L+ E K L   P EG     +DE + + WE  I GP  T +EGG F ARL FP+DYP +PP  +F++ ++HPNIY  G VCISILH P +DP   E  +ERW+P Q+V  ILLSV+S+L EPN  S ANVDA++ +R        DR+ + D+  K V
Sbjct:    8 SSQKALLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDRE-YTDIIRKQV 169          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. UniProt/SwissProt
Match: sp|Q5RF84|UB2G2_PONAB (Ubiquitin-conjugating enzyme E2 G2 OS=Pongo abelii OX=9601 GN=UBE2G2 PE=2 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 1.991e-94
Identity = 131/165 (79.39%), Postives = 148/165 (89.70%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNL 585
            MAG ALKRLM+EYKQLTLNPPEGIV+GP++EENFFEWEALI GPE T FE GVF A LSFP+DYPL+PPKM+F  ++FHPNIYPDGRVCISILHAPG+DP GYESSAERWSPVQSVEKILLSVVSMLAEPNDES ANVDA+  WRDDR++F  +A++ V+KSL L
Sbjct:    1 MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL 165          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. UniProt/SwissProt
Match: sp|P60605|UB2G2_MOUSE (Ubiquitin-conjugating enzyme E2 G2 OS=Mus musculus OX=10090 GN=Ube2g2 PE=1 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 1.991e-94
Identity = 131/165 (79.39%), Postives = 148/165 (89.70%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNL 585
            MAG ALKRLM+EYKQLTLNPPEGIV+GP++EENFFEWEALI GPE T FE GVF A LSFP+DYPL+PPKM+F  ++FHPNIYPDGRVCISILHAPG+DP GYESSAERWSPVQSVEKILLSVVSMLAEPNDES ANVDA+  WRDDR++F  +A++ V+KSL L
Sbjct:    1 MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL 165          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. UniProt/SwissProt
Match: sp|P60604|UB2G2_HUMAN (Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens OX=9606 GN=UBE2G2 PE=1 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 1.991e-94
Identity = 131/165 (79.39%), Postives = 148/165 (89.70%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNL 585
            MAG ALKRLM+EYKQLTLNPPEGIV+GP++EENFFEWEALI GPE T FE GVF A LSFP+DYPL+PPKM+F  ++FHPNIYPDGRVCISILHAPG+DP GYESSAERWSPVQSVEKILLSVVSMLAEPNDES ANVDA+  WRDDR++F  +A++ V+KSL L
Sbjct:    1 MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSLGL 165          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. UniProt/SwissProt
Match: sp|Q17QG5|UB2G2_BOVIN (Ubiquitin-conjugating enzyme E2 G2 OS=Bos taurus OX=9913 GN=UBE2G2 PE=2 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 2.479e-94
Identity = 131/165 (79.39%), Postives = 148/165 (89.70%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNL 585
            MAG ALKRLM+EYKQLTLNPPEGIV+GP++EENFFEWEALI GPE T FE GVF A LSFP+DYPL+PPKM+F  ++FHPNIYPDGRVCISILHAPG+DP GYESSAERWSPVQSVEKILLSVVSMLAEPNDES ANVDA+  WRDDR++F  +A++ V+KSL L
Sbjct:    1 MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKVAKQIVQKSLGL 165          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. UniProt/SwissProt
Match: sp|O00102|UBC7_SCHPO (Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc7 PE=1 SV=2)

HSP 1 Score: 229.565 bits (584), Expect = 3.659e-76
Identity = 104/161 (64.60%), Postives = 129/161 (80.12%), Query Frame = 1
Query:  103 ALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNL 585
            AL+RLM EYK+LT N P+GI +GP +E++FF W+ LI GP+GTPFEGG++ A L FP DYPL PP +KF  + FHPN+Y DG VCISILHAPG+DP  YESS+ERWSPVQSVEKILLSV+SMLAEPNDES AN+DA   WR+DR+++  +  +  RK+L L
Sbjct:    6 ALRRLMKEYKELTENGPDGITAGPSNEDDFFTWDCLIQGPDGTPFEGGLYPATLKFPSDYPLGPPTLKFECEFFHPNVYKDGTVCISILHAPGDDPNMYESSSERWSPVQSVEKILLSVMSMLAEPNDESGANIDACKMWREDREEYCRVVRRLARKTLGL 166          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. TrEMBL
Match: G7YQQ8 (Ubiquitin-conjugating enzyme E2 G2 OS=Clonorchis sinensis OX=79923 GN=CLF_107529 PE=3 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 5.507e-104
Identity = 142/168 (84.52%), Postives = 159/168 (94.64%), Query Frame = 1
Query:   85 LIMAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNLP 588
            LIMAGNALKRLM+EYKQLT+NPPEGIV+GP+DE+NFFEWEALI GPEGTPFEGGVF ARLSFPMDYPL+PPKM+F++D+FHPNIYPDGRVCISILHAPG+DP GYESS ERWSPVQSVEKILLSVVSMLAEPNDESAANVDAA TWR+D+++FN +A +SVR SL LP
Sbjct:   49 LIMAGNALKRLMAEYKQLTVNPPEGIVAGPVDEKNFFEWEALIAGPEGTPFEGGVFAARLSFPMDYPLSPPKMQFVTDLFHPNIYPDGRVCISILHAPGDDPMGYESSVERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAKTWREDKRRFNKLALRSVRISLGLP 216          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. TrEMBL
Match: A0A4V3SGD7 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002350 PE=3 SV=1)

HSP 1 Score: 309.301 bits (791), Expect = 6.786e-104
Identity = 142/168 (84.52%), Postives = 159/168 (94.64%), Query Frame = 1
Query:   85 LIMAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNLP 588
            LIMAGNALKRLM+EYKQLT+NPPEGIV+GP+DE+NFFEWEALI GPEGTPFEGGVF ARLSFPMDYPL+PPKM+F++D+FHPNIYPDGRVCISILHAPG+DP GYESS ERWSPVQSVEKILLSVVSMLAEPNDESAANVDAA TWR+D+++FN +A +SVR SL LP
Sbjct:   58 LIMAGNALKRLMAEYKQLTVNPPEGIVAGPVDEKNFFEWEALIAGPEGTPFEGGVFAARLSFPMDYPLSPPKMQFVTDLFHPNIYPDGRVCISILHAPGDDPMGYESSVERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAKTWREDKRRFNKLALRSVRISLGLP 225          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. TrEMBL
Match: A0A4S2M6V9 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002350 PE=3 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 1.271e-103
Identity = 142/168 (84.52%), Postives = 159/168 (94.64%), Query Frame = 1
Query:   85 LIMAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNLP 588
            LIMAGNALKRLM+EYKQLT+NPPEGIV+GP+DE+NFFEWEALI GPEGTPFEGGVF ARLSFPMDYPL+PPKM+F++D+FHPNIYPDGRVCISILHAPG+DP GYESS ERWSPVQSVEKILLSVVSMLAEPNDESAANVDAA TWR+D+++FN +A +SVR SL LP
Sbjct:   58 LIMAGNALKRLMAEYKQLTVNPPEGIVAGPVDEKNFFEWEALIAGPEGTPFEGGVFAARLSFPMDYPLSPPKMQFVTDLFHPNIYPDGRVCISILHAPGDDPMGYESSVERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAKTWREDKRRFNKLALRSVRISLGLP 225          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. TrEMBL
Match: A0A4S2M6L9 (UBIQUITIN_CONJUGAT_2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002350 PE=3 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 2.724e-102
Identity = 140/166 (84.34%), Postives = 157/166 (94.58%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNLP 588
            MAGNALKRLM+EYKQLT+NPPEGIV+GP+DE+NFFEWEALI GPEGTPFEGGVF ARLSFPMDYPL+PPKM+F++D+FHPNIYPDGRVCISILHAPG+DP GYESS ERWSPVQSVEKILLSVVSMLAEPNDESAANVDAA TWR+D+++FN +A +SVR SL LP
Sbjct:    1 MAGNALKRLMAEYKQLTVNPPEGIVAGPVDEKNFFEWEALIAGPEGTPFEGGVFAARLSFPMDYPLSPPKMQFVTDLFHPNIYPDGRVCISILHAPGDDPMGYESSVERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAKTWREDKRRFNKLALRSVRISLGLP 166          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. TrEMBL
Match: A0A4E0R980 (Ubiquitin-conjugating enzyme OS=Fasciola hepatica OX=6192 GN=D915_006504 PE=3 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 1.364e-100
Identity = 138/166 (83.13%), Postives = 156/166 (93.98%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNLP 588
            MAGNALKRL++EYKQLT+NPPEGIV+GPIDE+NFFEWEALI GPEGTPFEGGVF ARLSFPMDYPL+PPKM+F++++FHPNIYPDGRVCISILHAPG+DP GYES  ERWSPVQSVEKILLSVVSMLAEPNDESAANVDAA TWR+D+++FN +A +SVR SL LP
Sbjct:    1 MAGNALKRLLAEYKQLTVNPPEGIVAGPIDEKNFFEWEALIAGPEGTPFEGGVFAARLSFPMDYPLSPPKMQFVTELFHPNIYPDGRVCISILHAPGDDPMGYESPVERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAKTWREDKRRFNKLALRSVRLSLGLP 166          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Cavefish
Match: ube2g2 (ubiquitin conjugating enzyme E2 G2 [Source:NCBI gene;Acc:103032398])

HSP 1 Score: 283.493 bits (724), Expect = 2.013e-98
Identity = 135/165 (81.82%), Postives = 149/165 (90.30%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNL 585
            MAG ALKRLM+EYKQLTLNPPEGIV+GP++EENFFEWEALI GPE T FEGGVF A LSFP DYPL+PPKMKF  D+FHPNIYPDGRVCISILHAPG+DP GYESSAERWSPVQSVEKILLSVVSMLAEPNDES ANVDA+  WR+DR++FN +A++ VRKSL L
Sbjct:    1 MAGTALKRLMAEYKQLTLNPPEGIVAGPVNEENFFEWEALIMGPEDTCFEGGVFPAVLSFPSDYPLSPPKMKFTCDMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWREDREQFNRLAKQIVRKSLGL 165          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Cavefish
Match: ube2g2 (ubiquitin conjugating enzyme E2 G2 [Source:NCBI gene;Acc:103032398])

HSP 1 Score: 243.432 bits (620), Expect = 1.060e-82
Identity = 121/165 (73.33%), Postives = 133/165 (80.61%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNL 585
            MAG ALKRLM+EYK+                ENFFEWEALI GPE T FEGGVF A LSFP DYPL+PPKMKF  D+FHPNIYPDGRVCISILHAPG+DP GYESSAERWSPVQSVEKILLSVVSMLAEPNDES ANVDA+  WR+DR++FN +A++ VRKSL L
Sbjct:    1 MAGTALKRLMAEYKRKQ------------TPENFFEWEALIMGPEDTCFEGGVFPAVLSFPSDYPLSPPKMKFTCDMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWREDREQFNRLAKQIVRKSLGL 153          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Cavefish
Match: ube2g1a (ubiquitin conjugating enzyme E2 G1 [Source:NCBI gene;Acc:103024540])

HSP 1 Score: 178.333 bits (451), Expect = 6.865e-57
Identity = 85/155 (54.84%), Postives = 108/155 (69.68%), Query Frame = 1
Query:  115 LMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQ-KFNDMAEKSVRKS 576
            L  +  +L  NP EG  +G ID+ + + WE LI GP  T +EGGVF A L+FP DYPL PPKMKFI++I+HPN+  +G VCISILH PG D  GYE   ERW P+ +VE I++SV+SMLA+PN +S ANVDAA  WR+DR  +F     + VRKS
Sbjct:   10 LRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRHGEFKRKVARCVRKS 164          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Cavefish
Match: ube2g1a (ubiquitin conjugating enzyme E2 G1 [Source:NCBI gene;Acc:103024540])

HSP 1 Score: 176.792 bits (447), Expect = 3.986e-56
Identity = 84/151 (55.63%), Postives = 107/151 (70.86%), Query Frame = 1
Query:  127 YKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQ-KFNDMAEKSVRKS 576
            + +L  NP EG  +G ID+ + + WE LI GP  T +EGGVF A L+FP DYPL PPKMKFI++I+HPN+  +G VCISILH PG D  GYE   ERW P+ +VE I++SV+SMLA+PN +S ANVDAA  WR+DR  +F     + VRKS
Sbjct:   20 FLKLNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRHGEFKRKVARCVRKS 170          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Cavefish
Match: ube2g1b (ubiquitin-conjugating enzyme E2 G1-like [Source:NCBI gene;Acc:103023394])

HSP 1 Score: 173.711 bits (439), Expect = 4.186e-55
Identity = 82/158 (51.90%), Postives = 109/158 (68.99%), Query Frame = 1
Query:  115 LMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDD-RQKFNDMAEKSVRKSLNL 585
            L  +  +L  NP EG  +G ID+++ ++WE ++ GP  T FEGG F A L+FP DYPL PPKMKFI++I+HPN+  +G VCISILH PG D  GYE   ERW P+ +VE I++SV+SMLA+PN +S ANVDAA  WR+D   +F     + VRKS  +
Sbjct:    9 LRKQLAELNKNPVEGFSAGLIDDDDIYQWEVVVIGPPDTLFEGGFFKANLTFPQDYPLRPPKMKFITEIWHPNVAKNGDVCISILHEPGEDKFGYEKPEERWLPIHTVETIMISVISMLADPNSDSPANVDAAKEWREDPNGEFKRKVARCVRKSQEM 166          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Sea Lamprey
Match: ube2g2 (ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-050417-288])

HSP 1 Score: 233.417 bits (594), Expect = 1.217e-79
Identity = 110/139 (79.14%), Postives = 124/139 (89.21%), Query Frame = 1
Query:  169 GPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNL 585
            GP+DEENFFEWEALI GPEGT FEGGVF A L+FP DYPL+PPKM+F  ++FHPNIYPDGRVCISILHAPG+DP GYESSAERWSPVQSVEKILLSVVSMLAEPNDES ANVDA+  WR+DR++F  +A ++VRKSL L
Sbjct:    1 GPVDEENFFEWEALIMGPEGTCFEGGVFPAVLTFPPDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWREDREQFYRIAHQTVRKSLGL 139          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008817.1 (pep scaffold:Pmarinus_7.0:GL476329:1748443:1760143:-1 gene:ENSPMAG00000007968.1 transcript:ENSPMAT00000008817.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.487 bits (319), Expect = 8.654e-38
Identity = 67/162 (41.36%), Postives = 92/162 (56.79%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKS 576
            M+  A +RLM ++K+L  +PP G VSG   E N   W A+I GPEGTPFE G F   L F  +YP  PP +KF+S +FHPN+Y DG +C+ IL               RWSP   V  IL S+ S+L EPN  S AN  AA  ++++++++       V +S
Sbjct:    1 MSTPARRRLMRDFKRLQEDPPAG-VSGAPSENNIMLWNAVIFGPEGTPFEDGTFKLTLEFTEEYPNKPPTVKFVSKMFHPNVYADGSICLDILQ-------------NRWSPTYDVSSILTSIQSLLDEPNPNSPANSLAAQLYQENKREYEKKVSAVVEQS 148          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000634.1 (pep scaffold:Pmarinus_7.0:GL483316:3187:7493:1 gene:ENSPMAG00000000571.1 transcript:ENSPMAT00000000634.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.546 bits (288), Expect = 3.046e-33
Identity = 55/110 (50.00%), Postives = 78/110 (70.91%), Query Frame = 1
Query:  256 ARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAI---TWRDDR---QKFNDMAEKSV 567
            A++ FP DYP +PP  +F++ ++HPNIY +G VCISILH P +DP   E ++ERW+P QSV  ILLSV+S+L EPN  S ANVDA++    WRD +   +++ D+ +K V
Sbjct:    1 AQMKFPKDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELASERWNPTQSVRTILLSVISLLNEPNTYSPANVDASVMYRKWRDSKGRDKEYADIIKKQV 110          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010378.1 (pep scaffold:Pmarinus_7.0:GL477318:26908:31295:-1 gene:ENSPMAG00000009396.1 transcript:ENSPMAT00000010378.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.161 bits (287), Expect = 4.695e-33
Identity = 53/153 (34.64%), Postives = 87/153 (56.86%), Query Frame = 1
Query:  109 KRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSV 567
            + L  E   L  +PP    +GP+ ++  F W+A I GP  +P++GGVF   + FP DYP  PPK+ F + I+HPNI  +G +C+ IL +             +WSP  ++ K+LLS+ S+L +PN +     + A  ++ DR K+N +A +++
Sbjct:    5 RPLHQELNDLGRDPPAQCSAGPVGDD-LFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRS-------------QWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNKLARETI 143          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006211.1 (pep scaffold:Pmarinus_7.0:GL476897:3176:4886:1 gene:ENSPMAG00000005612.1 transcript:ENSPMAT00000006211.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.775 bits (286), Expect = 5.449e-33
Identity = 59/150 (39.33%), Postives = 83/150 (55.33%), Query Frame = 1
Query:  127 YKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKS 576
            + +L  +PP G VSG   E N   W A+I GPEGTPFE G F   + F  +YP  PP ++F+S +FHPN+Y DG +C+ IL               RWSP   V  IL S+ S+L EPN  S AN  AA  ++++++++       V +S
Sbjct:    1 FSRLQEDPPAG-VSGAPTENNIMVWNAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGSICLDILQ-------------NRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKKVSAIVEQS 136          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Yeast
Match: UBC7 (Ubiquitin conjugating enzyme; involved in the ER-associated protein degradation (ERAD) pathway and in the inner nuclear membrane-associated degradation (INMAD) pathway; requires Cue1p for recruitment to the ER membrane; proposed to be involved in chromatin assembly [Source:SGD;Acc:S000004624])

HSP 1 Score: 206.838 bits (525), Expect = 4.312e-69
Identity = 98/163 (60.12%), Postives = 119/163 (73.01%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSL 579
            M+  A KRL+ E +QL  + P GIV+GP  E N F W+ LI GP  TP+  GVF A+L FP DYPL+PPK+ F   I HPNIYP+G VCISILH+PG+DP  YE + ERWSPVQSVEKILLSV+SML+EPN ES AN+DA I WRD+R +F    + S+ KSL
Sbjct:    1 MSKTAQKRLLKELQQLIKDSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRPEFERQVKLSILKSL 163          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Yeast
Match: CDC34 (Ubiquitin-conjugating enzyme (E2); catalytic subunit of SCF ubiquitin-protein ligase complex (together with Skp1p, Rbx1p, Cdc53p, and an F-box protein) that regulates cell cycle progression by targeting key substrates for degradation; protein abundance increases in response to DNA replication stress; human CDC34 functionally complements the thermosensitivity of the cdc34-2 mutant [Source:SGD;Acc:S000002461])

HSP 1 Score: 133.265 bits (334), Expect = 1.179e-38
Identity = 68/158 (43.04%), Postives = 102/158 (64.56%), Query Frame = 1
Query:  115 LMSEYKQLTLNPPEGIVSGPI---DEENFFEWE-ALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKS 576
            L+ +Y++LT +P + I S  I   D+ N F W   ++   E + + GG F A++ FP D+P +PP+ +F   I+HPN+Y DGR+CISILH  G DP   E  AE WSPVQ+VE +L+S+VS+L +PN  S ANVDAA+ +R + +++    +  V +S
Sbjct:   12 LLRQYRELT-DPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSG-DPMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVKMEVERS 167          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Yeast
Match: RAD6 (Ubiquitin-conjugating enzyme (E2); involved in postreplication repair as a heterodimer with Rad18p, regulation of K63 polyubiquitination in response to oxidative stress, DSBR and checkpoint control as a heterodimer with Bre1p, ubiquitin-mediated N-end rule protein degradation as a heterodimer with Ubr1p, ERAD with Ubr1p in the absence of canonical ER membrane ligases, and Rpn4p turnover as part of proteasome homeostasis, in complex with Ubr2p and Mub1p [Source:SGD;Acc:S000003026])

HSP 1 Score: 118.242 bits (295), Expect = 3.493e-34
Identity = 58/162 (35.80%), Postives = 93/162 (57.41%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKS 576
            M+  A +RLM ++K++  + P G+ + P+  +N   W A+I GP  TP+E G F   L F  +YP  PP +KF+S++FHPN+Y +G +C+ IL               RW+P   V  IL S+ S+  +PN  S ANV+AA  ++D + ++    +++V KS
Sbjct:    1 MSTPARRRLMRDFKRMKEDAPPGVSASPL-PDNVMVWNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYANGEICLDILQ-------------NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYVKRVKETVEKS 148          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Yeast
Match: UBC11 (Ubiquitin-conjugating enzyme; most similar in sequence to Xenopus ubiquitin-conjugating enzyme E2-C, but not a true functional homolog of this E2; unlike E2-C, not required for the degradation of mitotic cyclin Clb2 [Source:SGD;Acc:S000005866])

HSP 1 Score: 110.538 bits (275), Expect = 1.882e-31
Identity = 57/150 (38.00%), Postives = 82/150 (54.67%), Query Frame = 1
Query:   94 AGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKF 543
             G   KRL +E  QL  +  E I + P+D+ +   W   I GP+ TP+ G  F   L FP +YP +PP +KF+S ++HPN+   G +C+ IL              E+WS V +VE ILLS+ S+L EPN+ S  N  AA  W  D +++
Sbjct:    6 GGCVTKRLQNELLQLLSSTTESISAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFLSPMWHPNVDKSGNICLDILK-------------EKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWDADMEEY 142          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Yeast
Match: UBC4 (Ubiquitin-conjugating enzyme (E2); key E2 partner with Ubc1p for the anaphase-promoting complex (APC); mediates degradation of abnormal or excess proteins, including calmodulin and histone H3; regulates levels of DNA Polymerase-{alpha} to promote efficient and accurate DNA replication; interacts with many SCF ubiquitin protein ligases; component of the cellular stress response; UBC4 has a paralog, UBC5, that arose from the whole genome duplication [Source:SGD;Acc:S000000286])

HSP 1 Score: 108.997 bits (271), Expect = 7.494e-31
Identity = 52/155 (33.55%), Postives = 84/155 (54.19%), Query Frame = 1
Query:  109 KRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRK 573
            KR+  E   L  +PP    +GP+ ++  + W+A I GP  +P+ GGVF   + FP DYP  PPK+ F + I+HPNI  +G +C+ IL              ++WSP  ++ K+LLS+ S+L + N +     + A  ++ DR K+   A +  +K
Sbjct:    5 KRIAKELSDLERDPPTSCSAGPVGDD-LYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINANGNICLDIL-------------KDQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRPKYEATAREWTKK 145          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Nematostella
Match: EDO48919 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHV4])

HSP 1 Score: 285.034 bits (728), Expect = 1.674e-99
Identity = 131/165 (79.39%), Postives = 150/165 (90.91%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNL 585
            MAG ALKRLM+EYKQLT+NPPEGI++GP+ EENFFEWEALI GPEGTPFEGGVFT RL FP DYPL+PPKM+F+ ++FHPN+YPDGRVCISILHAPG+DP GYESSAERWSPVQSVEKILLSV+SMLAEPNDES ANVDA+  WR++R +FND+A + VRKSL L
Sbjct:    1 MAGAALKRLMAEYKQLTVNPPEGIIAGPLTEENFFEWEALISGPEGTPFEGGVFTTRLVFPPDYPLSPPKMRFVGEMFHPNVYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVISMLAEPNDESGANVDASKMWRENRDQFNDIAHQIVRKSLGL 165          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Nematostella
Match: EDO39867 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8Q9])

HSP 1 Score: 171.014 bits (432), Expect = 2.209e-54
Identity = 81/165 (49.09%), Postives = 107/165 (64.85%), Query Frame = 1
Query:   94 AGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDD-RQKFNDMAEKSVRKSLNL 585
            A  A   L  +  +L   P EG  +G  D+E+ ++WE ++ GP GT +E G F A + FP +YP  PP + FISDI+HPN++ +G VCISILH PG D  GYE + ERW P+ +VE I+LSV+SMLAEPNDES ANVDAA  WR++    F    +  VRKS + 
Sbjct:    4 ADQAALLLRRQLMELQKKPVEGFSAGLFDDEDLYKWEIMVVGPPGTYYEEGYFKASMVFPKEYPQRPPTLTFISDIWHPNVHKNGEVCISILHEPGEDKYGYEKADERWRPIHTVETIMLSVISMLAEPNDESPANVDAAKEWREEYTTTFKKKVKACVRKSQDF 168          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Nematostella
Match: EDO31189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYN0])

HSP 1 Score: 154.451 bits (389), Expect = 3.919e-47
Identity = 79/166 (47.59%), Postives = 107/166 (64.46%), Query Frame = 1
Query:   94 AGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAI---TWRDDRQKFNDMAEKSVRKSLN 582
            + +A++ L  E K+LT  P EG      DE N FEW+  I GP GT + GG F A +SFP DYP +PP  +F++ ++HPNIY  G VCISILH P +DP   E  +ERW+P Q+V  ILLSV+S+L EPN  S ANVDA++    WR+ + K ++  EK +RK + 
Sbjct:    6 SSSAVRALQLELKKLTEEPVEGFTVEVPDESNTFEWDVAIFGPPGTLYAGGYFKAHMSFPHDYPYSPPTFRFLTKMWHPNIYESGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRETKGKDSEY-EKIIRKQVQ 170          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Nematostella
Match: EDO43669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXR8])

HSP 1 Score: 126.331 bits (316), Expect = 3.565e-37
Identity = 59/157 (37.58%), Postives = 95/157 (60.51%), Query Frame = 1
Query:  103 ALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRK 573
            ALKR+  E + L  +PP    +GP+ ++  F W+A I GP  +P++GGVF   + FP DYP  PPK+ F + I+HPNI  +G +C+ IL +             +WSP  ++ K+LLS+ S++ +PN +     + A +++ DR+K+NDMA++  RK
Sbjct:    2 ALKRINKELQDLGRDPPAQCSAGPVGDD-LFHWQATIMGPADSPYQGGVFFLTIHFPTDYPFKPPKVSFTTKIYHPNINSNGSICLDILRS-------------QWSPALTISKVLLSICSLMDDPNPDDPLVPEIARSFKTDRKKYNDMAKEWTRK 144          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Nematostella
Match: EDO48426 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJU1])

HSP 1 Score: 106.686 bits (265), Expect = 1.908e-29
Identity = 60/166 (36.14%), Postives = 86/166 (51.81%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEE----NFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKS 576
            M+G AL RL  E K    + P G V+ P+  E    N   WE  I G +GTP+E G +  R+ F  DYP  PPK KF   IFHPN+YP G VC+S+L              + W P  ++++ILL +  +L +PN +  A  +A   +  +R ++    EK VR+ 
Sbjct:    1 MSGIALGRLAEERKAWRKDHPFGFVAKPVKNEDGSLNLMNWECAIPGKKGTPWENGKYMLRMIFKDDYPSTPPKCKFEPPIFHPNVYPSGTVCLSLL-----------DEEKDWRPAVTIKQILLGIQDLLNDPNIKDPAQAEAYTIYCQNRAEY----EKRVRQQ 151          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Medaka
Match: ube2g2 (ubiquitin conjugating enzyme E2 G2 [Source:NCBI gene;Acc:101158984])

HSP 1 Score: 284.263 bits (726), Expect = 6.882e-97
Identity = 134/165 (81.21%), Postives = 148/165 (89.70%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNL 585
            MAG ALKRLM+EYKQLTLNPPEGIV+GP +EENFFEWEALI GPE T FEGGVF A LSFP DYPL+PPKM+F  D+FHPNIYPDGRVCISILHAPG+DP GYESSAERWSPVQSVEKILLSVVSMLAEPNDES ANVDA+  WR+DR++FN +A+K VR+SL L
Sbjct:  122 MAGTALKRLMAEYKQLTLNPPEGIVAGPANEENFFEWEALIMGPEDTCFEGGVFPAVLSFPSDYPLSPPKMRFTCDMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWREDREQFNKLAQKIVRRSLGL 286          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Medaka
Match: ube2g2 (ubiquitin conjugating enzyme E2 G2 [Source:NCBI gene;Acc:101158984])

HSP 1 Score: 253.832 bits (647), Expect = 8.160e-87
Identity = 123/165 (74.55%), Postives = 140/165 (84.85%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNL 585
            MAG ALKRLM+EYK+ ++       +GP +EENFFEWEALI GPE T FEGGVF A LSFP DYPL+PPKM+F  D+FHPNIYPDGRVCISILHAPG+DP GYESSAERWSPVQSVEKILLSVVSMLAEPNDES ANVDA+  WR+DR++FN +A+K VR+SL L
Sbjct:    1 MAGTALKRLMAEYKRDSVGS-----AGPANEENFFEWEALIMGPEDTCFEGGVFPAVLSFPSDYPLSPPKMRFTCDMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWREDREQFNKLAQKIVRRSLGL 160          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Medaka
Match: ube2g1a (ubiquitin conjugating enzyme E2 G1 [Source:NCBI gene;Acc:101169134])

HSP 1 Score: 177.948 bits (450), Expect = 9.777e-57
Identity = 85/155 (54.84%), Postives = 107/155 (69.03%), Query Frame = 1
Query:  115 LMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQ-KFNDMAEKSVRKS 576
            L  +  +L  NP EG  +G I++ + + WE LI GP  T +EGGVF A L+FP DYPL PPKMKFI+DI+HPN+  +G VCISILH PG D  GYE   ERW P+ +VE I++SV+SMLA+PN +S ANVDAA  WR+DR   F     + VRKS
Sbjct:   10 LRRQLAELNKNPVEGFSAGLIEDSDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITDIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRHGAFKRKVARCVRKS 164          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Medaka
Match: ube2g1a (ubiquitin conjugating enzyme E2 G1 [Source:NCBI gene;Acc:101169134])

HSP 1 Score: 177.563 bits (449), Expect = 1.796e-56
Identity = 85/157 (54.14%), Postives = 108/157 (68.79%), Query Frame = 1
Query:  109 KRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQ-KFNDMAEKSVRKS 576
            ++  S +  L  NP EG  +G I++ + + WE LI GP  T +EGGVF A L+FP DYPL PPKMKFI+DI+HPN+  +G VCISILH PG D  GYE   ERW P+ +VE I++SV+SMLA+PN +S ANVDAA  WR+DR   F     + VRKS
Sbjct:   10 QKTQSSFGILNKNPVEGFSAGLIEDSDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITDIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRHGAFKRKVARCVRKS 166          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Medaka
Match: ENSORLT00000046557.1 (ubiquitin-conjugating enzyme E2 G1 [Source:NCBI gene;Acc:101161315])

HSP 1 Score: 176.022 bits (445), Expect = 6.110e-56
Identity = 83/158 (52.53%), Postives = 110/158 (69.62%), Query Frame = 1
Query:  115 LMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDD-RQKFNDMAEKSVRKSLNL 585
            L  +  +L  NP EG  +G ID+++ ++WE +I GP+ T FEGG F A L+FP DYPL PPKMKFI++I+HPN+  +G VCISILH PG D  GYE   ERW P+ +VE I++SV+SMLA+PN +S ANVDAA  WR+D   +F     + VRKS  +
Sbjct:    9 LRKQLAELNKNPVEGFSAGLIDDDDIYKWEVVIIGPQDTLFEGGFFKAYLTFPYDYPLRPPKMKFITEIWHPNVAKNGDVCISILHEPGEDKFGYEKPEERWLPIHTVETIMISVISMLADPNSDSPANVDAAKEWREDPNGEFKKKVARCVRKSQEM 166          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Planmine SMEST
Match: SMESG000015438.1 (SMESG000015438.1)

HSP 1 Score: 347.821 bits (891), Expect = 5.550e-124
Identity = 168/168 (100.00%), Postives = 168/168 (100.00%), Query Frame = 1
Query:   91 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNLPIC 594
            MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNLPIC
Sbjct:    1 MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKSLNLPIC 168          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Planmine SMEST
Match: SMESG000003121.1 (SMESG000003121.1)

HSP 1 Score: 169.474 bits (428), Expect = 1.694e-53
Identity = 81/154 (52.60%), Postives = 105/154 (68.18%), Query Frame = 1
Query:  115 LMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRKS 576
            L  +  +L  N  EG  +G +D+EN F+W+ LI GP  T +EGG F A L FP DYP +PPKM+FI++I+HPNI   G VCISILH PG D  GYE   ERW PV +VE I+ SV+SMLAEPN +S ANVDAA  +R++  +F    ++ VR+S
Sbjct:   11 LQKQLAELNKNGSEGFSAGLVDDENIFKWQVLIIGPPDTLYEGGYFKAELDFPKDYPNHPPKMRFITEIWHPNIGSSGEVCISILHEPGEDRYGYEKPEERWLPVHTVETIITSVISMLAEPNADSPANVDAAKDFRENFSEFKRKVQRCVRRS 164          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Planmine SMEST
Match: SMESG000059645.1 (SMESG000059645.1)

HSP 1 Score: 164.466 bits (415), Expect = 1.553e-50
Identity = 76/141 (53.90%), Postives = 101/141 (71.63%), Query Frame = 1
Query:  103 ALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWR 525
            ++K L  E K+L  NP EG +   + ++N FEW+  I GP  T +EGG F A L+FP DYP +PP MKFI+ +FHPNI+ +G VCISILH PG+DP   E  +ERW+P Q+V  ILLSV+SML EPN  SAA+VDA++++R
Sbjct:    8 SIKTLQKELKELKENPVEGFIVDLLSDDNLFEWQVAIFGPPKTLYEGGYFKAVLNFPCDYPYSPPSMKFITKMFHPNIFENGDVCISILHTPGDDPQSGELPSERWNPTQNVRTILLSVISMLNEPNINSAAHVDASVSFR 148          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Planmine SMEST
Match: SMESG000064169.1 (SMESG000064169.1)

HSP 1 Score: 127.102 bits (318), Expect = 3.147e-37
Identity = 60/157 (38.22%), Postives = 92/157 (58.60%), Query Frame = 1
Query:  103 ALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRK 573
            ALKR+  E + L  +PP    +GP+  E+ F W+A I GP  +P++GGVF   + FP DYP  PPK+ F + I+HPNI  +G +C+ IL               +WSP  ++ K+LLS+ S+L +PN +     + A  +++DR+K+ND A+   RK
Sbjct:    2 ALKRIGRELQDLAKDPPAQCSAGPM-HEDLFHWQATIMGPNDSPYDGGVFFLDIQFPTDYPFKPPKVTFTTKIYHPNINANGSICLDILRG-------------QWSPALTISKVLLSICSLLTDPNPDDPLVPEIARIYKNDRKKYNDTAQDWTRK 144          
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Planmine SMEST
Match: SMESG000063640.1 (SMESG000063640.1)

HSP 1 Score: 124.79 bits (312), Expect = 2.490e-36
Identity = 60/157 (38.22%), Postives = 90/157 (57.32%), Query Frame = 1
Query:  103 ALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFEGGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDPTGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQKFNDMAEKSVRK 573
            ALKR+ +E K L  +PP    +GP  E +   W A I GP  +P+EGG+F+  + FP DYP  PP +KF + IFHPNI  +G +C+ IL               +WSP  ++ K+LLS+ S+L +PN +   + +AA  ++ DR+KF++ A     K
Sbjct:    2 ALKRIQTELKSLMTDPPAQCSAGP-KESDLVHWSATIMGPADSPYEGGIFSLSIEFPPDYPFKPPMVKFDTKIFHPNINSNGSICLDILKG-------------QWSPALTISKVLLSICSLLCDPNADDPLDSNAANLYKKDRKKFDETARSWTMK 144          
The following BLAST results are available for this feature:
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UBE2G24.146e-9579.39ubiquitin conjugating enzyme E2 G2 [Source:HGNC Sy... [more]
UBE2G21.144e-7477.37ubiquitin conjugating enzyme E2 G2 [Source:HGNC Sy... [more]
UBE2G11.500e-5654.84ubiquitin conjugating enzyme E2 G1 [Source:HGNC Sy... [more]
UBE2R21.315e-4547.83ubiquitin conjugating enzyme E2 R2 [Source:HGNC Sy... [more]
CDC341.591e-4346.63cell division cycle 34 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ubc-143.729e-8973.49UBiquitin Conjugating enzyme [Source:UniProtKB/Tr... [more]
ubc-73.308e-5150.96Probable ubiquitin-conjugating enzyme E2 7 [Sourc... [more]
ubc-32.307e-4344.24UBiquitin Conjugating enzyme [Source:UniProtKB/Tr... [more]
ubc-32.307e-4344.24UBiquitin Conjugating enzyme [Source:UniProtKB/Tr... [more]
ubc-13.783e-3741.36Ubiquitin-conjugating enzyme E2 1 [Source:UniProt... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ubc75.912e-9779.52gene:FBgn0267384 transcript:FBtr0340157[more]
Ubc75.912e-9779.52gene:FBgn0267384 transcript:FBtr0074283[more]
CG400452.733e-5855.84gene:FBgn0058045 transcript:FBtr0111163[more]
CG400451.563e-5655.84gene:FBgn0058045 transcript:FBtr0331586[more]
Ubc87F2.045e-5552.76gene:FBgn0267383 transcript:FBtr0082838[more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2g22.738e-9881.82ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, ... [more]
ube2g1a8.101e-5754.84ubiquitin-conjugating enzyme E2G 1a (UBC7 homolog,... [more]
ube2g1a8.101e-5754.84ubiquitin-conjugating enzyme E2G 1a (UBC7 homolog,... [more]
ube2g1b7.255e-5652.53ubiquitin-conjugating enzyme E2G 1b (UBC7 homolog,... [more]
cdc34a3.119e-4647.27cell division cycle 34 homolog (S. cerevisiae) a [... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2g28.391e-9780.00ubiquitin conjugating enzyme E2 G2 [Source:NCBI ge... [more]
ube2g23.179e-6764.85ubiquitin conjugating enzyme E2 G2 [Source:NCBI ge... [more]
ube2g11.232e-5654.84ubiquitin conjugating enzyme E2 G1 [Source:NCBI ge... [more]
ube2g16.832e-5655.63ubiquitin conjugating enzyme E2 G1 [Source:NCBI ge... [more]
ube2r21.154e-4547.83ubiquitin conjugating enzyme E2 R2 [Source:NCBI ge... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ube2g22.846e-9579.39ubiquitin-conjugating enzyme E2G 2 [Source:MGI Sym... [more]
Ube2g11.030e-5654.84ubiquitin-conjugating enzyme E2G 1 [Source:MGI Sym... [more]
Ube2r29.027e-4647.83ubiquitin-conjugating enzyme E2R 2 [Source:MGI Sym... [more]
Cdc341.029e-4346.63cell division cycle 34 [Source:MGI Symbol;Acc:MGI:... [more]
Cdc341.029e-4346.63cell division cycle 34 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RF84|UB2G2_PONAB1.991e-9479.39Ubiquitin-conjugating enzyme E2 G2 OS=Pongo abelii... [more]
sp|P60605|UB2G2_MOUSE1.991e-9479.39Ubiquitin-conjugating enzyme E2 G2 OS=Mus musculus... [more]
sp|P60604|UB2G2_HUMAN1.991e-9479.39Ubiquitin-conjugating enzyme E2 G2 OS=Homo sapiens... [more]
sp|Q17QG5|UB2G2_BOVIN2.479e-9479.39Ubiquitin-conjugating enzyme E2 G2 OS=Bos taurus O... [more]
sp|O00102|UBC7_SCHPO3.659e-7664.60Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosa... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YQQ85.507e-10484.52Ubiquitin-conjugating enzyme E2 G2 OS=Clonorchis s... [more]
A0A4V3SGD76.786e-10484.52UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
A0A4S2M6V91.271e-10384.52UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
A0A4S2M6L92.724e-10284.34UBIQUITIN_CONJUGAT_2 domain-containing protein OS=... [more]
A0A4E0R9801.364e-10083.13Ubiquitin-conjugating enzyme OS=Fasciola hepatica ... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2g22.013e-9881.82ubiquitin conjugating enzyme E2 G2 [Source:NCBI ge... [more]
ube2g21.060e-8273.33ubiquitin conjugating enzyme E2 G2 [Source:NCBI ge... [more]
ube2g1a6.865e-5754.84ubiquitin conjugating enzyme E2 G1 [Source:NCBI ge... [more]
ube2g1a3.986e-5655.63ubiquitin conjugating enzyme E2 G1 [Source:NCBI ge... [more]
ube2g1b4.186e-5551.90ubiquitin-conjugating enzyme E2 G1-like [Source:NC... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2g21.217e-7979.14ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, ... [more]
ENSPMAT00000008817.18.654e-3841.36pep scaffold:Pmarinus_7.0:GL476329:1748443:1760143... [more]
ENSPMAT00000000634.13.046e-3350.00pep scaffold:Pmarinus_7.0:GL483316:3187:7493:1 gen... [more]
ENSPMAT00000010378.14.695e-3334.64pep scaffold:Pmarinus_7.0:GL477318:26908:31295:-1 ... [more]
ENSPMAT00000006211.15.449e-3339.33pep scaffold:Pmarinus_7.0:GL476897:3176:4886:1 gen... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
UBC74.312e-6960.12Ubiquitin conjugating enzyme; involved in the ER-a... [more]
CDC341.179e-3843.04Ubiquitin-conjugating enzyme (E2); catalytic subun... [more]
RAD63.493e-3435.80Ubiquitin-conjugating enzyme (E2); involved in pos... [more]
UBC111.882e-3138.00Ubiquitin-conjugating enzyme; most similar in sequ... [more]
UBC47.494e-3133.55Ubiquitin-conjugating enzyme (E2); key E2 partner ... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO489191.674e-9979.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398672.209e-5449.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311893.919e-4747.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436693.565e-3737.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484261.908e-2936.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ube2g26.882e-9781.21ubiquitin conjugating enzyme E2 G2 [Source:NCBI ge... [more]
ube2g28.160e-8774.55ubiquitin conjugating enzyme E2 G2 [Source:NCBI ge... [more]
ube2g1a9.777e-5754.84ubiquitin conjugating enzyme E2 G1 [Source:NCBI ge... [more]
ube2g1a1.796e-5654.14ubiquitin conjugating enzyme E2 G1 [Source:NCBI ge... [more]
ENSORLT00000046557.16.110e-5652.53ubiquitin-conjugating enzyme E2 G1 [Source:NCBI ge... [more]
back to top
BLAST of Ubiquitin-conjugating enzyme E2 G2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015438.15.550e-124100.00SMESG000015438.1[more]
SMESG000003121.11.694e-5352.60SMESG000003121.1[more]
SMESG000059645.11.553e-5053.90SMESG000059645.1[more]
SMESG000064169.13.147e-3738.22SMESG000064169.1[more]
SMESG000063640.12.490e-3638.22SMESG000063640.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017077 ID=SMED30017077|Name=Ubiquitin-conjugating enzyme E2 G2|organism=Schmidtea mediterranea sexual|type=transcript|length=630bp
ATTTTCTACAAGCAATTGTTTATTTTTTCGAATTATAGTAATTAATAATT
ATTTTTTTCATTTGATTACTATTAACTAAATTATTTGATAATGGCTGGAA
ATGCTTTAAAGCGATTAATGTCTGAGTATAAACAATTAACTTTAAATCCA
CCAGAAGGAATAGTTTCAGGTCCAATCGATGAAGAAAATTTTTTCGAATG
GGAAGCATTGATTGGAGGCCCCGAAGGTACTCCATTCGAAGGCGGAGTGT
TTACGGCACGCCTATCATTTCCCATGGATTATCCTTTAAATCCACCTAAA
ATGAAATTTATTTCAGATATATTCCATCCAAATATTTATCCTGATGGTCG
CGTCTGCATTTCAATTTTGCATGCCCCAGGAAATGATCCCACCGGCTATG
AATCCAGCGCAGAAAGATGGAGTCCAGTGCAAAGTGTGGAGAAAATTTTG
CTCTCGGTGGTAAGCATGCTAGCTGAACCGAATGACGAAAGTGCAGCCAA
TGTTGATGCTGCCATAACTTGGCGAGATGATCGTCAGAAGTTCAATGATA
TGGCTGAGAAAAGTGTTCGGAAAAGTCTTAATCTTCCTATTTGTTAATAT
AAATAAATTTTGATTTCCATGAAAAAAAAA
back to top

protein sequence of SMED30017077-orf-1

>SMED30017077-orf-1 ID=SMED30017077-orf-1|Name=SMED30017077-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=169bp
MAGNALKRLMSEYKQLTLNPPEGIVSGPIDEENFFEWEALIGGPEGTPFE
GGVFTARLSFPMDYPLNPPKMKFISDIFHPNIYPDGRVCISILHAPGNDP
TGYESSAERWSPVQSVEKILLSVVSMLAEPNDESAANVDAAITWRDDRQK
FNDMAEKSVRKSLNLPIC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0000166nucleotide binding
GO:0005524ATP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR016135UBQ-conjugating_enzyme/RWD
IPR000608UBQ-conjugat_E2
IPR023313UBQ-conjugating_AS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00212ubc_7coord: 7..164
e-value: 2.1E-67
score: 239.9
NoneNo IPR availablePANTHERPTHR24067:SF154UBIQUITIN-CONJUGATING ENZYME E2 G2coord: 3..164
NoneNo IPR availablePANTHERPTHR24067UBIQUITIN-CONJUGATING ENZYME E2coord: 3..164
IPR000608Ubiquitin-conjugating enzyme E2PFAMPF00179UQ_concoord: 8..157
e-value: 1.6E-49
score: 167.1
IPR000608Ubiquitin-conjugating enzyme E2PROSITEPS50127UBIQUITIN_CONJUGAT_2coord: 7..153
score: 40.842
IPR000608Ubiquitin-conjugating enzyme E2CDDcd00195UBCccoord: 7..159
e-value: 2.92187E-63
score: 189.336
IPR016135Ubiquitin-conjugating enzyme/RWD-likeGENE3DG3DSA:3.10.110.10coord: 2..165
e-value: 1.2E-70
score: 238.2
IPR016135Ubiquitin-conjugating enzyme/RWD-likeSUPERFAMILYSSF54495UBC-likecoord: 5..162
IPR023313Ubiquitin-conjugating enzyme, active sitePROSITEPS00183UBIQUITIN_CONJUGAT_1coord: 78..93