Actin-related protein 5

Overview
NameActin-related protein 5
Smed IDSMED30017076
Length (bp)2251
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Actin-related protein 5 (SMED30017076) t-SNE clustered cells

Violin plots show distribution of expression levels for Actin-related protein 5 (SMED30017076) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Actin-related protein 5 (SMED30017076) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Actin-related protein 5 (SMED30017076) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017076

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30017076SMESG000077218.1 SmedASXL_015147SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Actin-related protein 5 vs. Ensembl Human
Match: ACTR5 (actin related protein 5 [Source:HGNC Symbol;Acc:HGNC:14671])

HSP 1 Score: 194.512 bits (493), Expect = 1.268e-52
Identity = 123/305 (40.33%), Postives = 182/305 (59.67%), Query Frame = 3
Query:  162 IPIVIDNGSYQFKCGFAIDSC-----PYLEFKNVIAKSKSKK---EGILVGN---EIEDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGL--QTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDL-RMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFKKSEKMLSNEQLEEKK----KQQMLRGKEMHLKRNQEKLASAQDNLSNLM 1022
            +P+V+DNGS+Q + G+A         P L+F+ V A+ +       G  VGN    +E     +R  FDRNV VN ++QE + DY+F +LG+  Q   DHPIV+ E +CNP   RQ MSELLFE Y +P +AY ID L S+ +N P+     +  + LI+S GYQ  H+LP+  GRL+AK C++IN+GGSQ    + RLLQLKY  H   I L RM E L + +  +A +Y +E+ +W+   Y+ +N   +Q+PF  S K+L +    E+K    +QQ+ R +E++ +R +EKL   Q+ L  L+
Sbjct:   31 VPLVLDNGSFQVRAGWACPGQDPGPEPRLQFRAVCARGRGGARGASGPQVGNALGSLEPLRWMLRSPFDRNVPVNLELQELLLDYSFQHLGVSSQGCVDHPIVLTEAVCNPLYSRQMMSELLFECYGIPKVAYGIDSLFSFYHNKPK----NSMCSGLIISSGYQCTHVLPILEGRLDAKNCKRINLGGSQAAGYLQRLLQLKYPGHLAAITLSRMEEILHEHS-YIAEDYVEELHKWRCPDYYENNVHKMQLPF--SSKLLGSTLTSEEKQERRQQQLRRLQELNARRREEKLQLDQERLDRLL 328          

HSP 2 Score: 100.908 bits (250), Expect = 1.671e-21
Identity = 70/200 (35.00%), Postives = 107/200 (53.50%), Query Frame = 3
Query: 1644 DSDTEQKQLCQLEILL------NQYDPEFTKDNNSSLK--------VDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLAL-HTQFDSMSISKELYEEMGHDYIQEHPLSNFFYTPL 2198
            DS  E   L QLE  L      N +DP F+++     K         ++  Y++L + TE+ R PEIIF+P +IG E+AG+ E L+      Y+L  Y K+    + L  N+FLTG  +  P +K R+  E+ +  P   S   +++A +P LDAW GA   AL H   + + I+++ YEE G +Y++EH  SN  Y P+
Sbjct:  388 DSKPETPDLEQLEPSLEDVESMNDFDPLFSEETPGVEKPVTTVQPVFNLAAYHQLFVGTERIRAPEIIFQPSLIGEEQAGIAETLQ------YILDRYPKDI--QEMLVQNVFLTGGNTMYPGMKARMEKELLEMRPFR-SSFQVQLASNPVLDAWYGARDWALNHLDDNEVWITRKEYEEKGGEYLKEHCASN-IYVPI 577          
BLAST of Actin-related protein 5 vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 99.3673 bits (246), Expect = 1.192e-22
Identity = 54/227 (23.79%), Postives = 112/227 (49.34%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYA--NIRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +VIDNGS   K GFA D  P   F +++ + + +     VG+E +       ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQDS--YVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 224          
BLAST of Actin-related protein 5 vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 101.679 bits (252), Expect = 1.980e-22
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +VIDNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 233          

HSP 2 Score: 55.4546 bits (132), Expect = 2.108e-7
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  248 ITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 371          
BLAST of Actin-related protein 5 vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 101.679 bits (252), Expect = 1.980e-22
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +VIDNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 233          

HSP 2 Score: 55.4546 bits (132), Expect = 2.108e-7
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  248 ITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 371          
BLAST of Actin-related protein 5 vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 101.679 bits (252), Expect = 1.980e-22
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +VIDNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 233          

HSP 2 Score: 55.4546 bits (132), Expect = 2.108e-7
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  248 ITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 371          
BLAST of Actin-related protein 5 vs. Ensembl Celegans
Match: act-2 (Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984])

HSP 1 Score: 101.679 bits (252), Expect = 7.438e-23
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T ++L  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    9 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 234          

HSP 2 Score: 56.9954 bits (136), Expect = 2.432e-8
Identity = 41/136 (30.15%), Postives = 61/136 (44.85%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E AG+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  249 ITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIM---------KCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 372          
BLAST of Actin-related protein 5 vs. Ensembl Celegans
Match: act-2 (Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984])

HSP 1 Score: 101.679 bits (252), Expect = 7.438e-23
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T ++L  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    9 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 234          

HSP 2 Score: 56.9954 bits (136), Expect = 2.432e-8
Identity = 41/136 (30.15%), Postives = 61/136 (44.85%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E AG+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  249 ITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIM---------KCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 372          
BLAST of Actin-related protein 5 vs. Ensembl Celegans
Match: act-2 (Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984])

HSP 1 Score: 101.679 bits (252), Expect = 7.438e-23
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T ++L  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    9 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 234          

HSP 2 Score: 56.9954 bits (136), Expect = 2.432e-8
Identity = 41/136 (30.15%), Postives = 61/136 (44.85%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E AG+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  249 ITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIM---------KCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 372          
BLAST of Actin-related protein 5 vs. Ensembl Celegans
Match: act-3 (Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42])

HSP 1 Score: 101.293 bits (251), Expect = 8.866e-23
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T ++L  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    9 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 234          

HSP 2 Score: 56.9954 bits (136), Expect = 2.850e-8
Identity = 41/136 (30.15%), Postives = 61/136 (44.85%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E AG+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  249 ITVGNERFRCPEAMFQPSFLGMESAGIHETSYNSIM---------KCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 372          
BLAST of Actin-related protein 5 vs. Ensembl Celegans
Match: act-3 (Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42])

HSP 1 Score: 101.293 bits (251), Expect = 8.866e-23
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T ++L  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    9 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 234          

HSP 2 Score: 56.9954 bits (136), Expect = 2.850e-8
Identity = 41/136 (30.15%), Postives = 61/136 (44.85%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E AG+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  249 ITVGNERFRCPEAMFQPSFLGMESAGIHETSYNSIM---------KCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 372          
BLAST of Actin-related protein 5 vs. Ensembl Fly
Match: Arp5 (gene:FBgn0038576 transcript:FBtr0336468)

HSP 1 Score: 210.305 bits (534), Expect = 2.441e-58
Identity = 113/308 (36.69%), Postives = 183/308 (59.42%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKS--KKEG-----------------ILVGNEI---EDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGL--QTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPF---KKSEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNL 1010
            +VIDNGSY+ + G++    P L F+NV+ K +   KKE                  I VGN+I   E   A+++  F+RNV+ N++ QE +FDY F  +G   Q   DHPI++ E L NPN CRQQM+ELLFE Y +PS++Y ID L  Y++ + +  +   +D  LI+SFGY + H++P+ +G+L+ +  R++NVGG  + + + RL+Q+KY  H N I +   E L  + C +A++Y++E++QW    Y+ ++ + IQ+P+     +  ML+ EQ +EK+++   R  ++   R QEKL   +  L
Sbjct:    7 LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPRKDRKKEAAASEGSASQTTVEQSAEIQVGNDITNIEAVRAHLKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQMNELLFECYGIPSVSYGIDAL--YSWKHHQQKQKNISD-ALIISFGYSTTHVIPVLDGKLQLEHVRRLNVGGYHIITYLFRLMQMKYPVHLNAITISRMEKLVHEHCHIAVDYKEELVQWAQMDYYDEHIMKIQLPYNAVTATNAMLTAEQKQEKRRELAHRLLDIKKNREQEKLREDEQQL 311          

HSP 2 Score: 112.079 bits (279), Expect = 3.336e-25
Identity = 70/221 (31.67%), Postives = 116/221 (52.49%), Query Frame = 3
Query: 1581 KKGSSQNQLEDDRYAEDLSDDDSDTEQK---------------QLCQLEILLNQYDPEFTKDNNSSLKVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQEHPLSNFFY-TP 2195
            K+  +  + EDD +   ++D+D D  ++               +L Q + +LN YD   T  N++       E Y+LH   E  RVPE++F+P MIG  EAGL E++      +++L L+   + + ++L ++++LTG  ++   LKERL  E+ +  P   S   I  +D+PTL AW GAC  A    F     +++ ++E G ++ +EH  SN FY TP
Sbjct:  438 KRRKANGEEEDDGFG--MNDNDWDVYKRINRYNDDSDSDADNEKLMQFDKILNHYDAN-TDGNSNVPPQSAAENYQLHFGVENIRVPEVLFQPSMIGCSEAGLAELI------AFVLKLFP--AAEQQRLVEHVYLTGGCAQFKGLKERLIKELMEMRPFQ-SKFAIYESDEPTLSAWLGACVHAGEPTFGQTLTTRQDHQEHGREFFREHTASNIFYPTP 646          
BLAST of Actin-related protein 5 vs. Ensembl Fly
Match: Arp5 (gene:FBgn0038576 transcript:FBtr0083557)

HSP 1 Score: 210.305 bits (534), Expect = 2.441e-58
Identity = 113/308 (36.69%), Postives = 183/308 (59.42%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKS--KKEG-----------------ILVGNEI---EDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGL--QTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPF---KKSEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNL 1010
            +VIDNGSY+ + G++    P L F+NV+ K +   KKE                  I VGN+I   E   A+++  F+RNV+ N++ QE +FDY F  +G   Q   DHPI++ E L NPN CRQQM+ELLFE Y +PS++Y ID L  Y++ + +  +   +D  LI+SFGY + H++P+ +G+L+ +  R++NVGG  + + + RL+Q+KY  H N I +   E L  + C +A++Y++E++QW    Y+ ++ + IQ+P+     +  ML+ EQ +EK+++   R  ++   R QEKL   +  L
Sbjct:    7 LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPRKDRKKEAAASEGSASQTTVEQSAEIQVGNDITNIEAVRAHLKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQMNELLFECYGIPSVSYGIDAL--YSWKHHQQKQKNISD-ALIISFGYSTTHVIPVLDGKLQLEHVRRLNVGGYHIITYLFRLMQMKYPVHLNAITISRMEKLVHEHCHIAVDYKEELVQWAQMDYYDEHIMKIQLPYNAVTATNAMLTAEQKQEKRRELAHRLLDIKKNREQEKLREDEQQL 311          

HSP 2 Score: 112.079 bits (279), Expect = 3.336e-25
Identity = 70/221 (31.67%), Postives = 116/221 (52.49%), Query Frame = 3
Query: 1581 KKGSSQNQLEDDRYAEDLSDDDSDTEQK---------------QLCQLEILLNQYDPEFTKDNNSSLKVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQEHPLSNFFY-TP 2195
            K+  +  + EDD +   ++D+D D  ++               +L Q + +LN YD   T  N++       E Y+LH   E  RVPE++F+P MIG  EAGL E++      +++L L+   + + ++L ++++LTG  ++   LKERL  E+ +  P   S   I  +D+PTL AW GAC  A    F     +++ ++E G ++ +EH  SN FY TP
Sbjct:  438 KRRKANGEEEDDGFG--MNDNDWDVYKRINRYNDDSDSDADNEKLMQFDKILNHYDAN-TDGNSNVPPQSAAENYQLHFGVENIRVPEVLFQPSMIGCSEAGLAELI------AFVLKLFP--AAEQQRLVEHVYLTGGCAQFKGLKERLIKELMEMRPFQ-SKFAIYESDEPTLSAWLGACVHAGEPTFGQTLTTRQDHQEHGREFFREHTASNIFYPTP 646          
BLAST of Actin-related protein 5 vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0070822)

HSP 1 Score: 100.523 bits (249), Expect = 2.379e-22
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T ++L  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    9 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 234          

HSP 2 Score: 55.8398 bits (133), Expect = 7.446e-8
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  249 ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 372          
BLAST of Actin-related protein 5 vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0100662)

HSP 1 Score: 100.523 bits (249), Expect = 2.379e-22
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T ++L  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    9 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 234          

HSP 2 Score: 55.8398 bits (133), Expect = 7.446e-8
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  249 ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 372          
BLAST of Actin-related protein 5 vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0345894)

HSP 1 Score: 100.523 bits (249), Expect = 2.379e-22
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T ++L  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    9 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 234          

HSP 2 Score: 55.8398 bits (133), Expect = 7.446e-8
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  249 ITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 372          
BLAST of Actin-related protein 5 vs. Ensembl Zebrafish
Match: actr5 (actin related protein 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2877])

HSP 1 Score: 199.904 bits (507), Expect = 6.695e-55
Identity = 112/298 (37.58%), Postives = 176/298 (59.06%), Query Frame = 3
Query:  177 DNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGIL------VGNEI---EDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQ--DHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDL-RMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPF--KKSEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNLSNLMNL 1028
            DNGS+Q + G++    P L+   ++ +  + +          VGN+I   E     ++ AFDR+ VVNFD+QE VFDY F +LG+ T    +HP+V+ EP CNP  CRQ MSELLFE Y VP +AY +D L S   N+    ++ A  T L+LS G+   H+LP+ NGRL+A  C+++N+GG Q  +   RLLQLKY  +   I L RM E L Q +  +A++Y  E+ +W+S +++      +Q+PF  + +   +S E+  E++ QQ+ R +E++ +R +E++   Q  L  L+ +
Sbjct:   38 DNGSFQCRAGWS-SGAPELDNPRLVFRPAAARSRGAARGGAQVGNDIPNPEPLRWTLKSAFDRDTVVNFDIQELVFDYIFMHLGINTQGRVEHPLVVTEPACNPLQCRQMMSELLFECYGVPRVAYGVDSLFSLHQNS--TADAGAPSTALVLSSGHHCSHVLPVINGRLDAVNCKRVNLGGGQAAAYYQRLLQLKYPANQASITLSRMEELLHQHS-YIAVDYHNELEKWRSPEFYESEVHRVQLPFSGRSAGVSVSAEERSERRAQQLRRIQEINSRRREERILEDQKRLDTLLAV 331          

HSP 2 Score: 101.293 bits (251), Expect = 8.441e-22
Identity = 60/153 (39.22%), Postives = 88/153 (57.52%), Query Frame = 3
Query: 1743 DIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALHTQFDSMS-ISKELYEEMGHDYIQEHPLSNFFYTPL 2198
            ++ EY++L + TE+ RVPEIIF+P +IG E+ GL E L+      ++L  Y     Q + L  N+FLTG   + P +KER+  E+    P   S   + +A  P LD+W GAC  AL +  D+   IS++ YEE G +Y+ EH  SN  Y P+
Sbjct:  414 NVAEYHQLFVGTERLRVPEIIFQPSLIGEEQMGLMETLQ------FVLEQYSPE--QQEALVRNVFLTGGNLQYPGVKERVERELLAIRPFQ-SHFKVSVAGRPALDSWFGACDWALRSPADAPGWISRQDYEEKGGEYLSEHCASN-IYIPM 556          
BLAST of Actin-related protein 5 vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 100.908 bits (250), Expect = 1.433e-23
Identity = 55/236 (23.31%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASS 233          
BLAST of Actin-related protein 5 vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 100.138 bits (248), Expect = 1.276e-22
Identity = 55/236 (23.31%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASS 233          
BLAST of Actin-related protein 5 vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 100.138 bits (248), Expect = 3.356e-22
Identity = 55/236 (23.31%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASS 233          

HSP 2 Score: 55.4546 bits (132), Expect = 1.239e-7
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  248 ITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 371          
BLAST of Actin-related protein 5 vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 100.138 bits (248), Expect = 3.356e-22
Identity = 55/236 (23.31%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASS 233          

HSP 2 Score: 55.4546 bits (132), Expect = 1.239e-7
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  248 ITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 371          
BLAST of Actin-related protein 5 vs. Ensembl Xenopus
Match: gpr84 (G protein-coupled receptor 84 [Source:Xenbase;Acc:XB-GENE-491098])

HSP 1 Score: 200.29 bits (508), Expect = 6.141e-55
Identity = 110/295 (37.29%), Postives = 178/295 (60.34%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGI-LVGNEI---EDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGLQT--LQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFKKSEKMLS----NEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNLSNLM 1022
            +V+DNGS+Q + G+A  + P L+ ++V+A+S+     +  VGN+I   E     +R  FDRNV VN ++QE + D+ F  LG+ +    D+PIV  E  C P   RQ +SELLFE Y VP +++ IDGL S+ +NN +   ++     L++S GY   H+LP+  GRL+AK C++IN+GG    + + RLLQLKY  H   I L   E +  + C +  +Y  E+ +W+   Y+ +N   +Q+PF  S K+L+    +E+ +E+++QQ+ R +E++ +R +EKL   Q+ L  L+
Sbjct:   34 LVLDNGSFQLRAGWA-GAGPALQLRSVVARSRGGPRSLSRVGNDIPSLEPLRWLLRTPFDRNVPVNLELQELLCDHVFQKLGIASEGCVDYPIVFTEAPCTPLHVRQMVSELLFECYRVPKVSFGIDGLYSFYHNNKDLSPASG----LVVSSGYHCTHILPVLRGRLDAKNCKRINIGGFHSVTYLQRLLQLKYPGHVPAITLSRMEEILHEHCYVPEDYVDELRKWRCPDYYEENVHKMQLPF--STKLLASAIPSEEKQERRQQQLKRLQELNARRREEKLQQDQERLERLL 321          

HSP 2 Score: 102.449 bits (254), Expect = 5.845e-22
Identity = 61/175 (34.86%), Postives = 99/175 (56.57%), Query Frame = 3
Query: 1689 LNQYDPEFTKDNNSSLKV--------DIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALH-TQFDSMSISKELYEEMGHDYIQEHPLSNFF 2186
            +++ +P +T+D   + K         ++ EY++++L TE+ RVPEI+F+P ++G ++AGL E L+      Y+L  Y +   Q  +L  N+FLTG     P +K R+  E+ Q  P   S   + +A  P LDAW+GA   AL     +   +S++ YEEMG +Y++EH  SN F
Sbjct:  392 ISEVEPAYTEDQVETEKAAPVVQNMFNMAEYHQMYLGTERIRVPEILFQPSLMGEDQAGLAETLQ------YILDRYPQEVQQ--ELVQNVFLTGGNVIYPGIKGRMEKELVQIRPFG-SSFQVSLASHPVLDAWQGASGWALQNVDCEEGWVSRKEYEEMGGEYLKEHVASNRF 557          
BLAST of Actin-related protein 5 vs. Ensembl Xenopus
Match: gpr84 (G protein-coupled receptor 84 [Source:Xenbase;Acc:XB-GENE-491098])

HSP 1 Score: 200.29 bits (508), Expect = 9.879e-55
Identity = 110/295 (37.29%), Postives = 178/295 (60.34%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGI-LVGNEI---EDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGLQT--LQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFKKSEKMLS----NEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNLSNLM 1022
            +V+DNGS+Q + G+A  + P L+ ++V+A+S+     +  VGN+I   E     +R  FDRNV VN ++QE + D+ F  LG+ +    D+PIV  E  C P   RQ +SELLFE Y VP +++ IDGL S+ +NN +   ++     L++S GY   H+LP+  GRL+AK C++IN+GG    + + RLLQLKY  H   I L   E +  + C +  +Y  E+ +W+   Y+ +N   +Q+PF  S K+L+    +E+ +E+++QQ+ R +E++ +R +EKL   Q+ L  L+
Sbjct:   34 LVLDNGSFQLRAGWA-GAGPALQLRSVVARSRGGPRSLSRVGNDIPSLEPLRWLLRTPFDRNVPVNLELQELLCDHVFQKLGIASEGCVDYPIVFTEAPCTPLHVRQMVSELLFECYRVPKVSFGIDGLYSFYHNNKDLSPASG----LVVSSGYHCTHILPVLRGRLDAKNCKRINIGGFHSVTYLQRLLQLKYPGHVPAITLSRMEEILHEHCYVPEDYVDELRKWRCPDYYEENVHKMQLPF--STKLLASAIPSEEKQERRQQQLKRLQELNARRREEKLQQDQERLERLL 321          

HSP 2 Score: 102.834 bits (255), Expect = 4.856e-22
Identity = 61/175 (34.86%), Postives = 99/175 (56.57%), Query Frame = 3
Query: 1689 LNQYDPEFTKDNNSSLKV--------DIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALH-TQFDSMSISKELYEEMGHDYIQEHPLSNFF 2186
            +++ +P +T+D   + K         ++ EY++++L TE+ RVPEI+F+P ++G ++AGL E L+      Y+L  Y +   Q  +L  N+FLTG     P +K R+  E+ Q  P   S   + +A  P LDAW+GA   AL     +   +S++ YEEMG +Y++EH  SN F
Sbjct:  418 ISEVEPAYTEDQVETEKAAPVVQNMFNMAEYHQMYLGTERIRVPEILFQPSLMGEDQAGLAETLQ------YILDRYPQEVQQ--ELVQNVFLTGGNVIYPGIKGRMEKELVQIRPFG-SSFQVSLASHPVLDAWQGASGWALQNVDCEEGWVSRKEYEEMGGEYLKEHVASNRF 583          
BLAST of Actin-related protein 5 vs. Ensembl Xenopus
Match: actg1 (actin gamma 1 [Source:NCBI gene;Acc:394957])

HSP 1 Score: 100.908 bits (250), Expect = 3.041e-22
Identity = 55/236 (23.31%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 233          

HSP 2 Score: 55.4546 bits (132), Expect = 1.796e-7
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  248 ITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 371          
BLAST of Actin-related protein 5 vs. Ensembl Xenopus
Match: actb (actin, beta [Source:NCBI gene;Acc:407952])

HSP 1 Score: 100.523 bits (249), Expect = 3.461e-22
Identity = 55/236 (23.31%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 233          

HSP 2 Score: 55.8398 bits (133), Expect = 1.404e-7
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  248 ITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 371          
BLAST of Actin-related protein 5 vs. Ensembl Xenopus
Match: acta2 (actin, alpha 2, smooth muscle, aorta [Source:NCBI gene;Acc:496696])

HSP 1 Score: 95.5153 bits (236), Expect = 1.516e-20
Identity = 55/236 (23.31%), Postives = 113/236 (47.88%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  ++ N+D  E ++ ++F N      ++HP ++ E   NP   R++M++++FE ++VP++   I  + S        L ++   T ++L  G    H +P++ G        ++++ G  L   +M++L  +        +  +   +++K C +AL++  EM    SS
Sbjct:   10 LVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLS--------LYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASS 235          
BLAST of Actin-related protein 5 vs. Ensembl Mouse
Match: Actr5 (ARP5 actin-related protein 5 [Source:MGI Symbol;Acc:MGI:1924748])

HSP 1 Score: 194.512 bits (493), Expect = 1.024e-54
Identity = 133/373 (35.66%), Postives = 213/373 (57.10%), Query Frame = 3
Query:  156 RDIPIVIDNGSYQFKCGFAIDSC-----PYLEFKNVIAKSKSKKEGIL---VGN---EIEDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGL--QTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDL-RMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFKKSEKMLSNEQLEEKK----KQQMLRGKEMHLKRNQEKLASAQDNLSNLMNLI-----SSKDNMKKKIINSMGFENEQHVMNEMKNIELLIEKLQCKIRGIDCPTKIENLEPKQKF 1205
            + +P+V+DNGS+Q + G+A         P L+F+ V A+ +    G     VGN    +E     +R  FDRNV VN ++QE + DY+F +LG+  Q   DHPIV+ E +CNP   RQ MSELLFE Y +P +AY ID L S+ +N P+     A  + LI+S GYQ  H+LP+  GRL+AK C++IN+GGSQ    + RLLQLKY  H   I L RM E LQ+ +  +A +Y  E+ +W+   Y+ +N   +Q+PF  S K+L +    E+K    +QQ+ R +E++ +R +EKL   Q+ L  L+ +         D   K +I  +  ++ + + + ++ + L +E+ + KI   +   +++ ++ K ++
Sbjct:   29 QPVPLVLDNGSFQARAGWACPGPDPGPEPRLQFRAVCARGRGGARGGPGPQVGNALGSLEPLRWMLRSPFDRNVPVNLELQELLLDYSFQHLGVSSQGCVDHPIVLTEAVCNPLYSRQMMSELLFECYRIPKVAYGIDSLFSFYHNVPK----NALSSGLIISSGYQCTHILPVLEGRLDAKNCKRINLGGSQAAGYLQRLLQLKYPGHLAAITLSRMEEILQEHS-YIAEDYGAELQKWQCPDYYENNVHKMQLPF--SSKLLGSTLTAEEKQERRQQQLRRLQELNARRREEKLQLDQERLERLLYVQELLEEGQMDQFHKALIE-LNMDSPEELQSYIQKLTLAVEQAKQKILQAEASLEVDVVDSKPEY 393          
BLAST of Actin-related protein 5 vs. Ensembl Mouse
Match: Actr5 (ARP5 actin-related protein 5 [Source:MGI Symbol;Acc:MGI:1924748])

HSP 1 Score: 194.897 bits (494), Expect = 5.365e-53
Identity = 132/355 (37.18%), Postives = 204/355 (57.46%), Query Frame = 3
Query:  156 RDIPIVIDNGSYQFKCGFAIDSC-----PYLEFKNVIAKSKSKKEGIL---VGN---EIEDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGL--QTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDL-RMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFKKSEKMLSNEQLEEKK----KQQMLRGKEMHLKRNQEKLASAQDNLSNLMNLI-----SSKDNMKKKIINSMGFENEQHVMNEMKNIELLIEKLQCKI 1151
            + +P+V+DNGS+Q + G+A         P L+F+ V A+ +    G     VGN    +E     +R  FDRNV VN ++QE + DY+F +LG+  Q   DHPIV+ E +CNP   RQ MSELLFE Y +P +AY ID L S+ +N P+     A  + LI+S GYQ  H+LP+  GRL+AK C++IN+GGSQ    + RLLQLKY  H   I L RM E LQ+ +  +A +Y  E+ +W+   Y+ +N   +Q+PF  S K+L +    E+K    +QQ+ R +E++ +R +EKL   Q+ L  L+ +         D   K +I  +  ++ + + + ++ + L +E+ + KI
Sbjct:   29 QPVPLVLDNGSFQARAGWACPGPDPGPEPRLQFRAVCARGRGGARGGPGPQVGNALGSLEPLRWMLRSPFDRNVPVNLELQELLLDYSFQHLGVSSQGCVDHPIVLTEAVCNPLYSRQMMSELLFECYRIPKVAYGIDSLFSFYHNVPK----NALSSGLIISSGYQCTHILPVLEGRLDAKNCKRINLGGSQAAGYLQRLLQLKYPGHLAAITLSRMEEILQEHS-YIAEDYGAELQKWQCPDYYENNVHKMQLPF--SSKLLGSTLTAEEKQERRQQQLRRLQELNARRREEKLQLDQERLERLLYVQELLEEGQMDQFHKALIE-LNMDSPEELQSYIQKLTLAVEQAKQKI 375          

HSP 2 Score: 94.7449 bits (234), Expect = 1.091e-19
Identity = 61/177 (34.46%), Postives = 97/177 (54.80%), Query Frame = 3
Query: 1677 LEILLNQYDPEFTKDNNSSLK--VDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLAL-HTQFDSMSISKELYEEMGHDYIQEHPLSNFFYTPL 2198
             E L ++  PE  K   ++++   ++  Y++L + TE+ R PEIIF+P +IG E+AG+ E L       ++L  Y K    T  L  N+FLTG     P +K R+  E+ +  P   S   +++A +P LDAW GA   AL H +     ++++ YEE G +Y++EH  SN  Y P+
Sbjct:  412 FEPLFSEETPEVEKPQVTTVQPVFNLAAYHQLSVGTERIRAPEIIFQPSLIGEEQAGIAETLH------FVLDRYPKAIQDT--LVQNVFLTGGNVMYPGMKARVEKELLEMRPFQ-SSFQVQLASNPVLDAWYGARDWALDHLEDSGAWVTRKDYEEKGGEYLKEHCASN-TYVPI 578          
BLAST of Actin-related protein 5 vs. Ensembl Mouse
Match: Actb (actin, beta [Source:MGI Symbol;Acc:MGI:87904])

HSP 1 Score: 101.293 bits (251), Expect = 2.265e-23
Identity = 55/236 (23.31%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 233          
BLAST of Actin-related protein 5 vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 101.679 bits (252), Expect = 1.359e-22
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +VIDNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 233          

HSP 2 Score: 55.4546 bits (132), Expect = 1.447e-7
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  248 ITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 371          
BLAST of Actin-related protein 5 vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 101.679 bits (252), Expect = 1.359e-22
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +VIDNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 233          

HSP 2 Score: 55.4546 bits (132), Expect = 1.447e-7
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  248 ITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 371          
BLAST of Actin-related protein 5 vs. UniProt/SwissProt
Match: sp|Q17GZ9|ARP5_AEDAE (Actin-related protein 5 OS=Aedes aegypti OX=7159 GN=Arp5 PE=3 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 3.070e-59
Identity = 121/329 (36.78%), Postives = 183/329 (55.62%), Query Frame = 3
Query:   87 MLDLTDLYIQQKSINKFQYNSNYRDIPIVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSK---SKKEG-------ILVGNEIEDFYA---NIRYAFDRNVVVNFDVQESVFDYAFDNLGLQT--LQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFKK--SEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNLSNLM 1022
            + D+ D+ ++   +  +   +   D  IVIDNGSY  + G+A    P L FKNV+AK +   SKK+        + +GN+I +  A    +R  FDRNVV +  VQE +FDY F  LG+       HP+++ E + NPN  R  MSEL+FE Y +P I Y +DGL SY  N          D+ LI+S GYQ+ H++P+ NGR+     R+IN+GG  + + M RLLQLKY  H N I L   E +    CS A +Y + +  W   +++  N + IQ+P+ +  S   L+ EQ  EK+K+   R  E++L++ +EKLA  +  L+ ++
Sbjct:    3 LFDIEDIKVKPDIVCTYPDPTVPPDAAIVIDNGSYHCRAGWAGKDVPSLVFKNVLAKPRKDRSKKDTSEVVVPTVQIGNDITNIEAVRFQLRTQFDRNVVTHLHVQEQIFDYLFGRLGINADGCVPHPVLLTECVANPNYSRMLMSELMFECYGIPGIVYAVDGLLSYRMNG-------GQDSGLIVSCGYQATHVIPVLNGRMVEDKVRRINLGGFNMINFMFRLLQLKYPVHVNAITLSRAETMIHNYCSFAYDYTESLRNWALLEFYEQNVIKIQLPYNQNVSAPTLTAEQRLEKRKELSRRLAEINLRKREEKLAEDKVLLTRML 324          

HSP 2 Score: 129.413 bits (324), Expect = 8.121e-30
Identity = 75/188 (39.89%), Postives = 111/188 (59.04%), Query Frame = 3
Query: 1635 SDDDSDTEQKQLCQLEILLNQYDPEFTKDNNSSLKVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQEHPLSNFFY-TP 2195
             D DSD E ++L + E +L Q+D  F +   +    +I E+++LH+  E+ RVPEI+F+P MIG +EAGL   ++      Y+L L+ K   Q K L  N+ LTG  + I   KERL  E++  LP   S   + +A  P+LDAWRGA + A   +F    I+++LY+E G +Y +EH  SNF+Y TP
Sbjct:  467 GDSDSDAENEKLIECEEILKQHDSTFVEPVVAP--GNIAEFHQLHIGVERIRVPEILFQPSMIGVQEAGLTGTID------YVLKLFPKED-QVK-LVGNVMLTGGCANIRGFKERLSRELQAILPFQ-SVYNLMVAGSPSLDAWRGASQFANSQEFKQSLITRQLYDECGGEYFKEHTASNFYYPTP 643          
BLAST of Actin-related protein 5 vs. UniProt/SwissProt
Match: sp|Q9VEC3|ARP5_DROME (Actin-related protein 5 OS=Drosophila melanogaster OX=7227 GN=Arp5 PE=1 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 2.447e-57
Identity = 113/308 (36.69%), Postives = 183/308 (59.42%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKS--KKEG-----------------ILVGNEI---EDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGL--QTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPF---KKSEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNL 1010
            +VIDNGSY+ + G++    P L F+NV+ K +   KKE                  I VGN+I   E   A+++  F+RNV+ N++ QE +FDY F  +G   Q   DHPI++ E L NPN CRQQM+ELLFE Y +PS++Y ID L  Y++ + +  +   +D  LI+SFGY + H++P+ +G+L+ +  R++NVGG  + + + RL+Q+KY  H N I +   E L  + C +A++Y++E++QW    Y+ ++ + IQ+P+     +  ML+ EQ +EK+++   R  ++   R QEKL   +  L
Sbjct:    7 LVIDNGSYECRVGWSDSKEPDLRFRNVLTKPRKDRKKEAAASEGSASQTTVEQSAEIQVGNDITNIEAVRAHLKSPFERNVITNWNHQEQIFDYIFTKMGFDGQDKIDHPIILTEALANPNFCRQQMNELLFECYGIPSVSYGIDAL--YSWKHHQQKQKNISD-ALIISFGYSTTHVIPVLDGKLQLEHVRRLNVGGYHIITYLFRLMQMKYPVHLNAITISRMEKLVHEHCHIAVDYKEELVQWAQMDYYDEHIMKIQLPYNAVTATNAMLTAEQKQEKRRELAHRLLDIKKNREQEKLREDEQQL 311          

HSP 2 Score: 112.079 bits (279), Expect = 3.344e-24
Identity = 70/221 (31.67%), Postives = 116/221 (52.49%), Query Frame = 3
Query: 1581 KKGSSQNQLEDDRYAEDLSDDDSDTEQK---------------QLCQLEILLNQYDPEFTKDNNSSLKVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQEHPLSNFFY-TP 2195
            K+  +  + EDD +   ++D+D D  ++               +L Q + +LN YD   T  N++       E Y+LH   E  RVPE++F+P MIG  EAGL E++      +++L L+   + + ++L ++++LTG  ++   LKERL  E+ +  P   S   I  +D+PTL AW GAC  A    F     +++ ++E G ++ +EH  SN FY TP
Sbjct:  438 KRRKANGEEEDDGFG--MNDNDWDVYKRINRYNDDSDSDADNEKLMQFDKILNHYDAN-TDGNSNVPPQSAAENYQLHFGVENIRVPEVLFQPSMIGCSEAGLAELI------AFVLKLFP--AAEQQRLVEHVYLTGGCAQFKGLKERLIKELMEMRPFQ-SKFAIYESDEPTLSAWLGACVHAGEPTFGQTLTTRQDHQEHGREFFREHTASNIFYPTP 646          
BLAST of Actin-related protein 5 vs. UniProt/SwissProt
Match: sp|P53946|ARP5_YEAST (Actin-related protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARP5 PE=1 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 9.054e-56
Identity = 204/741 (27.53%), Postives = 356/741 (48.04%), Query Frame = 3
Query:  165 PIVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKK---EGILVGNEI---EDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQD--HPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFKKS-EKMLSNEQLE---EKKKQQMLRGKEMHLKRNQEKLASAQDNLSNLMNLISS-KDNMKKKIINSM---GFENEQHVMNEMKNIELLIEKLQCKIRGIDCPTKIENLEPK--QKFXXXXXXXXXXXXXXXXXXXXXVMLRAAALRREQIRLMKEMKRNKILSAVNKLEESREDDFALWVMNLRHQRQSLLDNRMKKRSSLSVSMGSAGPSIGIDEXXXXXXXXXXXXXXELNEDLELKYIKKGSSQNQLEDDRYAEDLSDDDSDT---------------------------EQKQLCQLEILLNQYDPEFTKDNNSSLKVD--------------------IEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALH-TQFDSMSISKELYEEMGHDYIQEHPLSNFFY 2189
            PI ID GS + + GF   + P   F N + K + +K       VGN+    +   +  R  FD   V N+++ E + DY F +LG+       +PI++ E L    + R    ++LFE Y+VP + + ID L S+   NP     + N T L++S G++  +++P+ +G       ++IN GG Q    +  L+ LKY      +     E + +  C ++ NY +++ +  + +    N ++++ PF +  +   + E+L    EK+K+   R +E    +  EKL   Q+       +     D  KKK+++ +   GF++E+     + ++E  ++K Q  +   D     E  E K  QKFDL+DI+D++L+ED++K+K+KQ  L+A+   R++ +  KE    +      K ++ RE D   W+ + R +   L+  R K++  L   M      +          +   K  A L ED     +K+G+ +N     R+   + +D +DT                           E K + +LE LL ++DP FT+++    + D                    I E +++HL+ E+ RVPE+IF+P M G ++AG+ E+ E ++   +      K S  +  + +N+ +TG  +K+P LKER+  E   FLPT  ++  + ++ DP+LDAW+G   LA +  Q+    ISK+ YEE G +YI+EH L N  Y
Sbjct:   39 PIAIDFGSSKLRAGFVNHATPTHIFPNALTKFRDRKLNKNFTFVGNDTLLDQAVRSQSRSPFDGPFVTNWNLTEEILDYTFHHLGVVPDNGIPNPILLTERLATVQSQRTNWYQILFETYNVPGVTFGIDSLFSFYNYNP-----SGNKTGLVISCGHEDTNVIPVVDGAGILTDAKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYKDYCYVSRNYDEDIEKILTLENLDTNDVVVEAPFTEVLQPQKTEEELRIQAEKRKETGKRLQEQARLKRMEKLVQKQEEFEYFSKVRDQLIDEPKKKVLSVLQNAGFDDERDFKKYLHSLEQSLKKAQM-VEAEDDSHLDEMNEDKTAQKFDLLDIADEDLNEDQIKEKRKQRFLKASQDARQKAKEEKERVAKEEEEKKLKEQQWRETDLNGWIKDKRLKLNKLI-KRRKEKLKLRDEMKDRKSQVS---------QNRMKNLASLAED----NVKQGAKRN-----RHQATIDNDPNDTFGANDEDWLIYTDITQNPEAFEEALEYEYKDIVELERLLLEHDPNFTEEDTLEAQYDWRNSILHLFLRGPRPHDSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQP-GKLSQTSIDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTG-TNITVNMSSDPSLDAWKGMAALARNEEQYRKTVISKKEYEEYGPEYIKEHKLGNTKY 752          
BLAST of Actin-related protein 5 vs. UniProt/SwissProt
Match: sp|Q5ZJA4|ARP5_CHICK (Actin-related protein 5 OS=Gallus gallus OX=9031 GN=ACTR5 PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 2.173e-53
Identity = 127/354 (35.88%), Postives = 204/354 (57.63%), Query Frame = 3
Query:  162 IPIVIDNGSYQFKCGFA-----IDSCPYLEFKNVIAKSKSKKEG----ILVGNEI---EDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGL--QTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDL-RMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFKKSEKMLSNEQLEEKK----KQQMLRGKEMHLKRNQEKLASAQDNLSNLMNLI-----SSKDNMKKKIINSMGFENEQHVMNEMKNIELLIEKLQCKI 1151
            +P+VIDNGS+Q + G+A     + + P L F+++ A+S+  + G      VGN++   E     +R  FDRNV V  ++QE +FD+ F  LG+  Q   DHPIV+ E +CNP   RQ MSELLFE Y VP ++Y +D L S+ +N  +    +     L++S GYQ  H+LP+  GRL+AK C++IN+GG Q    + RLLQLKY  H   I L RM E L + +  +A +Y +E+ +W+S +Y+ +N   +Q+PF  S K+L +    E+K    +QQ+ R +E++ +R +EKL   Q+ L  L+ +         D   K ++  +  ++ + + + +  + L IE+ + KI
Sbjct:   32 VPLVIDNGSFQTRAGWAAADPSVPAEPLLRFRSLAARSRGARGGAGAETQVGNDLGSPEPLRWLLRSPFDRNVPVQLELQELLFDHVFQRLGVASQGCVDHPIVLTEAVCNPLYSRQMMSELLFECYQVPKVSYGVDSLYSFYHNRRQNWPCSG----LVISSGYQCTHILPVLEGRLDAKNCKRINLGGCQAAVYLQRLLQLKYPGHFAAITLSRMEEILHEHS-YIAEDYTEELQKWRSPEYYENNVHKMQLPF--SNKLLGSTLTSEEKQERRQQQLRRLQELNARRREEKLQLDQERLDRLLYVQELLEDGQMDQFHKALVE-LNMDSAEELQSYINKLSLAIEQTKQKI 377          

HSP 2 Score: 100.523 bits (249), Expect = 1.262e-20
Identity = 67/193 (34.72%), Postives = 104/193 (53.89%), Query Frame = 3
Query: 1626 EDLSDDDSDTEQKQLCQLEILLNQYDPEFTKDNNSSLKV-DIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLAL-HTQFDSMSISKELYEEMGHDYIQEHPLSNFFYTPL 2198
            + LS + S  + + + + E L  +  PE  K   +   V ++ EY++L L TE+ R PEIIF+P +IG ++ G+ E ++      Y+L  Y K   Q   L  N+FLTG  +  P LK R+  E+ +  P   S   + +A  PTLDAW GA   A+ H   +   I+++ YEE G +Y++EH  SN  Y P+
Sbjct:  399 DPLSSEQSLEDVESINEFEPLFAEEQPEAEKPVAAVQPVFNLAEYHQLFLGTERIRAPEIIFQPSLIGEDQTGIAETMQ------YVLERYSKE--QQALLVQNVFLTGGNAMYPGLKARVQKELLEMRPFQ-SSFQVHLASSPTLDAWYGARDWAVEHMTREEGWITRKDYEEKGGEYLKEHCASN-VYVPI 581          
BLAST of Actin-related protein 5 vs. UniProt/SwissProt
Match: sp|Q293V2|ARP5_DROPS (Actin-related protein 5 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=Arp5 PE=3 SV=2)

HSP 1 Score: 197.593 bits (501), Expect = 8.264e-53
Identity = 110/304 (36.18%), Postives = 176/304 (57.89%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKS--KKEGIL-------------------VGNEI---EDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQD--HPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYA-YNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPF---KKSEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEKL 989
            +VIDNGSY+ + G+     P L F+NV+ K +   KKE I                    VGN+I   E   A+++  F+RN++ N++ QE +FDY F  +G +  Q   +PIV+ E L NPN CRQ MSELLFE Y +P+++Y ID L S+  Y N     S A    LI+S GY + H++P+ NG+L+ +  R++NVGG  + + ++ L+Q+KY  H N I +   E L  + C +A++YR+E+++W    Y+ ++ + IQ+P+     +  +L+ EQ  EK+++  +R  E+  +R  EKL
Sbjct:    8 LVIDNGSYECRVGWNNTKEPALRFRNVLTKPRKDRKKEAIPDTTDGAPTPVAAEVPAEIQVGNDITNIEAVRAHLKSPFERNIITNWNHQEQIFDYIFTKMGFEGEQSIANPIVLTEALANPNFCRQNMSELLFECYGIPAVSYGIDALYSWEHYQNRRKKVSDA----LIISLGYSTTHVIPVLNGKLQLQHVRRLNVGGYHIITYLLCLMQMKYPVHLNAISISRMEKLVHEHCHIAVDYREELLKWGQMDYYEEHIMKIQLPYNPVTATNALLTAEQKLEKRRELAMRLLEIKNRREGEKL 307          

HSP 2 Score: 111.694 bits (278), Expect = 4.480e-24
Identity = 75/224 (33.48%), Postives = 116/224 (51.79%), Query Frame = 3
Query: 1581 KKGSSQNQLEDDRYAEDLSDDDSDTEQK---------------QLCQLEILLNQYDPEFTKDNNSSLKVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERL---FYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQEHPLSNFFY-TP 2195
            K+  +  + EDD +   ++D+D D  ++               QL + E +L+ YD  F  D N+       E Y+LH   E  RVPEI+F+P MIG  EAGL E++      +++L L+   + + +++ ++++LTG  ++   LKERL   F E+R F     S   I  +DD TL AW GAC  A    F     +++ Y+E G +Y +EH  SN FY TP
Sbjct:  441 KRRKANGEEEDDGFG--MNDNDWDVYKRINRYNDDSDSDADNEQLLEFEKILSHYDVNF-DDGNAVQTQSAAENYQLHFGVEDIRVPEILFQPSMIGSPEAGLAELI------AFVLKLF--TAQEQQRMVEHVYLTGGCAQFRGLKERLAREFLEMRPF----QSKFSIYESDDHTLSAWLGACVQASQPNFGQTLTTRKDYQEHGSEYFREHRASNLFYPTP 649          
BLAST of Actin-related protein 5 vs. TrEMBL
Match: A0A1S3HSI9 (actin-related protein 5 OS=Lingula unguis OX=7574 GN=LOC106157072 PE=3 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 3.300e-115
Identity = 272/712 (38.20%), Postives = 414/712 (58.15%), Query Frame = 3
Query:  135 FQYNSNYRD--IPIVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKE-GILVGNEI---EDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQ--DHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNN--PEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPF-KKSEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNLSNLMN---LISSKDNMK-KKIINSMGFENEQHVMNEMKNIELLIEKLQCKIRGIDCPTKIENLEPKQK-FXXXXXXXXXXXXXXXXXXXXXVMLRAAALRREQIRLMKEMKRNKILSAVNKLEESREDDFALWVMNLRHQRQSLLDNRMKKRSSLSVSMGSAGPSIGIDEXXXXXXXXXXXXXXELNEDLELKYIKKGSSQNQLEDDRYAE---DLSDDDSDTEQKQLCQLEILLNQYDPEFTKD---NNSSLKVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPI-IKIADDPTLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQEHPLSN-FFYTPL 2198
            F+Y  + RD  IP++IDNGSYQ + G+A D  P + FKN++A+ + KK+   L+GN+I   E     ++  FDRN+V  FD+QE V D+ F +LG+ T    DHP+V+ EP+CNPN CRQQMSELLFE Y VP +AY +D L S+  N+  PE    TAN   +++S GYQS+HLLP+ NGRL+A  CR+IN GGS LD+ M R+LQLK+  H   I L   E L ++   +A +Y  E+ +W    Y+ D+   IQ+P+  +    L+ EQ +EKK+QQ+ R KE++ K+  E+LA+ Q+ L  LM+   L++  D     K ++ + F +   +   +  +   I++ + K+ G+    K E  E KQ  +DL+D  DD L +D L++K++Q  L+AAA  R + R + E KR + L    ++EE R+ +F  W+   R +RQ LLD R +++   S           + +RR   +++  KI ++L E  + K  +     N  + + Y E      D DS+ EQ+QL +LE +L +YD EF KD    N     DI EYY+LH+STEQ R+PE++F+P ++G E+ G+ E L+      ++L  Y  +  +   L   +FLTG      N+KER+  EI    P     P  + +A+DP LDAW GA K AL +  +  SI++  YEE G +Y++EH ++N +  TP+
Sbjct:   24 FEYPDSLRDSSIPLIIDNGSYQCRAGWASDEKPKMIFKNLVARQRGKKDLDALIGNDIGNLEVMRWQLKSQFDRNIVTQFDLQEQVLDHLFSHLGINTQGQVDHPVVMTEPVCNPNHCRQQMSELLFEGYHVPQVAYGVDSLFSFYKNHATPE----TANG--MVVSCGYQSVHLLPVKNGRLDAGHCRRINTGGSHLDAFMHRMLQLKFPGHMAAITLSRAEELVREHTHMATDYINELEEWADVDYYEDHVHKIQLPYTAQPSNTLTAEQQKEKKEQQIRRLKEINAKKRLERLAADQERLQQLMSVQELMADDDEEAFNKALDDLEFSDPMELQEAINKLSSSIQRAKDKVMGVQT-QKEEEPETKQPVYDLLDTPDDMLTDDLLQKKKRQQFLKAAAEGRAKARKLNEEKRKQELMEEKRMEEKRKKNFQEWLAETRKKRQVLLDKRNQRKQRKS----------DMAKRRTFASQQRMKIISQLAEGEKKKKKEDTFGMNDDDWNVYKEINIRAGDSDSEMEQEQLEELETMLKEYDEEFAKDCDPQNGDGVFDIAEYYRLHVSTEQIRIPELLFQPSILGMEQGGIVETLD------FILKKY--SPQEQLDLVQYVFLTGGCVSFQNMKERMENEIMAIRP--FQSPFSVHMAEDPVLDAWHGARKWALSSALNVCSITRAEYEEKGGEYLKEHCVTNRYIPTPV 708          
BLAST of Actin-related protein 5 vs. TrEMBL
Match: A0A0L8H1G3 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22024586mg PE=3 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 1.359e-114
Identity = 267/711 (37.55%), Postives = 410/711 (57.67%), Query Frame = 3
Query:  135 FQYNSNYRD--IPIVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGIL-VGNEIEDFYAN---IRYAFDRNVVVNFDVQESVFDYAFDNLGLQT--LQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFK-KSEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNLSNLMNLI-----SSKDNMKK--KIINSMGFENEQHVMNEMKNIELLIEKLQCKIRGIDCPTKIENLEPKQKFXXXXXXXXXXXXXXXXXXXXXVMLRAAALRREQIRLMKEMKRNKILSAVNKLEESREDDFALWVMNLRHQRQSLLDNRMKKRSSLSVSMGSAGPSIGIDEXXXXXXXXXXXXXXELNEDLELKYIKKGSSQNQLEDDRYAE---DLSDDDSDTEQKQLCQLEILLNQYDPEFTKD---NNSSLKVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQEHPLSN-FFYTPL 2198
            + Y S  R+  IP+VIDNGSYQ + G+A    P L FKNV AK + KKE  L VGN+I +       +R  FDRNVV  +DVQE VFDY F++LG+ T    DHPIV++E LCNPN CRQQMSELLFE Y VP +AY  D L S   N+P+    +AN   LI+  GYQ+ H++P  NG++ A+ CR++N+GG  LDS + RLLQLKY  H   I L   E L Q    +A+NY +E+ +W   +Y+  N   IQ+PF   +E  ++ EQ +E+++Q + R KE++ KR  +KL   +++L  L  +        +D +KK  +++  MGF +   ++  M  +   I++ + KI G +   + EN E + KFDL++I D+ L  ++   K+KQ +L+AA   + Q + +++ K    ++    +E+ R  DF  W+  +R +R++LL++R  +R             I + +RR   +++  KI ++L ++ + K       QN  + D Y E   D  D DS+ E++QL +LE +L ++DPEF K+   N    + DI EYY+LHL  E+ RVPE++F+P MIG E+AGL EM++ ++           +  +   L   +FLTGS +   N  +R+  ++    P   +  + + A DP LDAW GA + AL     S S+++ +YEEMG +Y+ EH  SN +F TP+
Sbjct:   26 YTYPSGLRESAIPLVIDNGSYQCRAGWASMDKPQLIFKNVTAKQRGKKESELQVGNDISNLEVVRWILRTQFDRNVVTQYDVQEQVFDYIFNHLGIDTESCVDHPIVMSEALCNPNYCRQQMSELLFECYHVPKVAYGNDALFSLYKNHPK--PESAN--ALIVDCGYQTTHVIPFINGQIVAENCRRLNLGGLHLDSFLHRLLQLKYPNHLAAITLSRAEELVQHHTHMAVNYHEELAKWADYEYYEANVHKIQLPFTLTTEAQITLEQQKERREQHIRRLKEINAKRRLDKLQENEEHLLQLKRIQLLLEEDDEDALKKYHQVLKDMGFHSSDELLATMNKLSANIQRTRAKIHGKELTEEPENKE-ESKFDLLNIPDEMLTIEQQAAKRKQHILKAAQEGQAQAQALQQAKIQTEVAEELLMEQKRLTDFDSWLYEVRQKRKNLLESRTNRRQR----------KIDMAKRRTLASQQRMKIISQLAQNNK-KQKDDNFGQNDADWDVYKEINPDGGDTDSEVEEEQLEELETMLREHDPEFLKELEENAGIGEFDIAEYYRLHLGVERIRVPELLFQPSMIGIEQAGLSEMVDYVLKKC--------SPSEQNALVQCVFLTGSNAMFNNFNKRMERDLLAIRPFQTTFSVYRAA-DPILDAWHGARQWALSPLVHSCSVTRAMYEEMGGEYLIEHVASNRYFPTPV 711          
BLAST of Actin-related protein 5 vs. TrEMBL
Match: A0A1S3KGZ3 (actin-related protein 5-like OS=Lingula unguis OX=7574 GN=LOC106181758 PE=3 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 5.477e-114
Identity = 271/712 (38.06%), Postives = 412/712 (57.87%), Query Frame = 3
Query:  135 FQYNSNYRD--IPIVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKE-GILVGNEI---EDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQ--DHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNN--PEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFK-KSEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNLSNLMN---LISSKDNMK-KKIINSMGFENEQHVMNEMKNIELLIEKLQCKIRGIDCPTKIENLEPKQK-FXXXXXXXXXXXXXXXXXXXXXVMLRAAALRREQIRLMKEMKRNKILSAVNKLEESREDDFALWVMNLRHQRQSLLDNRMKKRSSLSVSMGSAGPSIGIDEXXXXXXXXXXXXXXELNEDLELKYIKKGSSQNQLEDDRYAE---DLSDDDSDTEQKQLCQLEILLNQYDPEFTKD---NNSSLKVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPI-IKIADDPTLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQEHPLSN-FFYTPL 2198
            F+Y  + RD  IP++IDNGSYQ + G+A D  P + FKN++A+ + KK+   L+GN+I   E     ++  FDRN+V  FD+QE V D+ F +LG+ T    DHP+V+ EP+CNPN CRQQMSELLFE Y VP +AY +D L S+  N+  PE    TAN   +++S GYQS+HLLP+ NGRL+A  CR+IN GG  LD+ M R+LQLK+  H   I L   E L ++   +A +Y  E+ +W    Y+ D+   IQ+P+  +    L+ EQ +EKK+QQ+ R KE++ K+  E+LA+ Q+ L  LM+   L++  D     K ++ + F +   +   +  +   I++ + K+ G+    K E  E KQ  +DL+D  DD L +D L++K++Q  L+AAA  R + R + E KR + L    ++EE R+ +F  W+   R +RQ LLD R +++   S           + +RR   +++  KI ++L E  + K  +     N  + + Y E      D DS+ EQ+QL +LE +L +YD EF KD    N     DI EYY+LH+STEQ R+PE++F+P ++G E+ G+ E L+      ++L  Y  +  +   L   +FLTG      N+KER+  EI    P     P  + +A+DP LDAW GA K AL +     SI++  YEE G +Y++EH ++N +  TP+
Sbjct:   24 FEYPDSLRDSRIPLIIDNGSYQCRAGWASDEKPKMIFKNLVARQRGKKDLDALIGNDIGNLEVMRWQLKSQFDRNIVTQFDLQEQVLDHLFSHLGINTQGQVDHPVVMTEPVCNPNHCRQQMSELLFEGYHVPQVAYGVDSLFSFYKNHATPE----TANG--IVVSCGYQSVHLLPVKNGRLDAGHCRRINTGGCHLDAFMHRMLQLKFPGHMAAITLSRAEELVREHTHMATDYINELEEWADVDYYEDHVHKIQLPYTAQPSNTLTAEQQKEKKEQQIRRLKEINAKKRLERLAADQERLQQLMSVQELMADDDEEAFNKALDDLEFSDPMELQEAINKLSSSIQRAKDKVMGVQT-QKEEEPETKQPVYDLLDTPDDMLTDDLLQKKKRQQFLKAAAEGRAKARKLNEEKRKQELMEEKRMEEKRKKNFQEWLAETRKKRQVLLDKRNQRKQRKS----------DMAKRRTFASQQRMKIISQLAEGEKKKKKEDTFGMNDDDWNVYKEINIRAGDSDSEMEQEQLEELETMLKEYDEEFAKDCDPQNGDGVFDIAEYYRLHVSTEQIRIPELLFQPSILGMEQGGIVETLD------FILKKY--SPQEQLDLVQYVFLTGGCVSFQNMKERMENEIMAIRP--FQSPFSVHMAEDPVLDAWHGARKWALSSALKVCSITRAEYEEKGGEYLKEHCVTNRYIPTPV 708          
BLAST of Actin-related protein 5 vs. TrEMBL
Match: A0A2B4SW19 (Actin-related protein 5 OS=Stylophora pistillata OX=50429 GN=Arp5 PE=3 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 2.646e-110
Identity = 255/730 (34.93%), Postives = 419/730 (57.40%), Query Frame = 3
Query:  135 FQYNSNYRD--IPIVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEG------ILVGNEIEDFYANIRYA----FDRNVVVNFDVQESVFDYAFDNLGLQTLQ--DHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFKK-SEKMLSNEQLEEKKK----QQMLRGKEMHLKRNQEKLASAQDNLSNLMNL--ISSKDNMK-KKIINSMGFENEQHVMNEMKNIELLIEKLQCKIRGIDCPTKIENLEPKQKFXXXXXXXXXXXXXXXXXXXXXVMLRAAALRREQI-RLMKEMKRNKILSAVNKLEESREDDFALWVMNLRHQRQSLLD---NRMKKRSSLSVSMGSAG-------------PSIGIDEXXXXXXXXXXXXXXELNEDLELKYIKKGSSQNQLEDDRYAEDLSDDDSDTEQKQLCQLEILLNQYDPEFTK--DNNSSLKVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALH-TQFDSMSISKELYEEMGHDYIQEHPLSNFFYTPL 2198
            + Y +N RD  +P+VIDNG +  + G+A D+ P L F+N++AK++ +K+G        VGN+I +    +R+A    FDR+VV +++ QE VFD+ F +LG+ TL   +HPIV+ EP+CNPN CRQ MSELLFE Y+VPS+AY ID L S  YN+P   ++TA    L++S G Q  H+LP+ NGRL+A  C++IN+GG+     M RLLQLK+  H+  I L   + L      +A +Y +E+ +W SS Y+ DN   IQ+P+ +      S  + EEK+K    +Q  R +E++ +R +EKLA  Q+ L +L+N+  + S+D+ + ++ + + GF++ + +   +KN+   I+K + KI  +    ++++ E K+K    +I D   +   ++ K++Q   + AA+  E+  + +KE K+ + +   ++ +  RE+ F  W+  L  +R+ +LD    R+++R  L+     A              P++  D   +   +K ++     N+D  + Y     S N+        D  D DS+ EQ++L +LE LL ++DP+F+K         VD  EYY+LHL  E+ RVPEI+++P M+G E+AG+ E ++      ++L+ Y  + LQT  L  N+F+TG  +K PN +ERL  E+    P   +  + K A +P LDAW GA K A   +   ++S++++ YEE G DY++EH  SN  Y P+
Sbjct:   25 YDYPANIRDNSVPLVIDNGGHCCRAGWATDNKPRLNFRNLVAKARGRKDGDASGAGYSVGNDIGNLEV-VRWALRTQFDRDVVTHYECQEQVFDHIFSHLGVNTLGSVNHPIVMTEPVCNPNYCRQSMSELLFECYNVPSVAYGIDSLFSLYYNSPNSDKTTA----LVVSSGCQVSHVLPVVNGRLDASNCKRINLGGALATWYMQRLLQLKHPHHAAQITLSRAQELVHSHGFMASDYSKELEEWASSDYYDDNVYKIQLPYAQVPTPQASGPKNEEKEKLRRQKQGRRLQEINARRREEKLAEEQERLQDLINIQELESQDSGEFQRSLAAGGFQSSEALQGAIKNLTTSIKKRKDKIVAMQTALELDS-EVKEK---DEIVDVVSEAPAVESKKRQRTPKGAAMAEEKSGKRLKEEKKQE-MQQKSQEDVQREETFKTWLTGLHRRRKEILDARQQRVQRREELASRRSQASLERMRILSQLAYDPNVRDDGTTRSSHKKPKEDTFGQNDDDWMVY----RSINK--------DAGDSDSEKEQEELNELENLLKKHDPDFSKRFGGKPETAVDWAEYYQLHLGVERIRVPEIVYQPSMLGIEQAGISETID------FILNHYSTD-LQTA-LVQNVFVTGGNTKFPNFQERLERELLAIRPFQSTFKVFKAA-NPVLDAWNGARKWAKSLSSLQAVSVTRQEYEEKGADYLKEHLASN-RYVPI 722          
BLAST of Actin-related protein 5 vs. TrEMBL
Match: A0A2C9L3L9 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106074646 PE=3 SV=1)

HSP 1 Score: 355.91 bits (912), Expect = 2.651e-108
Identity = 256/716 (35.75%), Postives = 389/716 (54.33%), Query Frame = 3
Query:  135 FQYNSNYRD--IPIVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEG----ILVGNEIEDFYAN---IRYAFDRNVVVNFDVQESVFDYAFDNLGLQT--LQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPF--KKSEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNLSNLMN----LISSKDNMKKKIINSMGFENEQHVMNEMKNIELLIEKLQCKIRGID-CPTKIENLEPKQKFXXXXXXXXXXXXXXXXXXXXXVMLRAAALRREQIRLMKEMKRNKILSAVNKLEESREDDFALWVMNLRHQRQSLLDNRMKKRSSLSVSMGSAGPSIGIDEXXXXXXXXXXXXXXELNEDLELKYIKKGS--SQNQLEDDRYAE---DLSDDDSDTEQKQLCQLEILLNQYDPEFTKD---NNSSLKVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQEHPLSN-FFYTPLT 2201
            F+Y++   +  +P+VIDNG+YQ + G+A    P L FKNV AK K KK       L+GN+I         +R  FDRN+V  FD+QE  FDY F +LG+ T    DHPIV+ E +CNPN  RQ M+ELLFE Y +P +AY +D L S  YN+P    S      LI+  GYQ+ H++P+  GR+  + CR+IN+GG  +D  + R+LQLKY  H N I +   E + +  C +A ++  E+  W  + Y   N   +Q+P   + +  +L+ EQ +E++KQQ+ R +E++ KR  +KL S +  L  L+     +++  D+     +  +G    + +   +  +   I++ + KI G +  P + EN EP   F L+DI D+ L  D+L  K++Q +L++A   R++   ++  KR K      KLEE R  DF  W+  +R +RQ +LD R  +R   S         +        + R              +   KKG    QN  + D Y E   +    DS+ E+++L +LE +L ++DPEF KD      S + D+ EYY+LHL  E+ RVPE++F+P M+G E+AGL E +E ++           N+LQTK +  ++FLTG  +   N KER+  E+ Q  P   +  I K A +P+LDAW GA K AL     S SI+++ YEEMG  Y++EH  SN +F TP+ 
Sbjct:   29 FEYDAALHENGVPLVIDNGTYQCRAGWASSQAPNLLFKNVTAKQKGKKSQNETETLIGNDITSMEVAKWILRSQFDRNIVTLFDIQEQTFDYLFSHLGISTEGCVDHPIVLTEAVCNPNYTRQLMNELLFECYHIPQVAYGVDSLFSLYYNHP----SPETADALIVDCGYQATHVVPVIGGRIYPEQCRRINIGGGYIDWFLQRILQLKYPGHVNAITINRVEEMIRDHCYMATDFLAELSLWNDNNYFEANVRKMQLPLGQQAASSLLTAEQQKERRKQQIARLQEVNTKRRLDKLQSDEAELQKLLEVQELIVTGDDDAFTSALAEVGLNRVEDLQEAVDRLSADIQRAKAKILGQEPAPIEQENKEP--SFPLLDIPDEMLTPDQLAIKKRQKILKSAREGRKKALALQREKRQKEWEEEKKLEERRRVDFNGWLAEVRAKRQKILDARNARRQKKS--------DMTKRRTYAAQQRMRIISQLAARACYRISPPKKGDNFGQNDADWDVYKEINREGGTSDSEAEEEKLEELETMLKEHDPEFQKDVDLGGLSGEFDVAEYYRLHLGVERIRVPELLFQPSMLGLEQAGLSETMEFILGRL-------PNNLQTK-VVQHVFLTGGNANFFNFKERIDRELLQIRPFQSTYNIFK-AGNPSLDAWNGARKFALSPFLASSSITRKDYEEMGDGYLREHVASNRYFPTPIV 721          
BLAST of Actin-related protein 5 vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 100.138 bits (248), Expect = 2.844e-22
Identity = 55/236 (23.31%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASS 233          

HSP 2 Score: 55.4546 bits (132), Expect = 1.050e-7
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  248 ITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 371          
BLAST of Actin-related protein 5 vs. Ensembl Cavefish
Match: actb2 (actin beta [Source:NCBI gene;Acc:103030443])

HSP 1 Score: 100.138 bits (248), Expect = 2.924e-22
Identity = 55/236 (23.31%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASS 233          

HSP 2 Score: 55.4546 bits (132), Expect = 1.087e-7
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  248 ITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 371          
BLAST of Actin-related protein 5 vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 99.7525 bits (247), Expect = 4.383e-22
Identity = 55/236 (23.31%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:   10 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASS 235          

HSP 2 Score: 55.8398 bits (133), Expect = 9.940e-8
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  250 ITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 373          
BLAST of Actin-related protein 5 vs. Ensembl Cavefish
Match: actc1c (actin, alpha cardiac muscle 1 [Source:NCBI gene;Acc:103039206])

HSP 1 Score: 96.6709 bits (239), Expect = 4.434e-21
Identity = 55/236 (23.31%), Postives = 113/236 (47.88%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  ++ N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++VP++   I  + S        L ++   T ++L  G    H +P++ G        ++++ G  L   +M++L  +        +  +   +++K C +AL++  EM    SS
Sbjct:   10 LVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLS--------LYASGRTTGIVLDAGDGVTHNVPVYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASS 235          

HSP 2 Score: 58.151 bits (139), Expect = 1.737e-8
Identity = 42/136 (30.88%), Postives = 61/136 (44.85%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  IG E AG+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IK+   P      W G   LA  + F  M ISK+ YEE G   + 
Sbjct:  250 ITIGNERFRCPETLFQPSFIGMESAGIHETTYNGIM---------KCDIDIRKDLYANNVLSGGTTMYPGIGDRMQKEITALAPSTMK---IKMIAPPERKYSVWIGGSILASLSTFQQMWISKDEYEEAGPSIVH 373          
BLAST of Actin-related protein 5 vs. Ensembl Cavefish
Match: actr1 (beta-centractin [Source:NCBI gene;Acc:103036907])

HSP 1 Score: 95.1301 bits (235), Expect = 1.371e-20
Identity = 62/241 (25.73%), Postives = 123/241 (51.04%), Query Frame = 3
Query:  165 PIVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKK------EG-ILVGNEIEDFYA--NIRYAFDRNVVVNFDVQESVFDYAFDNLGLQTL-QDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLK--YSCHSNIIDLRMGEYLQQKTCSLALN-YRQEMMQWKSSKY 848
            P+VIDNGS   K GFA D  P   F N + + K  +      EG + +G + E+     ++RY  +  +V +++  E ++ Y +    LQT  ++HP+++ E   NP+  R++ +E+ FE ++VP++   +  + S        L +T   T ++L  G    H +P++ G        ++++ G  + S  +RLL  K  Y  H++  +  +   ++++ C L+LN  + E ++ + ++Y
Sbjct:   11 PVVIDNGSGAIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDLFIGPKAEEHRGLLSVRYPMEHGIVKDWNDMERIWQYVYSKEQLQTFSEEHPVLLTEAPLNPSKNRERAAEVFFETFNVPALFISMQAVLS--------LYATGRTTGVVLDAGDGVTHAVPIYEGFAIPHSIMRVDIAGRDV-SRYLRLLLRKEGYDFHTS-AEFEVVRTMKERACYLSLNPQKDETLETEKAQY 241          

HSP 2 Score: 51.6026 bits (122), Expect = 2.198e-6
Identity = 39/126 (30.95%), Postives = 60/126 (47.62%), Query Frame = 3
Query: 1770 LSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIA--DDPTLDAWRGACKLALHTQFDSMSISKELYEE 2141
            +   +FR PE++F+P ++G E  G+ E+L   I  S      D +  +T  L  NI L+G  +      +RL  E+++  P    D  IKI+   +     W G   LA    F  M +SK+ YEE
Sbjct:  251 IGPARFRAPELLFRPDLVGDESEGIHEVLAFAIQKS------DMDLRRT--LFSNIVLSGGSTLFKGFGDRLLSEVKKLAP---KDVKIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEE 365          
BLAST of Actin-related protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011113.1 (pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene:ENSPMAG00000010086.1 transcript:ENSPMAT00000011113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 7.784e-23
Identity = 55/236 (23.31%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    9 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 234          

HSP 2 Score: 55.4546 bits (132), Expect = 2.273e-8
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  249 ITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 372          
BLAST of Actin-related protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004586.1 (pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 gene:ENSPMAG00000004161.1 transcript:ENSPMAT00000004586.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.6709 bits (239), Expect = 8.329e-22
Identity = 55/236 (23.31%), Postives = 113/236 (47.88%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++       +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    9 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGHPL--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 234          

HSP 2 Score: 55.4546 bits (132), Expect = 2.482e-8
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  249 ITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 372          
BLAST of Actin-related protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011230.1 (pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1 gene:ENSPMAG00000010203.1 transcript:ENSPMAT00000011230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 2.223e-13
Identity = 49/237 (20.68%), Postives = 106/237 (44.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGIL----------------VGNE--IEDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEM 824
            +V+DNGS   K GFA ++ P     +++ + + +   ++                +G +        ++RY  +R +V  +D  E V+ +A++       QD P+++ E   NP   R+Q ++LLFE +  P++   +  + S        L ++   T L +  G    H +P+F G    +   + +V G  +   + R+L  +     +  +  +   ++++ C +A +Y +E+
Sbjct:   10 VVMDNGSGLCKAGFAGENAPRFCVPSLVGRPRQRDTMLVSRGLDDAGGSGDGGCYIGRQALCRRGVLSLRYPVERGIVTRWDDMERVWAHAYEAELHARPQDQPVLLTEAPLNPLENREQAAQLLFERFGAPAVHIAVQAVLS--------LYASGMVTGLAVGVGDGVTHAVPVFEGYGLPRAVLRSDVAGRDVTDNLGRILAERGHAFVSSAEWEIVADIKEQVCYVAGDYEKEL 238          

HSP 2 Score: 57.3806 bits (137), Expect = 6.760e-9
Identity = 37/135 (27.41%), Postives = 63/135 (46.67%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + L +++FR PE++F P ++G +  G+ +++   +  S +        L+ K L  NI L+G  S  P L ERL+ E+ +  P       ++I   P      W G   LA  + F  M I+   Y+E G   + 
Sbjct:  257 ITLHSQRFRAPELLFSPTIVGLDAPGIHQLVWKSVTRSDI-------DLR-KSLYSNILLSGGSSLFPGLDERLWQELAKLAPRGAP---VRIFAPPERKYSVWIGGSILASLSTFQQMWITAPEYKEFGPSVVH 380          
BLAST of Actin-related protein 5 vs. Ensembl Sea Lamprey
Match: actr6 (actin related protein 6 [Source:ZFIN;Acc:ZDB-GENE-030131-3543])

HSP 1 Score: 68.9366 bits (167), Expect = 1.227e-12
Identity = 41/138 (29.71%), Postives = 68/138 (49.28%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLING---SYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALHTQF-DSMSISKELYEEMGHDYIQE 2165
            L L+ E+F VPEI+F P  IG +E G+ E + + +         H+Y           +NI LTG  S +P  ++R+  ++R   P      + +  D+P   AW G   L+    F +S+ ++++ YEE GH+   E
Sbjct:  267 LRLTNERFAVPEILFHPSDIGVQEMGIPEAVTHAVQSLPQEMHPHMY-----------NNILLTGGGSLLPGYRDRVLADVRSLTPDEYEVAVTQ-PDNPITHAWEGGVMLSGTPDFSNSLVVTRQEYEERGHEACDE 392          

HSP 2 Score: 64.6994 bits (156), Expect = 3.235e-11
Identity = 52/197 (26.40%), Postives = 98/197 (49.75%), Query Frame = 3
Query:  162 IPIVIDNGSYQFKCGFAIDSC---PYLEFKNVIAKSKSKKEGILVGNEIEDFYANIRY--AFDRNVVVNFDVQESVFDYAFDNLGLQTLQ-DHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYY-IDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLK 731
            + +V+DNG+Y  K G+A DS    P L+ ++  A+       +   +EI+D  + + +   F +  +VN+DVQ  V+D+ F     + +     I    P  N ++ ++ M+E+LFE Y   SI       L++Y+Y      +  +    LI+  G+   H++P + G+   +  R+INVGG  L + +  ++  +
Sbjct:    2 VVLVLDNGAYTAKIGYAGDSVRNIPKLKIRSKKARKTFTASQL---DEIKD-PSGLYFILPFQKGYLVNWDVQRQVWDHLFGKEMYKVMVVSRNIFFGCPYFNFHSIQESMNEILFEEYQFRSILRTNAATLSAYSYQQ----QKPSELCCLIIESGFSFTHIVPFYRGKKIKEGIRRINVGGKLLTNHLKEIISYR 190          
BLAST of Actin-related protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008200.1 (pep scaffold:Pmarinus_7.0:GL477804:3783:17322:1 gene:ENSPMAG00000007412.1 transcript:ENSPMAT00000008200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 2.330e-9
Identity = 44/193 (22.80%), Postives = 91/193 (47.15%), Query Frame = 3
Query:  198 KCGFAIDSCPYLEFKNVIAKS---KSKKEG------ILVGNEIEDFYA--NIRYAFDRNVVVNFDVQESVFDYAF--DNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYS 737
            KCG+A  + P   F  ++ +     + K G      ++VG++  +  +   + Y  +  +V N+D  + ++DY F  D L + T ++  I++ EP  NP   R+++ E++FE Y   ++   I  + +  Y     L     D+      G    H+ P++ G     L R++++ G  +   ++++L L +S
Sbjct:    3 KCGYAGSNFPEHIFPALVGRPIIRSTAKVGNIEIKDLMVGDDASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPDKLNVNT-RECKILLTEPPMNPMKNREKIIEVMFEQYGFSAVYIAIQAVLTL-YAQAGLLTGVVVDS------GDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKVLWLNHS 187          
BLAST of Actin-related protein 5 vs. Ensembl Yeast
Match: ARP5 (Nuclear actin-related protein involved in chromatin remodeling; component of chromatin-remodeling enzyme complexes; promotes nucleosome shifts in the 3 prime direction [Source:SGD;Acc:S000005004])

HSP 1 Score: 207.608 bits (527), Expect = 1.304e-57
Identity = 204/741 (27.53%), Postives = 356/741 (48.04%), Query Frame = 3
Query:  165 PIVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKK---EGILVGNEI---EDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQD--HPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFKKS-EKMLSNEQLE---EKKKQQMLRGKEMHLKRNQEKLASAQDNLSNLMNLISS-KDNMKKKIINSM---GFENEQHVMNEMKNIELLIEKLQCKIRGIDCPTKIENLEPK--QKFXXXXXXXXXXXXXXXXXXXXXVMLRAAALRREQIRLMKEMKRNKILSAVNKLEESREDDFALWVMNLRHQRQSLLDNRMKKRSSLSVSMGSAGPSIGIDEXXXXXXXXXXXXXXELNEDLELKYIKKGSSQNQLEDDRYAEDLSDDDSDT---------------------------EQKQLCQLEILLNQYDPEFTKDNNSSLKVD--------------------IEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALH-TQFDSMSISKELYEEMGHDYIQEHPLSNFFY 2189
            PI ID GS + + GF   + P   F N + K + +K       VGN+    +   +  R  FD   V N+++ E + DY F +LG+       +PI++ E L    + R    ++LFE Y+VP + + ID L S+   NP     + N T L++S G++  +++P+ +G       ++IN GG Q    +  L+ LKY      +     E + +  C ++ NY +++ +  + +    N ++++ PF +  +   + E+L    EK+K+   R +E    +  EKL   Q+       +     D  KKK+++ +   GF++E+     + ++E  ++K Q  +   D     E  E K  QKFDL+DI+D++L+ED++K+K+KQ  L+A+   R++ +  KE    +      K ++ RE D   W+ + R +   L+  R K++  L   M      +          +   K  A L ED     +K+G+ +N     R+   + +D +DT                           E K + +LE LL ++DP FT+++    + D                    I E +++HL+ E+ RVPE+IF+P M G ++AG+ E+ E ++   +      K S  +  + +N+ +TG  +K+P LKER+  E   FLPT  ++  + ++ DP+LDAW+G   LA +  Q+    ISK+ YEE G +YI+EH L N  Y
Sbjct:   39 PIAIDFGSSKLRAGFVNHATPTHIFPNALTKFRDRKLNKNFTFVGNDTLLDQAVRSQSRSPFDGPFVTNWNLTEEILDYTFHHLGVVPDNGIPNPILLTERLATVQSQRTNWYQILFETYNVPGVTFGIDSLFSFYNYNP-----SGNKTGLVISCGHEDTNVIPVVDGAGILTDAKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYKDYCYVSRNYDEDIEKILTLENLDTNDVVVEAPFTEVLQPQKTEEELRIQAEKRKETGKRLQEQARLKRMEKLVQKQEEFEYFSKVRDQLIDEPKKKVLSVLQNAGFDDERDFKKYLHSLEQSLKKAQM-VEAEDDSHLDEMNEDKTAQKFDLLDIADEDLNEDQIKEKRKQRFLKASQDARQKAKEEKERVAKEEEEKKLKEQQWRETDLNGWIKDKRLKLNKLI-KRRKEKLKLRDEMKDRKSQVS---------QNRMKNLASLAED----NVKQGAKRN-----RHQATIDNDPNDTFGANDEDWLIYTDITQNPEAFEEALEYEYKDIVELERLLLEHDPNFTEEDTLEAQYDWRNSILHLFLRGPRPHDSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQP-GKLSQTSIDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTG-TNITVNMSSDPSLDAWKGMAALARNEEQYRKTVISKKEYEEYGPEYIKEHKLGNTKY 752          
BLAST of Actin-related protein 5 vs. Ensembl Yeast
Match: ACT1 (Actin; structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions [Source:SGD;Acc:S000001855])

HSP 1 Score: 107.457 bits (267), Expect = 1.691e-25
Identity = 61/230 (26.52%), Postives = 115/230 (50.00%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEM 824
            +VIDNGS   K GFA D  P   F +++ + +   +GI+VG   +D Y             +RY  +  +V N+D  E ++ + F N      ++HP+++ E   NP + R++M++++FE ++VP+    I  + S        L S+   T ++L  G    H++P++ G        +I++ G  L   +M++L  +    S   +  +   +++K C +AL++ QEM
Sbjct:    8 LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLS--------LYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEM 227          

HSP 2 Score: 63.1586 bits (152), Expect = 5.094e-11
Identity = 46/148 (31.08%), Postives = 68/148 (45.95%), Query Frame = 3
Query: 1746 IEEYYKL------HLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            IE+ Y+L       +  E+FR PE +F P ++G E AG+ +   N I          K  +   K+L  NI ++G  +  P + ER+  EI    P+S+    +KI   P      W G   LA  T F  M ISK+ Y+E G   + 
Sbjct:  236 IEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIM---------KCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMK---VKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVH 371          
BLAST of Actin-related protein 5 vs. Ensembl Yeast
Match: ARP1 (Actin-related protein of the dynactin complex; required for spindle orientation and nuclear migration; forms actin-like short filament composed of 9 or 10 Arp1p monomers; putative ortholog of mammalian centractin [Source:SGD;Acc:S000001171])

HSP 1 Score: 77.7962 bits (190), Expect = 1.154e-15
Identity = 64/235 (27.23%), Postives = 115/235 (48.94%), Query Frame = 3
Query:  165 PIVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKK---EGI----LVGNEIEDFYA--NIRYAFDRNVVVNFDVQESVFDYAFDN-LGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLE--STANDTVLILSFGYQSIHLLPLFNG-RLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNII---DLRMGEYLQQKTCSLALNYRQE 821
            P+VIDNGS   K GF+ +  P      ++  +K  K   EG+     +GN  +       +RY     VV ++D  E ++ Y  +  L LQ + +HP++I E   NP   R+QM+++LFE +DV   A Y+        +NP  L   ++   T  ++  G      +P+++G  L A + R +++GG+ +   +    QL+ S   ++    +  +   +++K C LA N ++E
Sbjct:   14 PVVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGLLKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNPLKNREQMAQVLFETFDVS--ALYV--------SNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASMMR-MDIGGADITEQLQ--FQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKE 235          
BLAST of Actin-related protein 5 vs. Ensembl Yeast
Match: ARP2 (Essential component of the Arp2/3 complex; Arp2/3 is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity; required for efficient Golgi-to-ER trafficking in COPI mutants [Source:SGD;Acc:S000002187])

HSP 1 Score: 76.2554 bits (186), Expect = 3.542e-15
Identity = 54/227 (23.79%), Postives = 105/227 (46.26%), Query Frame = 3
Query:  165 PIVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKE----------GILVGNEIEDF--YANIRYAFDRNVVVNFDVQESVFDYAF-DNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDG-LASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLA 803
            PIV+D G+   K G A ++ P   F +++ +   + E           I++G+E  +   Y  I Y  +  ++ N+   E ++DYAF + + L +  +  I++ EP  NP   R++M E++FE YD   +   I   LA YA      +   + D V          H++P++   + + L R+++V G  +   ++ LL  +    +   D      +++K C ++
Sbjct:    6 PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGV---------THIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVS 223          

HSP 2 Score: 46.9802 bits (110), Expect = 6.559e-6
Identity = 38/139 (27.34%), Postives = 64/139 (46.04%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFL--------PTSLSDPIIKIADDPT---LDAWRGACKLALHTQFDSMSISKELYEEMG 2147
            + +  E+F  PE +F+P ++  E+ G+GE+L N +  + +    D  S     L   I L+G  S  P L  RL  E++Q          P+ L    ++I D P    +    GA   ++    D M +SK+ ++E G
Sbjct:  251 IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADV----DIRS----SLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESG 381          
BLAST of Actin-related protein 5 vs. Ensembl Yeast
Match: ARP6 (Actin-related protein that binds nucleosomes; a component of the SWR1 complex, which exchanges histone variant H2AZ (Htz1p) for chromatin-bound histone H2A [Source:SGD;Acc:S000004075])

HSP 1 Score: 47.7506 bits (112), Expect = 4.791e-6
Identity = 51/242 (21.07%), Postives = 96/242 (39.67%), Query Frame = 3
Query:  165 PIVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDF----YANIRYAFDRNVVVNFDVQESVFDYA------FDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPS-----IAYYIDGLASY-----------------------------AYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIID 758
            PIVIDNGSY+ K G + +  P   F+ + A +K K     + N I++         R   +   +  ++++  ++DY       FD   L+  + H +V +E         +   +++FE Y+  S     +A ++    SY                                N +   S  +D  L++  G+    ++P+  G    K  +K+++GG  L  L+   L  +   H N++D
Sbjct:    5 PIVIDNGSYEIKFGPSTNKKP---FRALNALAKDKFGTSYLSNHIKNIKDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLPELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNAQDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFR---HYNMMD 240          
BLAST of Actin-related protein 5 vs. Ensembl Nematostella
Match: EDO48687 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RID7])

HSP 1 Score: 105.531 bits (262), Expect = 1.663e-24
Identity = 66/249 (26.51%), Postives = 124/249 (49.80%), Query Frame = 3
Query:  165 PIVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKK------EG-ILVGNEIEDFYA--NIRYAFDRNVVVNFDVQESVFDYAFDNLGLQTL-QDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALN-YRQEMMQWKSSKYHADNSLIIQM 878
            PIVIDNGS   K GFA D  P   F N + + K  +      EG + +G + E+     NIRY  +  V+ +++  E ++ Y +    LQT  ++HP+++ E   NP   R++ +E+ FE ++VP++   +  + S        L +T   T ++L  G    H +P++ G        + ++ G  +   +  LL+ +  C  +  +L +   ++++ C LALN  ++E M+ +  +Y   +  II++
Sbjct:   11 PIVIDNGSGVIKAGFAGDQVPKYHFANFVGRPKHVRVMAGALEGDVFIGPKAEEHRGLLNIRYPMEHGVIRDWNDMERIWQYIYSKDQLQTFSEEHPVLLTEAPLNPRRNREKAAEVFFETFNVPALFISMQAVLS--------LYATGRTTGVVLDAGDGVSHSVPIYEGFAMPHSIMRTDIAGRDVSRYLRLLLRKEGHCFHSSSELEIVRTIKERACYLALNPQKEESMESERQQYALPDGSIIEI 251          

HSP 2 Score: 51.9878 bits (123), Expect = 6.010e-7
Identity = 37/131 (28.24%), Postives = 62/131 (47.33%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQ-LADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIA--DDPTLDAWRGACKLALHTQFDSMSISKELYEEMG 2147
            + +   +FR PE++F+P +IG E  G+ E+L   I          K+ L  ++ L  NI L+G  +      +RL  E+++  P  +    I+I+   +     W G   LA    F  M +SK+ Y+E G
Sbjct:  249 IEIGQARFRAPELLFRPDLIGDESEGIHEVLAFAIQ---------KSDLDLRRVLYSNIVLSGGSTLFKGFGDRLLSEVKKLAPKDIK---IRISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYDEEG 367          
BLAST of Actin-related protein 5 vs. Ensembl Nematostella
Match: EDO45013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU31])

HSP 1 Score: 100.523 bits (249), Expect = 9.734e-23
Identity = 55/236 (23.31%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASS 233          

HSP 2 Score: 55.8398 bits (133), Expect = 2.943e-8
Identity = 41/136 (30.15%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E AG+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P ++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  248 ITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIM---------KCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 371          
BLAST of Actin-related protein 5 vs. Ensembl Nematostella
Match: EDO38520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCN8])

HSP 1 Score: 100.138 bits (248), Expect = 1.154e-22
Identity = 55/236 (23.31%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    9 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMTTAASS 234          

HSP 2 Score: 57.3806 bits (137), Expect = 9.151e-9
Identity = 51/177 (28.81%), Postives = 78/177 (44.07%), Query Frame = 3
Query: 1659 QKQLCQLEILLNQYDPEFTKDNNSSLKVDIEEYYKL------HLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            +++LC + +   Q   E T   +SS    +E+ Y+L       +  E+FR PE +F+P  +G E AG+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P ++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  214 KEKLCYVALDFEQ---EMTTAASSS---SLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIM---------KCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISALAPPTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 372          
BLAST of Actin-related protein 5 vs. Ensembl Nematostella
Match: EDO37976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEA7])

HSP 1 Score: 100.138 bits (248), Expect = 1.289e-22
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +VIDNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    9 LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASS 234          

HSP 2 Score: 53.9138 bits (128), Expect = 1.260e-7
Identity = 43/143 (30.07%), Postives = 64/143 (44.76%), Query Frame = 3
Query: 1746 IEEYYKL------HLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMG 2147
            IE+ Y+L       +  E+FR PE + +P  +G E +G+ E   N I          K  +   K L  N  ++G  +  P L +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G
Sbjct:  237 IEKSYELPDGQVITIGNERFRCPEALLQPSFLGMESSGIHETTYNSIM---------KCDVDIRKDLYANTVMSGGTTMYPGLADRMQKEISALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367          
BLAST of Actin-related protein 5 vs. Ensembl Nematostella
Match: EDO42646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0V7])

HSP 1 Score: 99.7525 bits (247), Expect = 1.531e-22
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +VIDNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAIIRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMETAASS 233          

HSP 2 Score: 55.8398 bits (133), Expect = 2.841e-8
Identity = 41/136 (30.15%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E AG+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P ++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  248 ITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIM---------KCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 371          
BLAST of Actin-related protein 5 vs. Ensembl Medaka
Match: actr5 (actin related protein 5 [Source:NCBI gene;Acc:101173304])

HSP 1 Score: 215.698 bits (548), Expect = 1.080e-60
Identity = 121/306 (39.54%), Postives = 187/306 (61.11%), Query Frame = 3
Query:  150 NYRDIPIVIDNGSYQFKCGFAIDSCPY----LEFKNVIAKSK-SKKEGILVGNEI---EDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQD--HPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDL-RMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPF--KKSEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNLSNLMNL 1028
            N    PIVIDNGS+Q + G+A  +       L+F++V A+S+ + +    +GN+I   E     ++  FDRNVVVNF++QE +FDY F +LG+ +     HPIV+ E  CNP  CRQ MSELLFE Y VP ++Y +DGL S+ +NN    +     T +ILS GY   H+LP+ N RL+A  C+++NV GSQ  S + RLLQLKY  H + I L RM E L + + + A++Y +EM +W+S +++      +Q+ F  K     ++ E+ +E++ QQ+ R +E++ +R +E+L   Q+ L  L+ +
Sbjct:   33 NPTPAPIVIDNGSFQTRAGWAASAAELSSLLLQFRSVAARSRGAARSETQIGNDIPNLEPLRWLLKSQFDRNVVVNFEIQELIFDYIFTHLGINSEGSVKHPIVLTEAPCNPLHCRQMMSELLFECYSVPYVSYGVDGLYSFYHNN-ALRKQQPPHTGIILSSGYHCSHILPVINSRLDAVNCKRVNVAGSQASSYLQRLLQLKYPGHLSSITLSRMEELLHEHSYT-AVDYHEEMEKWRSPEFYEREVHRMQLSFSGKLPSGCVTAEERQERRAQQLRRLQEINARRREERLQQDQERLDRLLAV 336          

HSP 2 Score: 92.8189 bits (229), Expect = 3.475e-19
Identity = 58/161 (36.02%), Postives = 91/161 (56.52%), Query Frame = 3
Query: 1713 TKDNNSSLKVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLAL-HTQFDSMS--ISKELYEEMGHDYIQEHPLSNFF 2186
            T+ +  +++ ++ +Y++L + TE+ R PEI+F+P +IG E+ GL E L+      Y+L  Y     Q + L  N+FLTG   + P +KER+  E+    P   S   + +A  P LDAW GA   AL H   +++   IS++ YEE G +Y+ EH  SN F
Sbjct:  391 TESDLENMQSNLTKYHQLFVGTERLRCPEILFQPSLIGEEQMGLMETLQ------YVLARYTPE--QQEALVSNVFLTGGNIQYPGMKERIERELLAMRPFQ-SHFKVTMASRPALDAWYGARDWALEHPPGEALEGWISRQDYEEKGGEYLSEHCASNIF 542          
BLAST of Actin-related protein 5 vs. Ensembl Medaka
Match: ENSORLT00000029375.1 (actin, cytoplasmic 2 [Source:NCBI gene;Acc:101168921])

HSP 1 Score: 100.908 bits (250), Expect = 1.623e-22
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +VIDNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASS 233          

HSP 2 Score: 56.9954 bits (136), Expect = 3.856e-8
Identity = 41/136 (30.15%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    PT++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  248 ITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPTTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 371          
BLAST of Actin-related protein 5 vs. Ensembl Medaka
Match: ENSORLT00000011677.2 (actin, cytoplasmic 2 [Source:NCBI gene;Acc:101168921])

HSP 1 Score: 101.293 bits (251), Expect = 2.075e-22
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +VIDNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:   43 LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASS 268          

HSP 2 Score: 56.9954 bits (136), Expect = 4.598e-8
Identity = 41/136 (30.15%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    PT++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  283 ITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPTTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 406          
BLAST of Actin-related protein 5 vs. Ensembl Medaka
Match: ENSORLT00000021726.2 (actin, cytoplasmic [Source:NCBI gene;Acc:101155523])

HSP 1 Score: 99.3673 bits (246), Expect = 6.084e-22
Identity = 55/236 (23.31%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASS 233          

HSP 2 Score: 56.6102 bits (135), Expect = 4.559e-8
Identity = 41/131 (31.30%), Postives = 59/131 (45.04%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMG 2147
            + +  E+FR PE +F+P  +G E AG+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P ++    IKI   P      W G   LA  + F  M ISK+ Y+E G
Sbjct:  248 ITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPPTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 366          
BLAST of Actin-related protein 5 vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 98.9821 bits (245), Expect = 7.237e-22
Identity = 55/236 (23.31%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T +++  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:   10 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLS--------LYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASS 235          

HSP 2 Score: 55.8398 bits (133), Expect = 7.789e-8
Identity = 40/136 (29.41%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E  G+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  250 ITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIM---------KCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH 373          
BLAST of Actin-related protein 5 vs. Planmine SMEST
Match: SMESG000077218.1 (SMESG000077218.1)

HSP 1 Score: 1379.39 bits (3569), Expect = 0.000e+0
Identity = 710/712 (99.72%), Postives = 712/712 (100.00%), Query Frame = 3
Query:   87 MLDLTDLYIQQKSINKFQYNSNYRDIPIVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFKKSEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNLSNLMNLISSKDNMKKKIINSMGFENEQHVMNEMKNIELLIEKLQCKIRGIDCPTKIENLEPKQKFXXXXXXXXXXXXXXXXXXXXXVMLRAAALRREQIRLMKEMKRNKILSAVNKLEESREDDFALWVMNLRHQRQSLLDNRMKKRSSLSVSMGSAGPSIGIDEXXXXXXXXXXXXXXELNEDLELKYIKKGSSQNQLEDDRYAEDLSDDDSDTEQKQLCQLEILLNQYDPEFTKDNNSSLKVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQEHPLSNFFYTPLTDVDEMSC 2222
            MLDLTDLYIQQKSINKFQYNSNYRDIPIVIDNGSYQFKCGFAID+CPYLEFKNVIAKSKSKKEGILVGNEIEDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFKKSEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNLSNLMNLISSKDNMKKKIINSMGFENEQHVMNEMKNIELLIEKLQCKIRGIDCPTK+ENLEPKQKFDLIDISDDELDEDELKQKQKQVMLRAAALRREQIRLMKEMKRNKILSAVNKLEESREDDFALWVMNLRHQRQSLLDNRMKKRSSLSVSMGSAGPSIGIDERRQQKARKIRKIAAELNEDLELKYIKKGSSQNQLEDDRYAEDLSDDDSDTEQKQLCQLEILLNQYDPEFTKDNNSSLKVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQEHPLSNFFYTPLTDVDEMSC
Sbjct:    1 MLDLTDLYIQQKSINKFQYNSNYRDIPIVIDNGSYQFKCGFAIDNCPYLEFKNVIAKSKSKKEGILVGNEIEDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFKKSEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNLSNLMNLISSKDNMKKKIINSMGFENEQHVMNEMKNIELLIEKLQCKIRGIDCPTKMENLEPKQKFDLIDISDDELDEDELKQKQKQVMLRAAALRREQIRLMKEMKRNKILSAVNKLEESREDDFALWVMNLRHQRQSLLDNRMKKRSSLSVSMGSAGPSIGIDERRQQKARKIRKIAAELNEDLELKYIKKGSSQNQLEDDRYAEDLSDDDSDTEQKQLCQLEILLNQYDPEFTKDNNSSLKVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQEHPLSNFFYTPLTDVDEMSC 712          
BLAST of Actin-related protein 5 vs. Planmine SMEST
Match: SMESG000077218.1 (SMESG000077218.1)

HSP 1 Score: 1362.44 bits (3525), Expect = 0.000e+0
Identity = 705/712 (99.02%), Postives = 707/712 (99.30%), Query Frame = 3
Query:   87 MLDLTDLYIQQKSINKFQYNSNYRDIPIVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFKKSEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNLSNLMNLISSKDNMKKKIINSMGFENEQHVMNEMKNIELLIEKLQCKIRGIDCPTKIENLEPKQKFXXXXXXXXXXXXXXXXXXXXXVMLRAAALRREQIRLMKEMKRNKILSAVNKLEESREDDFALWVMNLRHQRQSLLDNRMKKRSSLSVSMGSAGPSIGIDEXXXXXXXXXXXXXXELNEDLELKYIKKGSSQNQLEDDRYAEDLSDDDSDTEQKQLCQLEILLNQYDPEFTKDNNSSLKVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQEHPLSNFFYTPLTDVDEMSC 2222
            MLDLTDLYIQQKSINKFQYNSNYRDIPIVIDNGSYQFKCGFAID+CPYLEFKNVIAKSKSKKEGILVGNEIEDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFKKSEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNLSNLMNLISSKDNMKKKIINSMGFENEQHVMNEMKNIELLIEKLQCKIRGIDCPTK+ENLEPKQKFDLIDISDDELDEDELKQKQKQVMLRAAALRREQIRLMKEMKRNKILSAVNKLEESREDDFALWVMNLRHQRQSLLDNRMKKRSSLSVSMGSAGPSIGIDERRQQKARKIRKIAAELNEDLEL     GSSQNQLEDDRYAEDLSDDDSDTEQKQLCQLEILLNQYDPEFTKDNNSSLKVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQEHPLSNFFYTPLTDVDEMSC
Sbjct:    1 MLDLTDLYIQQKSINKFQYNSNYRDIPIVIDNGSYQFKCGFAIDNCPYLEFKNVIAKSKSKKEGILVGNEIEDFYANIRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSSKYHADNSLIIQMPFKKSEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEKLASAQDNLSNLMNLISSKDNMKKKIINSMGFENEQHVMNEMKNIELLIEKLQCKIRGIDCPTKMENLEPKQKFDLIDISDDELDEDELKQKQKQVMLRAAALRREQIRLMKEMKRNKILSAVNKLEESREDDFALWVMNLRHQRQSLLDNRMKKRSSLSVSMGSAGPSIGIDERRQQKARKIRKIAAELNEDLEL-----GSSQNQLEDDRYAEDLSDDDSDTEQKQLCQLEILLNQYDPEFTKDNNSSLKVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDPTLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQEHPLSNFFYTPLTDVDEMSC 707          
BLAST of Actin-related protein 5 vs. Planmine SMEST
Match: SMESG000020125.1 (SMESG000020125.1)

HSP 1 Score: 103.219 bits (256), Expect = 1.919e-23
Identity = 61/237 (25.74%), Postives = 118/237 (49.79%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNG-RLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +VIDNGS   K GFA D  P   F ++I + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HPI++ E   NP   R++M++++FE ++VP++   I  + S        L ++   T ++L  G    H +P++ G  L   +CR I++ G  L   +M+++  +    +   +  +   +++K   +AL++ QEM    S+
Sbjct:    8 LVIDNGSGMCKAGFAGDDAPRAVFPSIIGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNEMRTAPEEHPILLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLS--------LYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAICR-IDLAGRDLTDYLMKIMTERGYSFTTTAEREIVRDIKEKLSYIALDFEQEMQSASST 233          

HSP 2 Score: 59.3066 bits (142), Expect = 4.706e-9
Identity = 42/136 (30.88%), Postives = 62/136 (45.59%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E AG+ E   N I          K  +   K L  NI L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  248 ITIGNERFRCPESLFQPSFLGMESAGIHETTYNSIM---------KCDVDIRKDLYSNIVLSGGSTMFPGISDRMQKEISSLAPSTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVH 371          
BLAST of Actin-related protein 5 vs. Planmine SMEST
Match: SMESG000012317.1 (SMESG000012317.1)

HSP 1 Score: 102.064 bits (253), Expect = 5.414e-23
Identity = 60/237 (25.32%), Postives = 118/237 (49.79%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNG-RLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +VIDNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T ++L  G    H +P++ G  L   +CR +++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    8 LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLS--------LYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICR-MDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASS 233          

HSP 2 Score: 56.225 bits (134), Expect = 4.235e-8
Identity = 41/136 (30.15%), Postives = 60/136 (44.12%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E AG+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P ++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  248 ITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIM---------KCDVDIRKDLYSNTVLSGGSTMYPGIADRMQKEISALAPPTMK---IKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVH 371          
BLAST of Actin-related protein 5 vs. Planmine SMEST
Match: SMESG000066035.1 (SMESG000066035.1)

HSP 1 Score: 102.064 bits (253), Expect = 5.909e-23
Identity = 56/236 (23.73%), Postives = 115/236 (48.73%), Query Frame = 3
Query:  168 IVIDNGSYQFKCGFAIDSCPYLEFKNVIAKSKSKKEGILVGNEIEDFYAN-----------IRYAFDRNVVVNFDVQESVFDYAFDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGLASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVGGSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWKSS 842
            +V+DNGS   K GFA D  P   F +++ + +   +G++VG   +D Y             ++Y  +  +V N+D  E ++ + F N      ++HP+++ E   NP   R++M++++FE ++ P++   I  + S        L ++   T ++L  G    H +P++ G        ++++ G  L   +M++L  +    +   +  +   +++K C +AL++ QEM    SS
Sbjct:    9 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR--HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLS--------LYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASS 234          

HSP 2 Score: 56.225 bits (134), Expect = 4.442e-8
Identity = 41/136 (30.15%), Postives = 61/136 (44.85%), Query Frame = 3
Query: 1764 LHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLLHLYDKNSLQT-KQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPIIKIADDP--TLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQ 2162
            + +  E+FR PE +F+P  +G E AG+ E   N I          K  +   K L  N  L+G  +  P + +R+  EI    P+++    IKI   P      W G   LA  + F  M ISK+ Y+E G   + 
Sbjct:  249 ITIGNERFRCPESLFQPSFLGMESAGIHETTFNSIM---------KCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMK---IKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVH 372          
The following BLAST results are available for this feature:
BLAST of Actin-related protein 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACTR51.268e-5240.33actin related protein 5 [Source:HGNC Symbol;Acc:HG... [more]
ACTG11.192e-2223.79actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG11.980e-2223.73actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG11.980e-2223.73actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG11.980e-2223.73actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
back to top
BLAST of Actin-related protein 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
act-27.438e-2323.73Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984][more]
act-27.438e-2323.73Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984][more]
act-27.438e-2323.73Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984][more]
act-38.866e-2323.73Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42][more]
act-38.866e-2323.73Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42][more]
back to top
BLAST of Actin-related protein 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arp52.441e-5836.69gene:FBgn0038576 transcript:FBtr0336468[more]
Arp52.441e-5836.69gene:FBgn0038576 transcript:FBtr0083557[more]
Act5C2.379e-2223.73gene:FBgn0000042 transcript:FBtr0070822[more]
Act5C2.379e-2223.73gene:FBgn0000042 transcript:FBtr0100662[more]
Act5C2.379e-2223.73gene:FBgn0000042 transcript:FBtr0345894[more]
back to top
BLAST of Actin-related protein 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actr56.695e-5537.58actin related protein 5 [Source:ZFIN;Acc:ZDB-GENE-... [more]
actb11.433e-2323.31actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb11.276e-2223.31actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb13.356e-2223.31actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb13.356e-2223.31actin, beta 1 [Source:NCBI gene;Acc:57934][more]
back to top
BLAST of Actin-related protein 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpr846.141e-5537.29G protein-coupled receptor 84 [Source:Xenbase;Acc:... [more]
gpr849.879e-5537.29G protein-coupled receptor 84 [Source:Xenbase;Acc:... [more]
actg13.041e-2223.31actin gamma 1 [Source:NCBI gene;Acc:394957][more]
actb3.461e-2223.31actin, beta [Source:NCBI gene;Acc:407952][more]
acta21.516e-2023.31actin, alpha 2, smooth muscle, aorta [Source:NCBI ... [more]
back to top
BLAST of Actin-related protein 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Actr51.024e-5435.66ARP5 actin-related protein 5 [Source:MGI Symbol;Ac... [more]
Actr55.365e-5337.18ARP5 actin-related protein 5 [Source:MGI Symbol;Ac... [more]
Actb2.265e-2323.31actin, beta [Source:MGI Symbol;Acc:MGI:87904][more]
Actg11.359e-2223.73actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
Actg11.359e-2223.73actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Actin-related protein 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q17GZ9|ARP5_AEDAE3.070e-5936.78Actin-related protein 5 OS=Aedes aegypti OX=7159 G... [more]
sp|Q9VEC3|ARP5_DROME2.447e-5736.69Actin-related protein 5 OS=Drosophila melanogaster... [more]
sp|P53946|ARP5_YEAST9.054e-5627.53Actin-related protein 5 OS=Saccharomyces cerevisia... [more]
sp|Q5ZJA4|ARP5_CHICK2.173e-5335.88Actin-related protein 5 OS=Gallus gallus OX=9031 G... [more]
sp|Q293V2|ARP5_DROPS8.264e-5336.18Actin-related protein 5 OS=Drosophila pseudoobscur... [more]
back to top
BLAST of Actin-related protein 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HSI93.300e-11538.20actin-related protein 5 OS=Lingula unguis OX=7574 ... [more]
A0A0L8H1G31.359e-11437.55Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A1S3KGZ35.477e-11438.06actin-related protein 5-like OS=Lingula unguis OX=... [more]
A0A2B4SW192.646e-11034.93Actin-related protein 5 OS=Stylophora pistillata O... [more]
A0A2C9L3L92.651e-10835.75Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Actin-related protein 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb12.844e-2223.31actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
actb22.924e-2223.31actin beta [Source:NCBI gene;Acc:103030443][more]
actb14.383e-2223.31actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
actc1c4.434e-2123.31actin, alpha cardiac muscle 1 [Source:NCBI gene;Ac... [more]
actr11.371e-2025.73beta-centractin [Source:NCBI gene;Acc:103036907][more]
back to top
BLAST of Actin-related protein 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011113.17.784e-2323.31pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene... [more]
ENSPMAT00000004586.18.329e-2223.31pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 ... [more]
ENSPMAT00000011230.12.223e-1320.68pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1... [more]
actr61.227e-1229.71actin related protein 6 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000008200.12.330e-922.80pep scaffold:Pmarinus_7.0:GL477804:3783:17322:1 ge... [more]
back to top
BLAST of Actin-related protein 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ARP51.304e-5727.53Nuclear actin-related protein involved in chromati... [more]
ACT11.691e-2526.52Actin; structural protein involved in cell polariz... [more]
ARP11.154e-1527.23Actin-related protein of the dynactin complex; req... [more]
ARP23.542e-1523.79Essential component of the Arp2/3 complex; Arp2/3 ... [more]
ARP64.791e-621.07Actin-related protein that binds nucleosomes; a co... [more]
back to top
BLAST of Actin-related protein 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO486871.663e-2426.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450139.734e-2323.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385201.154e-2223.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379761.289e-2223.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426461.531e-2223.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Actin-related protein 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actr51.080e-6039.54actin related protein 5 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000029375.11.623e-2223.73actin, cytoplasmic 2 [Source:NCBI gene;Acc:1011689... [more]
ENSORLT00000011677.22.075e-2223.73actin, cytoplasmic 2 [Source:NCBI gene;Acc:1011689... [more]
ENSORLT00000021726.26.084e-2223.31actin, cytoplasmic [Source:NCBI gene;Acc:101155523... [more]
actb7.237e-2223.31cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
back to top
BLAST of Actin-related protein 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077218.10.000e+099.72SMESG000077218.1[more]
SMESG000077218.10.000e+099.02SMESG000077218.1[more]
SMESG000020125.11.919e-2325.74SMESG000020125.1[more]
SMESG000012317.15.414e-2325.32SMESG000012317.1[more]
SMESG000066035.15.909e-2323.73SMESG000066035.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017076 ID=SMED30017076|Name=Actin-related protein 5|organism=Schmidtea mediterranea sexual|type=transcript|length=2251bp
GATCTAATAGTTGTTTGGGAATTAAAGTCCTTAAGAATATTTACATTAGG
CATTTAACATTTTAAAGAAATAATTACTGCGGCCTAATGCTGGACTTAAC
GGATTTATATATTCAACAAAAGTCAATAAATAAATTTCAATATAACTCAA
ATTATAGAGATATTCCTATAGTTATAGACAATGGTTCATATCAATTTAAA
TGTGGATTTGCTATAGATAGTTGCCCTTATTTAGAATTCAAGAATGTCAT
AGCTAAATCGAAATCCAAAAAAGAAGGAATATTAGTTGGCAATGAAATCG
AAGACTTCTATGCGAATATACGTTATGCCTTTGATCGCAATGTAGTTGTT
AATTTTGACGTCCAAGAAAGCGTGTTTGATTATGCATTTGATAATTTGGG
TTTACAAACTCTTCAAGATCATCCAATTGTAATAAATGAACCACTATGTA
ATCCAAATACTTGCCGACAACAAATGTCTGAGCTTTTATTCGAAGCCTAT
GATGTTCCTAGCATTGCTTATTATATTGATGGCTTAGCGAGTTATGCTTA
TAATAATCCAGAATATTTGGAATCTACTGCAAATGACACCGTGCTGATCC
TGTCATTTGGATATCAAAGCATTCACCTACTCCCCCTTTTTAATGGCCGA
TTAGAAGCGAAGCTTTGCCGAAAGATAAATGTCGGAGGATCACAGCTTGA
TTCTTTGATGATGAGGTTGCTGCAATTGAAATATTCTTGCCATTCAAACA
TTATTGACCTGCGAATGGGAGAATATCTTCAACAAAAGACTTGCTCGCTG
GCATTAAATTATCGGCAGGAAATGATGCAATGGAAATCTTCGAAATATCA
TGCCGACAATTCTTTAATAATCCAAATGCCTTTTAAAAAATCTGAGAAAA
TGCTGTCTAATGAACAATTGGAAGAAAAGAAAAAGCAGCAAATGCTACGA
GGTAAGGAAATGCATTTAAAGAGAAATCAAGAAAAGCTGGCTTCCGCTCA
AGATAACCTTTCTAATCTCATGAATCTGATATCATCTAAGGACAATATGA
AAAAAAAAATTATCAATTCCATGGGGTTTGAAAATGAGCAACATGTTATG
AATGAAATGAAGAATATTGAATTGCTTATTGAGAAACTGCAATGTAAAAT
CAGAGGCATTGACTGTCCAACCAAAATAGAAAATTTGGAGCCTAAACAGA
AATTCGATCTGATTGATATTTCAGACGATGAGCTCGATGAAGATGAATTA
AAACAAAAGCAAAAACAAGTAATGCTTCGGGCTGCTGCTCTGCGCCGCGA
ACAAATTCGATTAATGAAAGAAATGAAACGAAATAAAATTTTAAGCGCCG
TAAATAAACTTGAGGAATCTCGTGAGGATGATTTTGCATTATGGGTTATG
AATCTGAGACACCAAAGGCAATCTTTACTTGATAATAGAATGAAGAAGAG
ATCTAGTCTTTCTGTTTCTATGGGTTCCGCGGGTCCTAGTATCGGAATAG
ATGAAAGACGACAACAGAAAGCTCGAAAAATACGAAAAATTGCCGCCGAA
TTAAATGAAGATTTAGAACTTAAATACATTAAAAAGGGATCTAGTCAAAA
TCAATTAGAAGACGATAGATATGCGGAAGACCTTAGTGATGACGATAGTG
ACACGGAACAGAAACAATTGTGCCAGTTGGAAATATTATTAAATCAATAT
GATCCGGAATTCACCAAGGATAATAATTCATCTTTAAAGGTGGACATAGA
AGAATACTATAAATTGCATTTGTCAACGGAACAATTCAGAGTTCCTGAAA
TAATTTTTAAACCGTATATGATTGGATATGAAGAGGCAGGATTGGGAGAA
ATGTTAGAGAACCTTATAAATGGGTCGTATTTACTTCACTTATACGATAA
AAATTCCCTACAGACCAAACAGTTGGCGGATAATATATTTTTAACGGGTA
GTGTTAGTAAAATTCCAAATCTTAAAGAAAGGCTGTTTTACGAAATTCGG
CAATTTCTACCAACATCTTTATCAGATCCAATAATAAAAATTGCCGATGA
TCCGACTTTAGATGCTTGGCGAGGAGCTTGTAAATTGGCTTTACACACTC
AGTTCGATAGTATGAGCATATCAAAAGAACTATATGAAGAAATGGGCCAT
GATTACATTCAGGAACATCCGCTATCTAATTTTTTTTATACTCCTTTAAC
CGATGTTGATGAAATGAGTTGCTGATGATATATATGTAAATGTTTTGTAA
T
back to top

protein sequence of SMED30017076-orf-1

>SMED30017076-orf-1 ID=SMED30017076-orf-1|Name=SMED30017076-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=713bp
MLDLTDLYIQQKSINKFQYNSNYRDIPIVIDNGSYQFKCGFAIDSCPYLE
FKNVIAKSKSKKEGILVGNEIEDFYANIRYAFDRNVVVNFDVQESVFDYA
FDNLGLQTLQDHPIVINEPLCNPNTCRQQMSELLFEAYDVPSIAYYIDGL
ASYAYNNPEYLESTANDTVLILSFGYQSIHLLPLFNGRLEAKLCRKINVG
GSQLDSLMMRLLQLKYSCHSNIIDLRMGEYLQQKTCSLALNYRQEMMQWK
SSKYHADNSLIIQMPFKKSEKMLSNEQLEEKKKQQMLRGKEMHLKRNQEK
LASAQDNLSNLMNLISSKDNMKKKIINSMGFENEQHVMNEMKNIELLIEK
LQCKIRGIDCPTKIENLEPKQKFDLIDISDDELDEDELKQKQKQVMLRAA
ALRREQIRLMKEMKRNKILSAVNKLEESREDDFALWVMNLRHQRQSLLDN
RMKKRSSLSVSMGSAGPSIGIDERRQQKARKIRKIAAELNEDLELKYIKK
GSSQNQLEDDRYAEDLSDDDSDTEQKQLCQLEILLNQYDPEFTKDNNSSL
KVDIEEYYKLHLSTEQFRVPEIIFKPYMIGYEEAGLGEMLENLINGSYLL
HLYDKNSLQTKQLADNIFLTGSVSKIPNLKERLFYEIRQFLPTSLSDPII
KIADDPTLDAWRGACKLALHTQFDSMSISKELYEEMGHDYIQEHPLSNFF
YTPLTDVDEMSC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006310DNA recombination
GO:0006338chromatin remodeling
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006281DNA repair
GO:0006974cellular response to DNA damage stimulus
GO:0010082regulation of root meristem growth
GO:0080036regulation of cytokinin-activated signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR027664Arp5
IPR043129ATPase_NBD
IPR004000Actin
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 294..314
NoneNo IPR availableCOILSCoilCoilcoord: 334..354
NoneNo IPR availableCOILSCoilCoilcoord: 385..405
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 26..169
e-value: 9.0E-32
score: 111.8
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 660..688
e-value: 3.9E-23
score: 83.7
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 527..583
e-value: 3.9E-23
score: 83.7
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 584..659
e-value: 3.9E-23
score: 83.7
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 201..255
e-value: 3.1E-7
score: 32.1
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 171..200
e-value: 3.1E-7
score: 32.1
NoneNo IPR availableCDDcd00012NBD_sugar-kinase_HSP70_actincoord: 28..200
e-value: 5.75654E-6
score: 45.2724
IPR004000Actin familySMARTSM00268actin_3coord: 25..696
e-value: 9.8E-25
score: 98.2
IPR004000Actin familyPFAMPF00022Actincoord: 27..215
e-value: 4.5E-28
score: 98.0
coord: 320..692
e-value: 3.2E-19
score: 68.8
IPR004000Actin familyPANTHERPTHR11937ACTINcoord: 26..696
IPR027664Actin-related protein 5PANTHERPTHR11937:SF16ACTIN-RELATED PROTEIN 5coord: 26..696
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 27..155
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 168..694