FMRFamide-activated amiloride-sensitive sodium channel

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel
Smed IDSMED30017073
Length (bp)2263
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30017073) t-SNE clustered cells

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30017073) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30017073) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30017073) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017073

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30017073SMESG000037525.1 dd_Smed_v4_10522_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017073SMESG000037525.1 dd_Smed_v4_10522_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017073SMESG000037525.1 dd_Smed_v4_10522_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30017073SMESG000037525.1 dd_Smed_v4_10522_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30017073SMESG000037525.1 dd_Smed_v4_10522_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 58.9214 bits (141), Expect = 2.753e-8
Identity = 78/386 (20.21%), Postives = 142/386 (36.79%), Query Frame = 3
Query:  876 LDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVE-----LFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQ----EHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYL----PCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFAEI 1994
            L   +  C+ N V  NQ           +    HP Y NCY++      +L  +++      L + L  E N        F  + + ++GA +++H +     ++    NL+PG  T + ++          YG C+K       E+LY  K    YT+  C    FQ+ + +EC C  I +P     ++ +C                              D  K      C   +   +  D + GC+     PC+  SY+     S WP+ +   +W+    ++                  N+    N  + +A  NI  K+L          N     E   +++ + LS  G  +S+W G +++++VE+ E++     I
Sbjct:  298 LGNFIFACRFNQVSCNQ---------ANYSHFHHPMYGNCYTFNDKNNSNLWMSSMPGINNGLSLMLRAEQND-------FIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSK----YTQQVCIHSCFQESMIKECGCAYIFYP--RPQNVEYC------------------------------DYRKHSSWGYCYYKLQVDFSSDHL-GCFTKCRKPCSVTSYQLSAGYSRWPSVTSQ-EWVFQMLSRQ-----------------NNYTVNNKRNGVAKVNIFFKEL----------NYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVI 602          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 58.9214 bits (141), Expect = 3.077e-8
Identity = 78/386 (20.21%), Postives = 142/386 (36.79%), Query Frame = 3
Query:  876 LDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVE-----LFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQ----EHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYL----PCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFAEI 1994
            L   +  C+ N V  NQ           +    HP Y NCY++      +L  +++      L + L  E N        F  + + ++GA +++H +     ++    NL+PG  T + ++          YG C+K       E+LY  K    YT+  C    FQ+ + +EC C  I +P     ++ +C                              D  K      C   +   +  D + GC+     PC+  SY+     S WP+ +   +W+    ++                  N+    N  + +A  NI  K+L          N     E   +++ + LS  G  +S+W G +++++VE+ E++     I
Sbjct:  275 LGNFIFACRFNQVSCNQ---------ANYSHFHHPMYGNCYTFNDKNNSNLWMSSMPGINNGLSLMLRAEQND-------FIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSK----YTQQVCIHSCFQESMIKECGCAYIFYP--RPQNVEYC------------------------------DYRKHSSWGYCYYKLQVDFSSDHL-GCFTKCRKPCSVTSYQLSAGYSRWPSVTSQ-EWVFQMLSRQ-----------------NNYTVNNKRNGVAKVNIFFKEL----------NYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVI 579          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 58.5362 bits (140), Expect = 3.525e-8
Identity = 78/386 (20.21%), Postives = 142/386 (36.79%), Query Frame = 3
Query:  876 LDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVE-----LFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQ----EHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYL----PCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFAEI 1994
            L   +  C+ N V  NQ           +    HP Y NCY++      +L  +++      L + L  E N        F  + + ++GA +++H +     ++    NL+PG  T + ++          YG C+K       E+LY  K    YT+  C    FQ+ + +EC C  I +P     ++ +C                              D  K      C   +   +  D + GC+     PC+  SY+     S WP+ +   +W+                  + +   N+    N  + +A  NI  K+L          N     E   +++ + LS  G  +S+W G +++++VE+ E++     I
Sbjct:  334 LGNFIFACRFNQVSCNQ---------ANYSHFHHPMYGNCYTFNDKNNSNLWMSSMPGINNGLSLMLRAEQND-------FIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSK----YTQQVCIHSCFQESMIKECGCAYIFYP--RPQNVEYC------------------------------DYRKHSSWGYCYYKLQVDFSSDHL-GCFTKCRKPCSVTSYQLSAGYSRWPSVTSQ-EWV-----------------FQMLSRQNNYTVNNKRNGVAKVNIFFKEL----------NYKTNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELVFDLLVI 638          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1B (sodium channel epithelial 1 beta subunit [Source:HGNC Symbol;Acc:HGNC:10600])

HSP 1 Score: 55.0694 bits (131), Expect = 4.398e-7
Identity = 71/354 (20.06%), Postives = 127/354 (35.88%), Query Frame = 3
Query:  966 TILHPQYINCY--SYVLYERFSLKTN-----TVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQE-HLYMYKEDY--TYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKAL-ERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFAEI 1994
            +I +P Y NCY  ++ + E+     N      ++L + +G+E          +       +G  L++H + S+P I    +    GT T + +   K      PY  C+    E  +  +  DY  TY+  AC    FQ  +   C C    +P             P + H                   C SD++ ++ +R  C            +  C   C    Y+   S++ WP+++    WI    ++       +   R+ I  LN                         I   ++N   +EE    ++   LS  GG F  W+G +++ ++E  E++I F  I
Sbjct:  236 SIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQED---------YVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAH-------------------CYSDLQMSVAQRETC------------IGMCKESCNDTQYKMTISMADWPSEASE-DWIFHVLSQERDQSTNITLSRKGIVKLN-------------------------IYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWI 523          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1B (sodium channel epithelial 1 beta subunit [Source:HGNC Symbol;Acc:HGNC:10600])

HSP 1 Score: 55.0694 bits (131), Expect = 4.604e-7
Identity = 71/350 (20.29%), Postives = 126/350 (36.00%), Query Frame = 3
Query:  966 TILHPQYINCY--SYVLYERFSLKTN-TVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQE-HLYMYKEDY--TYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKAL-ERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFAEI 1994
            +I +P Y NCY  ++ + E+     N   E  + L  ++   + +    S      +G  L++H + S+P I    +    GT T + +   K      PY  C+    E  +  +  DY  TY+  AC    FQ  +   C C    +P             P + H                   C SD++ ++ +R  C            +  C   C    Y+   S++ WP+++    WI    ++       +   R+ I  LN                         I   ++N   +EE    ++   LS  GG F  W+G +++ ++E  E++I F  I
Sbjct:  308 SIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLAST-----AGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAH-------------------CYSDLQMSVAQRETC------------IGMCKESCNDTQYKMTISMADWPSEASE-DWIFHVLSQERDQSTNITLSRKGIVKLN-------------------------IYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWI 595          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 73.9442 bits (180), Expect = 2.297e-13
Identity = 91/381 (23.88%), Postives = 148/381 (38.85%), Query Frame = 3
Query:  858 KELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIH--NRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFAEI 1994
            + L + L+E V+ C  N  D        C     ++  + P+Y NCY++   +   LK +       L   +N  +          T+ +G  LV+H  ++  FPD   YS     G ++   LKT +    + P+G CS   +   Y+Y E Y+  EG C    FQ K+ E C C    FP            LP   H+    + KSK     +D+ C+S++          ++    +H      C  PC    +ET  S S+WP++++ +     +   A+ +            I ND      Y          +    I I     N   ++E    +L +  S  GG   +WIG ++I   E  E+   F EI
Sbjct:  409 RNLSYTLNEFVLRCSFNSKD--------CSMERDFKLHVDPEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNVHQSD----YMPTTEAAGVRLVVHEQDQEPFPDTFGYSA--PTGFISSFGLKTKELHRLSAPWGNCSDTFRPVPYIYNEHYS-PEG-CHRNCFQLKVLEICGCGDPRFP------------LPSEEHRHC--NAKSK-----IDRQCLSNL---------TSDSGGYHHLHEQCECRQPCHEKVFETAYSASAWPSQNFKI----GTDCPAVSD------------IFNDTEACTEY--------YRQNTAYIEIYYEQLNFESLKETAGYTLVNLFSDFGGNIGLWIGFSVITFAEFAEL---FCEI 718          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 73.9442 bits (180), Expect = 2.486e-13
Identity = 89/386 (23.06%), Postives = 149/386 (38.60%), Query Frame = 3
Query:  858 KELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIH--NRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFAEIDTNQG 2009
            + L + L+E V+ C  N  D        C     ++  + P+Y NCY++   +   LK +       L   +N  +          T+ +G  LV+H  ++  FPD   YS     G ++   LKT +    + P+G CS   +   Y+Y E Y+  EG C    FQ K+ E C C    FP            LP   H+    + KSK     +D+ C+S++          ++    +H      C  PC    +ET  S S+WP++++ +     +   A+ +            I ND      Y          +    I I     N   ++E    +L +  S  GG   +WIG ++I   E  E+     ++   +G
Sbjct:  411 RNLSYTLNEFVLRCSFNSKD--------CSMERDFKLHVDPEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNVHQSD----YMPTTEAAGVRLVVHEQDQEPFPDTFGYSA--PTGFISSFGLKTKELHRLSAPWGNCSDTFRPVPYIYNEHYS-PEG-CHRNCFQLKVLEICGCGDPRFP------------LPSEEHRHC--NAKSK-----IDRQCLSNL---------TSDSGGYHHLHEQCECRQPCHEKVFETAYSASAWPSQNFKI----GTDCPAVSD------------IFNDTEACTEY--------YRQNTAYIEIYYEQLNFESLKETAGYTLVNLFSDFGGNIGLWIGFSVITFAEFAELFCEICKLMYFKG 728          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 73.9442 bits (180), Expect = 2.570e-13
Identity = 89/386 (23.06%), Postives = 149/386 (38.60%), Query Frame = 3
Query:  858 KELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIH--NRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFAEIDTNQG 2009
            + L + L+E V+ C  N  D        C     ++  + P+Y NCY++   +   LK +       L   +N  +          T+ +G  LV+H  ++  FPD   YS     G ++   LKT +    + P+G CS   +   Y+Y E Y+  EG C    FQ K+ E C C    FP            LP   H+    + KSK     +D+ C+S++          ++    +H      C  PC    +ET  S S+WP++++ +     +   A+ +            I ND      Y          +    I I     N   ++E    +L +  S  GG   +WIG ++I   E  E+     ++   +G
Sbjct:  370 RNLSYTLNEFVLRCSFNSKD--------CSMERDFKLHVDPEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNVHQSD----YMPTTEAAGVRLVVHEQDQEPFPDTFGYSA--PTGFISSFGLKTKELHRLSAPWGNCSDTFRPVPYIYNEHYS-PEG-CHRNCFQLKVLEICGCGDPRFP------------LPSEEHRHC--NAKSK-----IDRQCLSNL---------TSDSGGYHHLHEQCECRQPCHEKVFETAYSASAWPSQNFKI----GTDCPAVSD------------IFNDTEACTEY--------YRQNTAYIEIYYEQLNFESLKETAGYTLVNLFSDFGGNIGLWIGFSVITFAEFAELFCEICKLMYFKG 687          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 73.1738 bits (178), Expect = 3.984e-13
Identity = 89/386 (23.06%), Postives = 149/386 (38.60%), Query Frame = 3
Query:  858 KELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIH--NRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFAEIDTNQG 2009
            + L + L+E V+ C  N  D        C     ++  + P+Y NCY++   +   LK +       L   +N  +          T+ +G  LV+H  ++  FPD   YS     G ++   LKT +    + P+G CS   +   Y+Y E Y+  EG C    FQ K+ E C C    FP            LP   H+    + KSK     +D+ C+S++          ++    +H      C  PC    +ET  S S+WP++++ +     +   A+ +            I ND      Y          +    I I     N   ++E    +L +  S  GG   +WIG ++I   E  E+     ++   +G
Sbjct:  410 RNLSYTLNEFVLRCSFNSKD--------CSMERDFKLHVDPEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNVHQSD----YMPTTEAAGVRLVVHEQDQEPFPDTFGYSA--PTGFISSFGLKTKELHRLSAPWGNCSDTFRPVPYIYNEHYS-PEG-CHRNCFQLKVLEICGCGDPRFP------------LPSEEHRHC--NAKSK-----IDRQCLSNL---------TSDSGGYHHLHEQCECRQPCHEKVFETAYSASAWPSQNFKI----GTDCPAVSD------------IFNDTEACTEY--------YRQNTAYIEIYYEQLNFESLKETAGYTLVNLFSDFGGNIGLWIGFSVITFAEFAELFCEICKLMYFKG 727          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 62.7734 bits (151), Expect = 7.506e-10
Identity = 89/447 (19.91%), Postives = 169/447 (37.81%), Query Frame = 3
Query:  864 LGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNT--------VELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNR--ASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLD-KDCVSDIEKALERIICKNN---VTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPE----LKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFAEIDTNQGETKTIRTLEIRTRPCSSRRCVLNDVDTRGVDVLESLTASNQLREAVI 2150
            + + LDE+V+ C  N  D        C     +       + NCY++       + ++         V L+  + E + TTE +            G  + +H++    FPD   YS     G ++   ++  + I   PPYG C    ++        + Y+  AC     Q+ I E C C    +P  E              + K C +       V++D ++C+ +    L  +  K     +   Y       C+ PC   +YE   S + WP          S +AK ++  P     L+KYR                         K    + I   + N   ++E    +LTS L+  GGL  +WIG ++++++EI+ +++   +    + +  ++ TL    +  +++   L+ +D R +  + S  +S   +  +I
Sbjct:  457 MSYELDELVLKCSFNQKD--------CQMDRDFTLHYDNTFGNCYTFNYNRTAEVASHRAGANYGLRVLLYANVSEYLPTTEAV------------GFRITVHDKHIVPFPDAFGYSA--PTGFMSSFGVRMKQFIRLEPPYGHCRHGGEDAATFVYTGFQYSVEACHRSCAQKVIVEACGCADPMYPVAEMFGN----------NTKPCQA-------VNMDQRECLRNTTLWLGELYSKGKEAIIPDCY-------CHQPCQETNYEVTYSSARWP----------SGSAKVMECLPGDFLCLEKYR-------------------------KNAAMVQIFYEELNYETMQESPAYTLTSVLADLGGLTGLWIGASVVSLLEIVTLIVFATQAYVRKRKGVSLNTLH---KSSTTQSVKLSVMDIRSIKSIHSNHSSKSKQSILI 819          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Match: asic2 (acid-sensing (proton-gated) ion channel 2 [Source:NCBI gene;Acc:407669])

HSP 1 Score: 52.373 bits (124), Expect = 1.792e-6
Identity = 76/383 (19.84%), Postives = 145/383 (37.86%), Query Frame = 3
Query:  852 YFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYE-----RFSLKTNT---VELFVYLGEEVNTTECIDCFFSNVKTQL-SGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRC-SKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIE 1970
            + + +GH L EM+++C+            EC S   ++T+   +Y  CY +   E     R ++K  T   +E+ +    ++   E +  +    +T   +G  + IH++A  P +++    + PG  T V  +  +     PP+G C S+     L+       Y+  AC+     + I E C C  +  P +     P+CT   +                    KDC      AL  +   N + R            PC    Y  + S+   P+K         ++A+ ++     KK+  + K + D       +IL      E             N   +E+K+   +   L   GG   ++IG +++ ++E+ +
Sbjct:  177 FTERVGHDLKEMMLYCRFQG--------QEC-SHQDFKTVF-TRYGKCYMFNAAEEGKTLRTTMKGGTGNGLEIML----DIQQDEYLPVWGETEETAFEAGVRVQIHSQAEPPFVHELGFGVAPGFQTFVATQEQRLTYLPPPWGECVSRALDSGLFQ-----VYSVSACRIECETRYIVENCNCRMVYMPGDS----PYCTPEQY--------------------KDCAEPALAALSAVEGTNCICRS-----------PCNMTRYNKELSMVKIPSK---------TSARYLE-----KKFNRSEKYITD-------NILVLDVFFEA-----------LNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTLLELFD 473          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Match: asic2 (acid-sensing (proton-gated) ion channel 2 [Source:NCBI gene;Acc:407669])

HSP 1 Score: 52.373 bits (124), Expect = 1.792e-6
Identity = 76/383 (19.84%), Postives = 145/383 (37.86%), Query Frame = 3
Query:  852 YFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYE-----RFSLKTNT---VELFVYLGEEVNTTECIDCFFSNVKTQL-SGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRC-SKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIE 1970
            + + +GH L EM+++C+            EC S   ++T+   +Y  CY +   E     R ++K  T   +E+ +    ++   E +  +    +T   +G  + IH++A  P +++    + PG  T V  +  +     PP+G C S+     L+       Y+  AC+     + I E C C  +  P +     P+CT   +                    KDC      AL  +   N + R            PC    Y  + S+   P+K         ++A+ ++     KK+  + K + D       +IL      E             N   +E+K+   +   L   GG   ++IG +++ ++E+ +
Sbjct:  177 FTERVGHDLKEMMLYCRFQG--------QEC-SHQDFKTVF-TRYGKCYMFNAAEEGKTLRTTMKGGTGNGLEIML----DIQQDEYLPVWGETEETAFEAGVRVQIHSQAEPPFVHELGFGVAPGFQTFVATQEQRLTYLPPPWGECVSRALDSGLFQ-----VYSVSACRIECETRYIVENCNCRMVYMPGDS----PYCTPEQY--------------------KDCAEPALAALSAVEGTNCICRS-----------PCNMTRYNKELSMVKIPSK---------TSARYLE-----KKFNRSEKYITD-------NILVLDVFFEA-----------LNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTLLELFD 473          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Match: asic4a (acid-sensing (proton-gated) ion channel family member 4a [Source:NCBI gene;Acc:407668])

HSP 1 Score: 51.9878 bits (123), Expect = 2.569e-6
Identity = 80/379 (21.11%), Postives = 146/379 (38.52%), Query Frame = 3
Query:  855 FKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKT------NTVELFVYLGEEVNTTECIDCFFSNVKTQL-SGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIE 1970
            F   GH L+EM+  C  N+   N    D         T+++ +Y  CY++   +  S KT      N +E+ +    ++   + +  +    +T L +G  + IH++   P I+Q    + PG  T V  +  +      P+G C   +++ +  Y    TY+  AC+      ++  ECKC  +  P + +     CT           PS          D  CV   +KAL        + ++  GD    C  PC    Y  + S+   P+K          +A+ +  K                     YD   S++ +    + + I     N   +E+K+   +   L   GG   ++IG +++ I+EI++
Sbjct:  164 FNRTGHQLEEMLKSC--NFSGQNCSAED--------FTVVYTRYGKCYTFNGNKTTSRKTKQGGMGNGLEIML----DIQQDDYLPIWKETNETSLEAGIRVQIHSQDEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRSTSEQMIPGYD---TYSISACRLRCETLEVLRECKCRMVHMPGDAN----ICT-----------PS----------DIKCV---DKALA-------LLQKSSGDTC-FCETPCNLTRYGKELSMVKIPSK---------GSARYLSRK---------------------YD--KSEDYIRDNFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASVLTILEILD 457          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 65.855 bits (159), Expect = 2.003e-10
Identity = 74/386 (19.17%), Postives = 146/386 (37.82%), Query Frame = 3
Query:  864 LGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILH-PQYINCYSYVLYERFSLKTNT-------VELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRC----SKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKAL--ERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLI 1979
            +G+  DE+++ C            D      R  T+ H P Y NCY++   ER +L  ++       +++ +Y+ E+          ++   +  +GA +++H++  +P I      L+  T T + ++  ++   + PY  C    S  + E+LY  K    YT   C    FQ+++   C C   D P    +        P +I+                   C   + K    E + C++             C   C+F  +   RS++ WP+ +   +W+    +  +  K                          ++N+ +  L  + I   D N   + E    ++ + LS  GG   +W+  +MI ++EI+E+  
Sbjct:  260 MGYKADELIVTC----------FFDGLSCDARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDE---------YNPYLSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSDVSVENLYSKK----YTLQICLNSCFQREMVRTCGCAHYDQPLPNGAKYCNYEEYPSWIY-------------------CYFKLYKQFVQEELGCQS------------ACRESCSFKEWTLTRSLAKWPSLNSE-QWMLRVLSWELGEK-------------------------LNKNLTKNDLANLNIFYQDLNSRSISESPTYNIVTLLSNFGGQLGLWMSCSMICVLEIVEVFF 565          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 63.5438 bits (153), Expect = 9.094e-10
Identity = 75/388 (19.33%), Postives = 148/388 (38.14%), Query Frame = 3
Query:  864 LGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILH-PQYINCYSYVLYERFSLKTNT-------VELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRC----SKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKAL--ERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLK--WIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLI 1979
            +G+  DE+++ C            D      R  T+ H P Y NCY++   ER +L  ++       +++ +Y+ E+          ++   +  +GA +++H++  +P I      L+  T T + ++  ++   + PY  C    S  + E+LY  K    YT   C    FQ+++   C C   D P    +        P +I+                   C   + K    E + C++             C   C+F  +   RS++ WP+ +  ++  W+                    +++   G+     + LA+ NI  +          D N   + E    ++ + LS  GG   +W+  +MI ++EI+E+  
Sbjct:  252 MGYKADELIVTC----------FFDGLSCDARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDE---------YNPYLSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSDVSVENLYSKK----YTLQICLNSCFQREMVRTCGCAHYDQPLPNGAKYCNYEEYPSWIY-------------------CYFKLYKQFVQEELGCQS------------ACRESCSFKEWTLTRSLAKWPSLNSEVRSAWV--------------------LQLFYVGHGFFNLNDLANLNIFYQ----------DLNSRSISESPTYNIVTLLSNFGGQLGLWMSCSMICVLEIVEVFF 555          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 57.3806 bits (137), Expect = 8.407e-8
Identity = 73/387 (18.86%), Postives = 144/387 (37.21%), Query Frame = 3
Query:  864 LGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILH-PQYINCYSYVLYERFSLKTNT-------VELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRC----SKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKAL--ERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAY-DILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLI 1979
            +G+  DE+++ C            D      R  T+ H P Y NCY++   ER +L  ++       +++ +Y+ E+          ++   +  +GA +++H++  +P I      L+  T T + ++  ++   + PY  C    S  + E+LY  K    YT   C    FQ+++   C C   D P    +        P +I+                   C   + K    E + C++             C   C+F  +   RS++ WP+ +  ++                  +   +  +  GN  N + ++    + L    +  V     Y          L + + LS  GG   +W+  +MI ++EI+E+  
Sbjct:  250 MGYKADELIVTC----------FFDGLSCDARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDE---------YNPYLSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSDVSVENLYSKK----YTLQICLNSCFQREMVRTCGCAHYDQPLPNGAKYCNYEEYPSWIY-------------------CYFKLYKQFVQEELGCQS------------ACRESCSFKEWTLTRSLAKWPSLNSEVR----------------SAWVLQLFYVGHGNSHNLFSEMFFWASALAASFMLYVFMMCIY-WQCSTSHLSLQIVTLLSNFGGQLGLWMSCSMICVLEIVEVFF 565          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: lhx1 (LIM homeobox 1 [Source:Xenbase;Acc:XB-GENE-482482])

HSP 1 Score: 50.447 bits (119), Expect = 5.437e-6
Identity = 50/226 (22.12%), Postives = 101/226 (44.69%), Query Frame = 3
Query:  612 VLSNKESPFPSFTICNLRP--LSPDVRSFLANEKLRNPR-EFASRLNQYAVSRYLKKNDSFHYAASTAISSMGGYLESMPNTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTEC-------IDCFFSNVK-----TQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIM 1244
            ++S+ +  FP+ TICNL    LS   RSF  +  L++   E   R N+         +   +   ++A +        +P+     E+GH L++M+IFC  +          EC S   +   ++ ++ NCY++   +   ++ N + +     + +N T+        ++ F   ++     T  +G  L++H++A  P      VN+ PG  TE+ +  ++ I+
Sbjct:   91 LISSAKLKFPAVTICNLNSVRLSSLGRSFSMSNSLQDSGLEMTHRRNRSHHMNVTSDSVDENVLYASAFNKFASEFNQLPDEQKI-EMGHQLEDMLIFCNFHG--------QECNS-SFFSGFINYKFGNCYTFNSQKSVDIRGNQIRV-----DPLNITKAGFMYGLHLELFIQQIEYVRDMTHAAGIRLLVHDQAQMPFPEDEGVNVPPGAETEIGMMKVQLIV 301          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 5.856e-21
Identity = 125/583 (21.44%), Postives = 235/583 (40.31%), Query Frame = 3
Query:  357 IKKRNSPSTCQSDDKPKRGECMKKEFLLFCQNTTIRGVSRIVKSTDKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYNVIHPPRVLSNKESPFPSFTICNLRPLSPDVRSFLANEKLRNPREFASRLNQYAVSRYLKKNDSFHYAASTAISSMGGYLESMPNTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCF-----FSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKAL---ERIICKNNVTRRYHGDRVE----GCYLPCTFYSYETDRSISSWPTKSYHLKWIQ---SSAAKAIKNKPELKKYREAIKILNDG------NEANAYDILASQNILEKKLVG-----------IVINKPDYNLHVVEEKEV--LSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFAEIDTN 2003
            ++ R  P  C   D     + + +        +   G+++IV S D K   +W    I       + + LL+ +YL + V+    +  +    +PS +ICN+ P+S           LR  R          +  +L+    F +   + ++S+  + E++   +  K+L H L++M++ C+ N          E   V  + T     Y NC+++   +R  +     E  + L   V   + +        F N     +G  +V+H   S P    + +++ PG  + V LK I +     PYG C+      +  YK    YT  AC  +  Q+ I + C C +   P   S +  FC  +      K    I    +N   ++   S+ ++A      + C+    +  + DR      GC+ PC+  SY    S+S WP + Y L  ++       +A +N      Y    K+ +        N+++  DIL+    L +K +            + +N    +L VVE +++    L    +  GG   +W+G++++ I+E+IE++I    +  N
Sbjct:   22 MRNRYHPHHCNYSDNRSAIDIIAE----LGSESNAHGLAKIVTSRDTKRKVIWALLVIAGFTAATLQLSLLVRKYLQFQVVELSEIKDSMPVQYPSVSICNIEPIS-----------LRTIRRMYFNNESQNLITWLRFIQKFRFEQDSFMNSIRAFYENLGQDA--KKLSHNLEDMLMHCRFN---------RELCHVSNFSTFFDGNYFNCFTFNSGQRLQMHATGPENGLSLIFSVEKDDPLPGTYGVYNFDNNILHSAGVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTRLPYPYGNCTNDMLNGIKQYK----YTFFACLQLCKQRLIIQRCGCKSSALPEVPSYNATFCGVI------KDWQEINRNHSNEDHNQ---SEEDRAFIPTPYLACEEREQKNLNNDRTYELSCGCFQPCSETSYLKSVSLSYWPLEFYQLSAVERFFKQERQAGQNHFMKTAYEYLEKLAHPSQKHLARNDSHMDDILSKSYSLSEKEMAKEASDLIRQNMLRLNIYLEDLSVVEYRQLPAYGLADLFADIGGTLGLWMGISVLTIMELIELVIRLTGLVFN 565          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q21974|UNC8_CAEEL (Degenerin unc-8 OS=Caenorhabditis elegans OX=6239 GN=unc-8 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 5.068e-12
Identity = 89/386 (23.06%), Postives = 149/386 (38.60%), Query Frame = 3
Query:  858 KELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIH--NRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFAEIDTNQG 2009
            + L + L+E V+ C  N  D        C     ++  + P+Y NCY++   +   LK +       L   +N  +          T+ +G  LV+H  ++  FPD   YS     G ++   LKT +    + P+G CS   +   Y+Y E Y+  EG C    FQ K+ E C C    FP            LP   H+    + KSK     +D+ C+S++          ++    +H      C  PC    +ET  S S+WP++++ +     +   A+ +            I ND      Y          +    I I     N   ++E    +L +  S  GG   +WIG ++I   E  E+     ++   +G
Sbjct:  410 RNLSYTLNEFVLRCSFNSKD--------CSMERDFKLHVDPEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNVHQSD----YMPTTEAAGVRLVVHEQDQEPFPDTFGYSA--PTGFISSFGLKTKELHRLSAPWGNCSDTFRPVPYIYNEHYS-PEG-CHRNCFQLKVLEICGCGDPRFP------------LPSEEHRHC--NAKSK-----IDRQCLSNL---------TSDSGGYHHLHEQCECRQPCHEKVFETAYSASAWPSQNFKI----GTDCPAVSD------------IFNDTEACTEY--------YRQNTAYIEIYYEQLNFESLKETAGYTLVNLFSDFGGNIGLWIGFSVITFAEFAELFCEICKLMYFKG 727          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|O13263|SCNNH_XENLA (Amiloride-sensitive sodium channel subunit gamma-2 OS=Xenopus laevis OX=8355 GN=scnn1g-b PE=1 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 9.962e-10
Identity = 76/384 (19.79%), Postives = 149/384 (38.80%), Query Frame = 3
Query:  864 LGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILH-PQYINCYSYVLYERFSLKTNT-------VELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRC----SKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLI 1979
            +G+  DE+++ C          + D      R  T+ H P Y NCY++   ER +L  ++       +++ +Y+ E+          ++   +  +GA +++H++  +P I      L+ GT T + ++  ++   + PY  C    S  + E+LY  K    YT   C    FQ+++   C C   D P    +        P++I+             V L K  V       E + C++             C   C+F  +   RS++ WP+ +   +W+    +  +  K                          ++N+ +  L  + I   D N   + E    ++ + LS  GG   +W+  +M+  +EI+E+  
Sbjct:  252 MGYKADELIVTC----------LFDGLSCDARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDE---------YNPYLSTAAGAKILVHDQDEYPFIEDLGTELETGTETSIGMQLTESTKLSDPYSDCTIDGSDISVENLYNKK----YTLQICLNSCFQREMVRSCGCAHYDQPLPNGAKYCNYEEYPNWIY-----------CYVKLYKQFVQ------EELGCQST------------CRESCSFKEWTLTRSLAKWPSLNSE-EWMLRVLSWELGEK-------------------------LNKNLTKNDLGNLNIFYQDLNSRSISESPTYNIVTLLSNFGGQLGLWMSCSMVCGLEIVEVFF 557          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|P51171|SCNNG_XENLA (Amiloride-sensitive sodium channel subunit gamma OS=Xenopus laevis OX=8355 GN=scnn1g-a PE=1 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.541e-9
Identity = 74/386 (19.17%), Postives = 146/386 (37.82%), Query Frame = 3
Query:  864 LGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILH-PQYINCYSYVLYERFSLKTNT-------VELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCS----KYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKAL--ERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLI 1979
            +G+  DE+++ C            D      R  T+ H P Y NCY++   ER +L  ++       +++ +Y+ E+          ++   +  +GA +++H++  +P I      L+  T T + ++  ++   + PY  C+      + E+LY  K    YT   C    FQ+++   C C   D P    +        P +I+                   C   + K    E + C++             C   C+F  +   RS++ WP+ +   +W+    +  +  K                          ++N+ +  L  + I   D N   + E    ++ + LS  GG   +W+  +MI ++EIIE+  
Sbjct:  252 MGYKADELIVTC----------FFDGLSCDARNFTLFHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDE---------YNPYLSTAAGAKILVHDQDEYPFIEYLGTELETATETSIGMQLTESAKLSDPYSDCTMDGRDVSVENLYNKK----YTLQICLNSCFQREMVRSCGCAHYDQPLPNGAKYCNYEEYPSWIY-------------------CYFKVYKQFVQEELGCQS------------ACRESCSFKEWTLTRSLAKWPSLNSE-EWMLRVLSWELGEK-------------------------LNKNLTKNDLANLNIFYQDLNSRSISESPTYNIVTLLSNFGGQLGLWMSCSMICVLEIIEVFF 557          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|O97741|SCNNA_RABIT (Amiloride-sensitive sodium channel subunit alpha OS=Oryctolagus cuniculus OX=9986 GN=SCNN1A PE=2 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 2.112e-9
Identity = 75/360 (20.83%), Postives = 138/360 (38.33%), Query Frame = 3
Query:  954 GRWRTILHPQYINCYSYVLYERFSLKTNTVE-----LFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQE----HLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYL----PCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFAEI 1994
            G +    HP Y NCY++      SL  +++      L + L  E N        F  + + ++GA +++H +     ++    NL+PG  T + ++          YG C++   +    +LY  K    YT+  C    FQ+ + +EC C  I +P  E   + +C                              D  K      C   +   +  DR+ GC+     PC+  +YE     S WP+ +    W+                  + + + N+   +N  + +A  NI  K+L          N     E   +++ + LS  G  +S+W G +++++VE+ E+L   + I
Sbjct:  269 GNYSHFHHPMYGNCYTFNDKNNSSLWMSSMPGINNGLSLTLRTEQND-------FIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKESLDRLGGDYGDCTQNGSDVPVKNLYRSK----YTQQVCIHSCFQENMVKECGCAYIFYPLPE--GVEYC------------------------------DYRKHNSWGYCYYKLQDAFSSDRL-GCFTKCRKPCSVTNYELSAGYSRWPSVTSQ-DWV-----------------FQMLSLQNNYTVSNKRNGVAKLNIYFKEL----------NYKANSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELLFDLSVI 556          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4V3SD10 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009422 PE=3 SV=1)

HSP 1 Score: 506.523 bits (1303), Expect = 4.431e-167
Identity = 256/540 (47.41%), Postives = 362/540 (67.04%), Query Frame = 3
Query:  399 KPKRGECMKKEFLLFCQNTTIRGVSRIVKSTDKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYNVIHPPRVLSNKESPFPSFTICNLRPLSPDVRSFLANEKLRNPREFASRLNQYAVSRYLKKNDSFHYAASTAISSMGGYLESMPNTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMY-KEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSC-----PSIKSKLTNV----SLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGN-EANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHF 1985
            KP R + +KKE +LFCQ TTIRGV+R+V +  K    +W    + L IGL  CM  L  QYL+Y+VIHPP+VL +  SPFPS T+CNLRPL+ +    L   +++ PR+FA  +N +A   +  K D   Y   T+  SMGGYLES+P      +LGH +++ +I C V Y +G++ +L++C  VGRWR  +H QY+NCYSY L E++     T+ELFVYL    N T C+DCF + +K+QLSGA +V+HN  ++PDINQ  +N+QPG+LTE+K+KTIK+I KTPPYGRCS  T + + +Y    Y Y+E AC+  T Q +IN+ C C AI+FP+  SSS+PFC ++  F+H+ SC         SK+ N     SL  +C++++E     + CK++VTR + GD V  C LPC F+SYETDRS S+WPTKS+ L W+ + A + I N+PEL  YREA  ++   N +  A  +L+  N+LEK L+ I+I +P++NLH VEEKEVLSLTS LSQ+GGL SIWIG+ +++++E+ E+L+H 
Sbjct:   31 KPIRTK-IKKELILFCQTTTIRGVTRVVNARSKSFQIVWASSVLFLFIGLFTCMFFLTRQYLEYHVIHPPQVLRDTPSPFPSITLCNLRPLASEATKVLEESRIKTPRKFAMDVNNFAAEAFYHKGDVHSYQLITSAISMGGYLESLPPEIRL-QLGHHMNQTIIHCMVLYSEGSKRVLNDCHQVGRWRRFVHAQYLNCYSYDLLEKYRDHVRTIELFVYLDVPPNKTSCVDCFSAEIKSQLSGAVVVVHNADTYPDINQEGINIQPGSLTEIKVKTIKHIQKTPPYGRCSPDTPKTIELYGAAPYRYSEHACRMSTIQTQINDRCGCNAIEFPY-RSSSLPFCLAMGSFVHEGSCDVQSLQGSGSKVANSTKIGSLKSECLAELEVVKNHVTCKSDVTRHFEGDVVPSCTLPCQFFSYETDRSTSTWPTKSWQLGWLGTRAGRMILNRPELAPYREARDLMRQPNGDVRAQTLLSQTNVLEKNLLAIMIIRPNFNLHNVEEKEVLSLTSLLSQTGGLLSIWIGMNIMSVIELFELLVHL 567          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4E0S173 (FMRFamide-activated amiloride-sensitive sodium channel OS=Fasciola hepatica OX=6192 GN=D915_002784 PE=3 SV=1)

HSP 1 Score: 484.952 bits (1247), Expect = 7.081e-159
Identity = 260/556 (46.76%), Postives = 360/556 (64.75%), Query Frame = 3
Query:  387 QSDDKPKRGECMKKEFLLFCQNTTIRGVSRIVKSTDKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYNVIHPPRVLSNKESPFPSFTICNLRPLSPDVRSFLANEKLRNPREFASRLNQYAVSRYLKKNDSFHYAASTAISSMGGYLESMP-NTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMY-KEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSC----------------PSIKSKLTNVSLDKD----CVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILN-DGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHF 1985
            Q     K+G  +K E L+FCQ TTIRGV+RIV + +K     W+   I L IGL  CM  L  QYL+YNVIHPP+VL +  SPFPS T+CNLRPL+ +    L +  L+NPR+FAS +N++A   Y   ND   Y   T+  SMGGYLES+P N S+   LGH   + +I C V + +G++ +L++C  VGRWR  +H QY+NCY+Y LYE +     T+ELFVYL   +N T C+DCF S +K+QLSGA +V+HN  ++PD+NQ  +N+QPG+LTE+K+KTIK+  KTPPYGRCS  T   + +Y  E Y Y+E AC+  T Q KIN  C C AI+FP+  + S+PFC ++  F+++  C                P       N S+ ++    C  ++E     + CK+ VT+ + GD V  C LPCTF+SYETDRS S WPTKS+ L W+ +   + + N+P+++ YR A K+L   G EA A  ILAS ++LE+ L+ I++ +P+ NLH VEEKEVLSLTS LSQSGGL SIWIGL M++++E++E+L+H 
Sbjct:   20 QPQHSVKKG--LKDELLIFCQTTTIRGVTRIVTARNKTFQTAWVCSVIALFIGLFTCMFFLTRQYLEYNVIHPPQVLRDTPSPFPSMTLCNLRPLTSNATKILESLNLKNPRQFASDVNKFAAKTYYYNNDFLSYQLVTSAISMGGYLESLPLNVSHI--LGHNRSDTIIHCMVLHTEGSKRVLNDCEQVGRWRQFVHAQYLNCYTYDLYEAYRDHVRTIELFVYLDGPMNKTACLDCFSSEIKSQLSGAVVVVHNSDTYPDVNQEGINIQPGSLTEIKVKTIKHTQKTPPYGRCSPNTPVSIQLYGSESYAYSEHACRMSTIQSKINTRCGCNAIEFPY-LNGSLPFCLAMSSFVYRGGCEDHTNISRSQSDTTVSPEPNRSPKNSSIHRNPTEICYQELETVKRHVACKSEVTKHFQGDVVPSCTLPCTFFSYETDRSASVWPTKSWQLSWLGTKVGRTLVNRPDMESYRRARKLLTIPGGEAEAKTILASSSVLEQNLLAIMLIRPNLNLHNVEEKEVLSLTSLLSQSGGLLSIWIGLNMMSVIEVLELLVHL 570          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A3Q0KSP8 (Putative amiloride-sensitive sodium channel OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 478.019 bits (1229), Expect = 5.568e-156
Identity = 265/591 (44.84%), Postives = 372/591 (62.94%), Query Frame = 3
Query:  420 MKKEFLLFCQNTTIRGVSRIVKSTDKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYNVIHPPRVLSNKESPFPSFTICNLRPLSPDVRSFLANEKLRNPREFASRLNQYAVSRYLKKNDSFHYAASTAISSMGGYLESMPNTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMY-KEDYTYTEGACKFVTFQQKINEECKCIAIDFPF-NESSSMPFCTSLPHFIHKKSC----PSI------------------------KSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDG-NEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFAEIDTNQGETKTIRTLEIRTRPCSSRRCVLNDVDTRGV 2099
            +KKEFL FCQ TTIRGV+R+V + +K +  LW+G  I+   GL +CM +L  QYL+YNVIHPP+VL +  SPFPS T+CNLRPLS +    L   KL++PR+FA  LN +A   Y   ND   Y   T+  SMGGYLES+P     K LGH L   VI C V + +G++ +++EC  VGRWR  +H QY+NCY+Y ++E +     T+ELFVYL E +N T C DCF S +K+QLSGA + +HN  ++PDINQ  +N+QPG+LTE+K+KTIK+  KTPPYGRCS  T   + +Y  E Y Y+E AC+  T Q KIN  C C AI+FP+ NE  S+PFC  +  F+   +C    P I                        K+K   +  + +C+S++E    R++CK+ VT+ Y GD V  C LPC F++YETDRS S+WPTKS+ L W+ + A K + N+P+L  YR A + L+    E  A + L+  N+LE+ L+ I++ +P++N+H V+EKEVLSLTS LSQSGGLFSIWIGL M++++E++E++ H         + K +R  + +   C + + + N     GV
Sbjct:   20 LKKEFLYFCQTTTIRGVTRVVNARNKTLQILWIGSVILFFGGLFICMFILTRQYLEYNVIHPPQVLRDTPSPFPSLTLCNLRPLSSEANIILNKYKLKSPRQFAIDLNNFAAKAYYYSNDIHSYQQVTSAVSMGGYLESLPQIVVPK-LGHNLSHTVIHCMVIHAEGSKRVMNECIQVGRWRRFVHAQYLNCYTYDIHEIYRNHVRTIELFVYLDESMNITSCSDCFSSEIKSQLSGAVVTVHNAETYPDINQEGINIQPGSLTEIKVKTIKHTQKTPPYGRCSPDTPTKINLYGSEVYAYSEHACRMSTIQAKINSLCGCNAIEFPYINE--SLPFCLEMSSFVKIGNCDIQHPIIQNYTIHNSPSNQNYTLLSSVNQNQKTKPHEMPFNFECLSELEAVKNRVLCKSEVTKHYQGDVVLSCTLPCAFFAYETDRSTSTWPTKSWQLSWLSTRAGKKVANRPDLVGYRLAKEKLDSSEGEKEAEEFLSKSNVLERNLLAIMLIRPNFNVHKVDEKEVLSLTSLLSQSGGLFSIWIGLNMMSVIEVVELIFHLITRCRQFSKRKRLRRTQKKQTTCDTPKSLTNTNSETGV 607          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A158QSX4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1629 PE=3 SV=1)

HSP 1 Score: 471.855 bits (1213), Expect = 1.162e-154
Identity = 257/531 (48.40%), Postives = 345/531 (64.97%), Query Frame = 3
Query:  426 KEFLLFCQNTTIRGVSRIVKSTDKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYNVIHPPRVLSNKESPFPSFTICNLRPLSPDVRSFLANEKLRNPREFASRLNQYAVSRYLKKNDSFHYAASTAISSMGGYLESMPNTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKE-DYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCP----SIKSKLTNVSLDKD----CVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILN---DGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIH 1982
            +EFL FCQ TTIRGVSRIVK+ +K I  LWL F I L IGL  CMILL+ QY+DY+VIHPPRVL +  SPFPS T+CNLRP+SP     + N K R+PREFA+ LN +A   Y  +N S  Y   ++  SMGGYLES+P  S +  LGH  +E VI C V Y++G+  I ++C  VG+WR   H  Y+NC+S+ L    S +  TVELF YL E  +  EC DCF S +K+QLSGA +V+H   ++PD+NQ  +N+QPGTLTE+K+K I+NI K PPYGRCS  T   +  Y    Y Y+E  C+ +T Q +IN+ C C AI+FP     ++PFC S+  F+ +  C       +++  N +   +    C   +  A +RI+CK  V  R+  D V  C LPC FYSYETDRS S+WPTKS+ L W+++   + I   PE+ +YR A ++L+   D N      ILA  N +E+ L+ I++ +P++NLH V EKEV SLTSFLSQ+GGL SIWIGLTMI +VE+IE++I+
Sbjct:   15 QEFLRFCQTTTIRGVSRIVKAPNKGIRSLWLTFVIALFIGLFACMILLVRQYVDYDVIHPPRVLRDTPSPFPSLTLCNLRPISPPGMKKIRNLKFRDPREFANNLNSFAAGLYFYRNKSHDYELVSSAISMGGYLESLPKGSSYS-LGHMRNETVIQCLVLYLEGSSRITEQCEKVGKWRHFFHALYLNCHSFDLDPSISQQVLTVELFSYLNERHDDVECHDCFASEIKSQLSGAVVVVHTAKTYPDVNQEGINVQPGTLTEIKIKAIENIQKEPPYGRCSLDTPTEIPSYDNISYAYSEYGCRMLTIQNEINKNCNCNAIEFP-RMDDTLPFCMSMVDFVKENRCVYEDMVKQAQALNATGPSEEFLLCEKQLNMARDRILCKAQVMHRFQSDVVPTCTLPCAFYSYETDRSTSTWPTKSWQLTWLKTPIGRTILQMPEMSEYRRAEELLDQPGDKNRDEVLRILAENNAVERNLLAIMVVRPNFNLHKVAEKEVFSLTSFLSQAGGLLSIWIGLTMICLVEVIELIIN 543          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A0R3W5S0 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5486 PE=3 SV=1)

HSP 1 Score: 469.159 bits (1206), Expect = 2.415e-153
Identity = 253/537 (47.11%), Postives = 345/537 (64.25%), Query Frame = 3
Query:  423 KKEFLLFCQNTTIRGVSRIVKSTDKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYNVIHPPRVLSNKESPFPSFTICNLRPLSPDVRSFLANEKLRNPREFASRLNQYAVSRYLKKNDSFHYAASTAISSMGGYLESMPNTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKE-DYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKD----------CVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILN--DGNEA----NAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIH 1982
            K+EFL FCQ TTIRGVSRIV S +K I  LWL F I L IGL  CMI+L  QY DY+VIHPPRVL +  SPFPS T+CNLRPLSP     +   + R+PR+FA  LN++A   Y  +N S  Y   ++  SMGGYLES+P  S +  LGH  +E VI C V Y++G+  I++ C  VGRWR   H  Y+NC+S+ +    S +  T+ELF YL E  +  EC DCF S +K+QLSGA +V+H  +++PD+NQ  +NLQPGTLTE+K+K I+NI K PPYGRC++ T   +  +    Y Y+E  C+  T Q +IN+ C C AI+FP   + S+PFC S+  F+ K  C  +  K+   +  ++          C + +  A +RI+CK  V + + GD V  C LPC FYSYETDRS S WPTKS+ L W+ +   + I   PE+ +YR A+++L+  DG+          IL   N +E+ L+ I++ +P++NLH V EKEV SLTSFLSQ+GGL SIWIGLTMI +VE++E++I+
Sbjct:   14 KQEFLRFCQTTTIRGVSRIVNSPNKGIRSLWLTFVISLYIGLFTCMIILASQYFDYDVIHPPRVLRDTPSPFPSLTLCNLRPLSPPGMKRIRQLQFRDPRDFAKNLNEFAAGLYFYRNRSHDYELVSSAISMGGYLESLPKGSSYS-LGHLQNETVIQCMVLYLEGSSRIIEPCEKVGRWRHFFHALYLNCHSFDIDPGISQRVLTIELFSYLNERHDEVECHDCFASEIKSQLSGAVVVVHTASTYPDVNQEGINLQPGTLTEIKIKAIENIQKEPPYGRCARDTPTEIPGHDNLSYAYSEYGCRMYTIQAEINKNCNCNAIEFPII-NGSLPFCMSMVDFVKKNRC--VYEKMVKQAGMRNSTGPSEEFLTCEAQLNMARDRILCKALVMQEFQGDVVPTCTLPCAFYSYETDRSTSMWPTKSWQLTWLSTDVGRTILEMPEMAEYRRAVEMLSQPDGDTGASKREVLRILEQNNAVERNLLAIIVVRPNFNLHKVAEKEVFSLTSFLSQTGGLLSIWIGLTMICVVEVLELIIN 546          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Match: asic4a (acid-sensing ion channel 4 [Source:NCBI gene;Acc:103040152])

HSP 1 Score: 57.3806 bits (137), Expect = 4.223e-8
Identity = 76/381 (19.95%), Postives = 146/381 (38.32%), Query Frame = 3
Query:  855 FKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKT------NTVELFVYLGEEVNTTECIDCFFSNVKTQL-SGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEML 1976
            F   GH LDEM+  C  N+   N    D         ++++ +Y  CY++   +  S KT      N +E+ +    ++   E +  +    +T L +G  + IH++   P I+Q    + PG  T V  +  +      P+G C   T++ +  Y    TY+  AC+     Q + +EC+C  +  P  +                  CP  K K             +++AL        + ++  GD    C  PC    Y  + S+   P+K          +A+ +      +KY +                  S++ +    + + I     N   +E+K+   +   L   GG   ++IG +++ ++EI++ +
Sbjct:  167 FNRTGHQLDEMLKSC--NFSGQNCSAED--------FSVVYTRYGKCYTFNGNKTTSRKTKQGGMGNGLEIML----DIQQDEYLPIWRETNETSLEAGIRVQIHSQDEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRSSTEQLIPGYD---TYSISACRLHCETQAVQQECQCRMVHMPGTDD----------------ICPPNKIKC------------VDRALA-------LLQKSSGDSCP-CETPCNLTRYGKELSMVKIPSK---------GSARYLS-----RKYHK------------------SEDYIRDNFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASILTVLEILDYI 462          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Match: asic4b (acid-sensing ion channel 4 [Source:NCBI gene;Acc:103044180])

HSP 1 Score: 50.8322 bits (120), Expect = 4.574e-6
Identity = 93/468 (19.87%), Postives = 170/468 (36.32%), Query Frame = 3
Query:  618 SNKESPFPSFTICNLRPLSPDVRSFLANEKLRNPREFASRLNQYAVSRYLKKNDSFHYAASTAI--SSMGGY----LESMP--NTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSY------VLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQL-SGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEML 1976
            S +E  FP+ T+CN                          +N++  S  L   D +H A  T +   S GG+    L+  P      F+  GH L++M+  C  N+   N  + D         ++++ +Y  CY++          R     N +EL +    ++   E +  +    +T L +G  + IH++   P I+Q    + PG  T V  +  +      P+G C   T+  +  Y    TY+  AC+      ++  EC C  I  P     S   CT       K  C                   +++AL        + ++  GD    C  PC    Y  + S+   P+K          +A+ +      +KY                    +++ +    + + I     N   +E+K+   +   L   GG   ++IG +++ I+EI++ +
Sbjct:  111 SRRELTFPAVTLCN--------------------------VNRFRFSA-LTDADIYHLANLTGLPPKSRGGHRPGELQYPPPDMLDIFQRTGHQLEDMLKSC--NFSGQNCSVHD--------FSVVYTRYGKCYTFNGNRTSAKRTRQGGMGNGLELML----DIQQDEYLPIWRETNETTLEAGIRVQIHSQDEPPYIHQLGFGVSPGFQTFVSCQEQRLSYLPQPWGNCRASTEPVIPGYD---TYSVSACRLHCESIQVQRECNCRMIHMP----GSADICTPA-----KVKC-------------------VDRAL-------GLLQKSTGDSCP-CETPCNVTRYGKELSMVKIPSK---------GSARYLS-----RKYH------------------TTEDYIRDNFLILDIYFEALNYETIEQKKAYDIAGLLGDIGGQMGLFIGASILTILEILDYI 466          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Match: asic4a (acid-sensing ion channel 4 [Source:NCBI gene;Acc:103040152])

HSP 1 Score: 50.0618 bits (118), Expect = 8.159e-6
Identity = 46/188 (24.47%), Postives = 82/188 (43.62%), Query Frame = 3
Query:  855 FKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKT------NTVELFVYLGEEVNTTECIDCFFSNVKTQL-SGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFP 1397
            F   GH LDEM+  C  N+   N    D         ++++ +Y  CY++   +  S KT      N +E+ +    ++   E +  +    +T L +G  + IH++   P I+Q    + PG  T V  +  +      P+G C   T++ +  Y    TY+  AC+     Q + +EC+C  +  P
Sbjct:  167 FNRTGHQLDEMLKSC--NFSGQNCSAED--------FSVVYTRYGKCYTFNGNKTTSRKTKQGGMGNGLEIML----DIQQDEYLPIWRETNETSLEAGIRVQIHSQDEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRSSTEQLIPGYD---TYSISACRLHCETQAVQQECQCRMVHMP 337          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: SCNN1B (sodium channel epithelial 1 beta subunit [Source:HGNC Symbol;Acc:HGNC:10600])

HSP 1 Score: 53.5286 bits (127), Expect = 1.507e-7
Identity = 75/342 (21.93%), Postives = 129/342 (37.72%), Query Frame = 3
Query:  936 DECPSVGRWRTILHPQYINCYSYVLYER---FSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCS-KYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMI 1949
            D C S   + T  HP Y NC+ +   E      +    VE  + L   ++  E I        T ++GA +++H++ ++P ++   V ++ G  T V ++  +   +  PY  C+   T   +        Y+  AC    FQ K+ E C C    +P        +C +  +F   + C   K     V  D DC +         ICK                 PC    Y+   S+S WP++S    WI    +K  K+           +I N             Q+I++  L        ++N   + E    ++ + LS  GG F  W+G +++
Sbjct:  258 DTC-SATNFTTFFHPMYGNCFIFNWGENETVMQVSNPGVEYGLKLVLSIDQDEYIPFL-----TTIAGAVIMVHDQNTYPFLSDLGVFVKTGVETSVGIEVGQLQRQGAPYSDCTMDGTDLPITNLYNGTAYSVQACLRSCFQTKMIEMCGCGYYLYPLPPGEK--YCQN-QNFTGWRYC-YYKLYEQFVEEDMDCYT---------ICKQ----------------PCIESEYKMSISMSDWPSQSSE-DWIFHILSKERKHN--------VSRIFN-----------RKQDIIKLNLF-----FQEFNSMTISESPAQTIVTLLSNLGGQFGFWMGGSVL 539          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO42137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2F2])

HSP 1 Score: 69.3218 bits (168), Expect = 2.940e-12
Identity = 96/471 (20.38%), Postives = 181/471 (38.43%), Query Frame = 3
Query:  636 FPSFTICNLRPLS-----PDVRS----FLANEKLRNPREFASRLNQYAVSRYLKKNDSFHYAASTAISSMGGYLESMPNTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLY-----ERFSLKTNTV-----ELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHL---YMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYRE--AIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEML 1976
            FP  TICN+  L      P +R+     + N    +PR  ++  N +   + L   ++  +    A+++   Y E            H L+++++ C  N V+         P+   W    +  + NCY +        E+  L +++V      L + L  E N       +   + T+++G  + I ++   P   Q  + + PG  T +++  ++     P   R  + + E       +  + TY+  ACK+     +  E C C   + P  +  ++P C  L   I                   DC++      E   C          DR   C   C+  S++   S + WP +S+                 E+ KY     +++LN    +++   + S+NI +   V +   + DY L  V+E    +  S LS  GG   +WIG++ +   E+IE++
Sbjct:   83 FPVVTICNMNVLRASRLPPKLRTKFDQIINNTNKTSPRNSSNSRNAFVDPQDLSFEETKKFEILHAVTAHDDYRE-------LVSAAHQLEDILLSCNFNGVNCRNSKDPTIPTY--WTQTWNDNFGNCYMFNSVKTHNGEKVDLYSSSVPGESNGLTLQLNLEQNE------YLEGI-TEVAGMKVTISDQGVLPFPGQQGIRIMPGQSTGIQMTKLQTRRIDPFKNRSCESSNEMSDKNLFFGYNMTYSIMACKYSCLNARKIERCGCTNYNTPEMQKRNIPLCNRLNSTI------------------IDCLNKAYDTFEDGSC----------DR--ECPPSCSEVSFDLTVSSARWPARSF-----------------EVTKYAYFLRVRVLNKIASSSSKYFVNSENIAQ---VHVYYGELDYLL--VQETLAYTFMSLLSDIGGQMGMWIGISALTCAELIELV 485          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO37667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF92])

HSP 1 Score: 56.6102 bits (135), Expect = 2.580e-8
Identity = 62/284 (21.83%), Postives = 108/284 (38.03%), Query Frame = 3
Query: 1161 FPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQ-----EHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRV---EGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFA 1988
             P   +  +++ PG  T   ++ + NI++  P+   S  +      E+LY  + + +Y+   C       K  + C C+   FP                                ++D   V DI   ++ I C N V   Y  +++   E C  PC    ++   S + WPT  Y   ++            ELK+ +  +   N   +A AY             V + I   + N  V+EE     L +F+S  GG   +WIG++ +   E++E+LI  A
Sbjct:    1 MPSPLEKGISVSPGFSTTTGIR-MTNILRADPFNNKSCLSSDDIDPENLYRKRYNVSYSRTTCMDSCLAHKQVDMCGCLEYRFP--------------------------------NIDNRTVCDILD-IDVIRCLNKVQSLYQDNKLGCSEKCRPPCNEEVFKLSISSARWPTDDYEAHFLD-----------ELKEDKGFVLPAN--ADARAY------------FVKLQIFYEELNHEVIEEYRSYELVNFVSDIGGQLGLWIGISALTASELVELLIVIA 225          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO37452 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFR0])

HSP 1 Score: 50.447 bits (119), Expect = 2.596e-6
Identity = 46/179 (25.70%), Postives = 76/179 (42.46%), Query Frame = 3
Query: 1461 CPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRV---EGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFA 1988
            C  ++ +  N+  D   V DI   ++ I C N V   Y  +++   E C  PC    ++   S + WPT  Y   ++            ELK+ +  +   N   +A AY             V + I   + N  V+EE     L +F+S  GG   +WIG++ +   E++E+LI  A
Sbjct:  968 CGCLEYRFPNI--DNRTVCDILD-IDVIRCLNKVQSLYQDNKLGCSEKCRPPCNEEVFKLSISSARWPTDDYEAHFLD-----------ELKEDKGFVLPAN--ADARAY------------FVKLQIFYEELNHEVIEEYRSYELVNFVSDIGGQLGLWIGISALTASELVELLIVIA 1118          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Match: asic4a (acid sensing ion channel subunit family member 4 [Source:NCBI gene;Acc:101159336])

HSP 1 Score: 55.0694 bits (131), Expect = 2.280e-7
Identity = 76/379 (20.05%), Postives = 144/379 (37.99%), Query Frame = 3
Query:  855 FKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKT------NTVELFVYLGEEVNTTECIDCFFSNVKTQL-SGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIE 1970
            F   GH L+EM++ C  N+   N    D         ++++ +Y  CY++   +  S KT      N +E+ +    ++   E +  +    +T L +G  + IH++   P I+Q    + PG  T V  +  +      P+G C   ++E    Y    TY+  AC+ +    ++   CKC  +  P                     CP  K            +S ++KAL ++       ++  GD    C  PC    Y  + S+   P+K          +A+ +  K                     YD   S++ +    + + I     N   +E+K+   +   L   GG   ++IG +++ ++EI++
Sbjct:  164 FNRTGHQLEEMLMSC--NFSGQNCSAED--------FSVVYTRYGKCYTFNGNKTASRKTKQGGMGNGLEIML----DIQQDEYLPIWRETNETSLEAGIRVQIHSQDEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRSTSKEKFPGYD---TYSISACRLLCETNEVLRVCKCRMVHMPGTAD----------------ICPPSK------------ISCVDKALAQL-------QKNSGDTCP-CETPCNLTRYGKELSMVKIPSK---------GSARYLSRK---------------------YD--KSEDYIRDNFLVLDIFFEALNYETIEQKKAYDVAGLLGDIGGQMGLFIGASILTVLEILD 457          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000037525.1 (SMESG000037525.1)

HSP 1 Score: 1109.75 bits (2869), Expect = 0.000e+0
Identity = 570/571 (99.82%), Postives = 570/571 (99.82%), Query Frame = 3
Query:  213 MESSNFNFNDTNLKENPYAVIDNRNFKLPPSYNNCNKIRSNSYSPTQSIKKRNSPSTCQSDDKPKRGECMKKEFLLFCQNTTIRGVSRIVKSTDKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYNVIHPPRVLSNKESPFPSFTICNLRPLSPDVRSFLANEKLRNPREFASRLNQYAVSRYLKKNDSFHYAASTAISSMGGYLESMPNTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFS 1925
            MESSNFNFNDTNLKENPYAVIDNRNFKLPPSYNNCNKIRSNSYSPTQSIKKRNSPSTCQSD KPKRGECMKKEFLLFCQNTTIRGVSRIVKSTDKKIFFLWLGFFIILCIGLLVCMILLLLQYLDYNVIHPPRVLSNKESPFPSFTICNLRPLSPDVRSFLANEKLRNPREFASRLNQYAVSRYLKKNDSFHYAASTAISSMGGYLESMPNTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFS
Sbjct:    1 MESSNFNFNDTNLKENPYAVIDNRNFKLPPSYNNCNKIRSNSYSPTQSIKKRNSPSTCQSDHKPKRGECMKKEFLLFCQNTTIRGVSRIVKSTDKKIFFLWLGFFIILCIGLLVCMILLLLQYLDYNVIHPPRVLSNKESPFPSFTICNLRPLSPDVRSFLANEKLRNPREFASRLNQYAVSRYLKKNDSFHYAASTAISSMGGYLESMPNTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFS 571          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000028687.1 (SMESG000028687.1)

HSP 1 Score: 514.998 bits (1325), Expect = 1.064e-174
Identity = 260/521 (49.90%), Postives = 364/521 (69.87%), Query Frame = 3
Query:  414 ECMKKEFLLFCQNTTIRGVSRIVKSTDKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYNVIHPPRVLSNKESPFPSFTICNLRPLSPDVRSFLANEKLRNPREFASRLNQYAVSRYLKKNDSFHYAASTAISSMGGYLESMPNTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEML 1976
            + +K+EFL FC+NTTIRGV +I+KS  K + ++W+  FI+L  G  VC I LL QY  Y+VIHPPR+L+N ++PFPSFT+CNLRPL+ ++ +    + L+ PREFA  +N YA+  +  KN+   Y  +++I  MGGYLES+PN SY  ELGH   +++I C+V Y+ G++P   +C  +G+WR I+H QY+NCY + L E  S  TNT+E+F+YL E +N   CIDCF S+VK+QLSGA ++IH   +FP+ N+  +NLQPGTLTE+KLKTI N  K PPYGRCS  T + + ++ E Y Y+E  CK +T Q  +N  C C AI++PFN  SS+ FC++LP F  + SC        N   D+ C ++++  +++I CK      Y+ D V  C LPC+FYSYETDRS S+WPTKS+ L+WI + AAK + +K EL  YR A+K+   GN + A  IL  +N +E+K++ ++IN+P+YN+H+VEEKEVLSLTSFLSQ+GGLFSIWIG+T+ +IVEI EM 
Sbjct:   40 QVIKEEFLRFCENTTIRGVPKIIKSKHKPLRYMWMTCFILLLSGFSVCFIFLLKQYFAYDVIHPPRILTNSQAPFPSFTVCNLRPLARNIDTIFKLKNLKTPREFAKNVNNYAIKYFYNKNNLTLYGHASSIMLMGGYLESVPNKSYV-ELGHKKQDLIIHCRVTYMIGSKPHSKDCDELGKWRRIIHAQYVNCYMFDLIESLSNATNTLEMFLYLDESINQATCIDCFSSDVKSQLSGALILIHRSNTFPNFNRDMINLQPGTLTEIKLKTIHNRHKLPPYGRCSNKTPKWIKVFGELYAYSEDLCKLITIQGDLNHFCNCNAIEYPFN-YSSLKFCSALPSFSQRVSC-------NNRLNDRKCETELKNTVKQISCKAKACLIYNNDIVPSCKLPCSFYSYETDRSTSTWPTKSWQLQWISTKAAKPLLDKQELDNYRYAVKLQEKGNYSEALKILNKENTMEQKILAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLFSIWIGMTLFSIVEIFEMF 551          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000069611.1 (SMESG000069611.1)

HSP 1 Score: 509.605 bits (1311), Expect = 1.101e-172
Identity = 283/570 (49.65%), Postives = 380/570 (66.67%), Query Frame = 3
Query:  396 DKPKRGECMKKEFLLFCQNTTIRGVSRIVKSTDKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYNVIHPPRVLSNKESPFPSFTICNLRPLSPDVRSFLANEKLRNPREFASRLNQYAVSRYL-KKNDSFHYAASTAISSMGGYLESMPNTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKD---CVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFAEIDTNQGETKTIRTLEIRTRPCSSRRCVLNDVDTR 2093
            + P   + +K E L FC+NTTIRGV RIV +T+K    LW+ FFI LC GL +C+  L+ Q+++Y+VIHPPRVL N  SPFPSFT+CN RPLS ++ SF     +RNPREFA   N Y   +YL  + D  HY+  T+  S+ GYLES+P   Y   LGH   + VI C + + +G++  +D C ++G+W+   H Q+INC+SY +   F  +  T+EL++YL EE N + CIDCF SNVK+QLSGA LVIH   SFP+INQ ++NLQPGTLTEV+LKT  N+MKT PYGRC   T  +L M  E Y+YTE  CK  T Q +IN +C C AI++P   + ++ FC++LP FI   SC       TN S DK+   C  +I+ +L+R+ CK++VT  YH D ++ C+LPC +YSYE+DRSIS+WPTKS+ L W+ SS    +++K ELK Y+ A +   +G E  A +IL  Q+ILE KL+ +VIN+P+ NLH VEEKEVLSLTSFLSQ GGLFSIWIGLT+I+IVEIIE+L+  +E              ++  R C SRR  L +V T+
Sbjct:   43 NSPTFKKLLKNELLHFCKNTTIRGVPRIVNTTNKSSKILWISFFIFLCAGLTICLTFLIRQFIEYSVIHPPRVLQNSPSPFPSFTVCNHRPLSYNISSFFNQRNMRNPREFAIAAN-YVSKKYLFDRGDKGHYSLITSSFSLSGYLESIP-LEYHNMLGHDYYDFVIDCLITFRNGSKHHVDLCQNIGQWKVTPHAQFINCFSYNIKAEFIEEVTTIELYLYLNEETNVSRCIDCFISNVKSQLSGALLVIHKSNSFPNINQEAINLQPGTLTEVRLKTFFNVMKTAPYGRCKPNTPSNLEMGNETYSYTEHLCKEKTIQLEINNKCHCNAIEYPV-VNRNLSFCSALPTFIKFGSCE------TN-SHDKEQEKCFEEIKTSLKRLECKSSVTVLYHNDIIDTCFLPCEYYSYESDRSISTWPTKSWQLTWLNSSRGSNVRSKKELKPYKIAAEYFKEGKEDKAIEILNKQDILESKLIAVVINRPNKNLHRVEEKEVLSLTSFLSQLGGLFSIWIGLTLISIVEIIELLMRISE--------------KVLDRCCKSRRLSLINVSTQ 588          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000044381.1 (SMESG000044381.1)

HSP 1 Score: 508.449 bits (1308), Expect = 2.817e-172
Identity = 269/542 (49.63%), Postives = 388/542 (71.59%), Query Frame = 3
Query:  423 KKEFLLFCQNTTIRGVSRIVKSTDKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYNVIHPPRVLSNKESPFPSFTICNLRPLSPDVRSFLANEKLRNPREFASRLNQYAVSRYLKKNDSFHYAASTAISSMGGYLESMPNTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIH-FAEIDTNQGETK-TIRTLEIR 2042
            K+EFL FC+NTT+RGV RIVKS    I  LWL FFI+L IG +VC+I L  QYL+YNVIHPPR+LS+ ++PFPS T+CN RP+  ++   +    +++PREFA  +N+YA+  Y KKN   +Y  +++I +MG YLES+PN + F ELGH   +++I+C+V Y++G+ P    C  +G+WR I+H QYINCYSY LYE +S  TNT+EL+ YL + +  + C+DCF S+VK+QLSGA ++IH R +FP+ N   +NLQPGTLTE+KLK   N+ K PPYGRCS  + + + +Y + Y+Y+E ACK +T Q  IN++C C AI++P  ++ ++ FC++LP FI  K C   +S       D  C   ++  +++IICK+NV+ +Y  D V+ C LPC  YSYE+DRS SSWPTK++ + WI+S+AA+ ++ KPELK Y +A +   +G+   ++ IL  QNILE+ L+ ++IN+P+YN+H+VEEKEVLSLTSFLSQ+GGL SIWIGLTMI+IVE+IEML++ F+++ T +     + R L+I+
Sbjct:   19 KEEFLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDPREFAHSINKYAIKYYYKKNLGKNYQRASSIMNMGAYLESVPNRT-FNELGHDEQDLIIYCQVTYMNGSSPHYKVCSDIGKWRVIIHAQYINCYSYNLYENYSRNTNTMELYFYLDQGIPDSMCLDCFSSDVKSQLSGALVLIHRRLTFPNFNHDIINLQPGTLTEIKLKIFNNVHKEPPYGRCSYKSPKTMKIYNDLYSYSEHACKLLTIQHDINKQCGCNAIEYPI-DNFNLSFCSNLPRFIEGKLCHDDQS-------DMKCKHQLDAVVKKIICKSNVSSQYQKDIVKSCSLPCDIYSYESDRSTSSWPTKTWQMPWIKSNAARRLRKKPELKGYIDAYREYLNGSVNKSFRILNQQNILEQNLLAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLCSIWIGLTMISIVEVIEMLLNCFSQLKTARKRKHFSARELQIQ 551          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000078360.1 (SMESG000078360.1)

HSP 1 Score: 483.411 bits (1243), Expect = 1.504e-161
Identity = 259/527 (49.15%), Postives = 354/527 (67.17%), Query Frame = 3
Query:  420 MKKEFLLFCQNTTIRGVSRIVKSTDKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXDYNVIHPPRVLSNKESPFPSFTICNLRPLSPDVRSFLANEKLRNPREFASRLNQYAVSRYLKKNDSFHYAA--STAISSMGGYLESMPNTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRWRTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNVKTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYGRCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFP-FNESSSMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNVTRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKNKPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHVVEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFAE 1991
            +K E + FCQNTT+RG+ RI+K+  + +  LW+ F +IL IGLL+ M+ L  QYL+YNVIHPP +L ++E PFPS ++CNLRPLS     FL     RNPREF + LN Y  +++     + HY    +TAIS M GYLES+P      +LGH LDE+VI C V Y  G++  + +C S+G W    H  YINC+S  +Y        +V +++YL E + T  C DCF   +K+QLSGA +V+H   ++PDINQ +VNLQPGTLTE  LK I N  K PPYGRCSKYT+ H+ ++  +Y Y+E AC+  T Q++IN+ C+C AI++P FN   S+PFC++LP FI  K C  I SK   V  +K C  +I K    + CKNN+T +Y  D V  C LPC+FYSY +DRS S+WPTKS+ L  I S  A+ ++NK + K Y + I I N+G+E  A ++L   NILE+ L+GI+IN+P+  +HVVEEKEVLSLTS+LSQ+GGLFSI+IGL++I++VE +E+LIH  E
Sbjct:   76 LKHELIAFCQNTTMRGIPRIIKAQSRNLRILWITFVVILFIGLLLSMLFLTKQYLEYNVIHPPVILPDQEPPFPSISLCNLRPLSRFGLEFLKKNNWRNPREFGNNLNVYVANKWYYNQSTKHYYTQFTTAIS-MNGYLESVP-FDVLDKLGHSLDELVIHCLVIYNVGSKSEIQKCGSLGHWTKTTHALYINCHSLTIYPELRNHIKSVIMYIYLDEILKTNLCADCFMQELKSQLSGALVVVHTSDTYPDINQEAVNLQPGTLTEFNLKFILNKNKAPPYGRCSKYTETHIKLHNHNYIYSEHACQLTTIQREINDICRCNAIEYPIFN--LSLPFCSALPSFISHKDC--ISSKTKKVLNNKTCDMEILKVFNNLGCKNNITIKYRSDVVAKCTLPCSFYSYASDRSTSTWPTKSFQLNLINSEKARELRNKEDFKPYLKLINISNEGHETEALEMLEKLNILERNLLGIMINRPNNKVHVVEEKEVLSLTSYLSQTGGLFSIFIGLSIISVVEFLELLIHCVE 596          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCNN1A2.753e-820.21sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A3.077e-820.21sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A3.525e-820.21sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1B4.398e-720.06sodium channel epithelial 1 beta subunit [Source:H... [more]
SCNN1B4.604e-720.29sodium channel epithelial 1 beta subunit [Source:H... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-82.297e-1323.88Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
unc-82.486e-1323.06Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
unc-82.570e-1323.06Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
unc-83.984e-1323.06Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
unc-1057.506e-1019.91Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
asic21.792e-619.84acid-sensing (proton-gated) ion channel 2 [Source:... [more]
asic21.792e-619.84acid-sensing (proton-gated) ion channel 2 [Source:... [more]
asic4a2.569e-621.11acid-sensing (proton-gated) ion channel family mem... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cdh122.003e-1019.17cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
cdh129.094e-1019.33cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
cdh128.407e-818.86cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
lhx15.437e-622.12LIM homeobox 1 [Source:Xenbase;Acc:XB-GENE-482482][more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25011|FANA_CORAP5.856e-2121.44FMRFamide-activated amiloride-sensitive sodium cha... [more]
sp|Q21974|UNC8_CAEEL5.068e-1223.06Degenerin unc-8 OS=Caenorhabditis elegans OX=6239 ... [more]
sp|O13263|SCNNH_XENLA9.962e-1019.79Amiloride-sensitive sodium channel subunit gamma-2... [more]
sp|P51171|SCNNG_XENLA1.541e-919.17Amiloride-sensitive sodium channel subunit gamma O... [more]
sp|O97741|SCNNA_RABIT2.112e-920.83Amiloride-sensitive sodium channel subunit alpha O... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4V3SD104.431e-16747.41Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4E0S1737.081e-15946.76FMRFamide-activated amiloride-sensitive sodium cha... [more]
A0A3Q0KSP85.568e-15644.84Putative amiloride-sensitive sodium channel OS=Sch... [more]
A0A158QSX41.162e-15448.40Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3W5S02.415e-15347.11Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
asic4a4.223e-819.95acid-sensing ion channel 4 [Source:NCBI gene;Acc:1... [more]
asic4b4.574e-619.87acid-sensing ion channel 4 [Source:NCBI gene;Acc:1... [more]
asic4a8.159e-624.47acid-sensing ion channel 4 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SCNN1B1.507e-721.93sodium channel epithelial 1 beta subunit [Source:H... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO421372.940e-1220.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376672.580e-821.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374522.596e-625.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asic4a2.280e-720.05acid sensing ion channel subunit family member 4 [... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037525.10.000e+099.82SMESG000037525.1[more]
SMESG000028687.11.064e-17449.90SMESG000028687.1[more]
SMESG000069611.11.101e-17249.65SMESG000069611.1[more]
SMESG000044381.12.817e-17249.63SMESG000044381.1[more]
SMESG000078360.11.504e-16149.15SMESG000078360.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017073 ID=SMED30017073|Name=FMRFamide-activated amiloride-sensitive sodium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=2263bp
GAAAATAAAAAAACCACCTAATGAAATAGAGTAAATTTAAATAATTTCAT
TAATTTTACAAAACAAAATCGTTTCAAGTGTATCAATTCGTAAGCACAAC
AAGAAAATTAGCCTCAGAAAAATTTCAGTCATGCAATAAATTTCCCATCT
CAAATCTGATTGGTCAAAAAACGTTTTAATATAATTTCAATTGTTAAAAT
TGCAATCAAATTATGGAATCAAGTAATTTCAATTTTAATGACACCAATTT
AAAGGAAAATCCCTATGCCGTAATTGATAACAGAAATTTCAAATTGCCTC
CATCGTATAATAACTGTAATAAAATCAGATCAAATTCTTATTCACCTACT
CAATCAATCAAAAAACGAAATTCCCCATCAACCTGTCAATCGGATGACAA
ACCGAAGAGAGGAGAATGCATGAAGAAAGAATTTCTTTTGTTTTGTCAAA
ACACAACAATCAGGGGGGTGTCGAGAATAGTTAAATCGACTGATAAAAAG
ATTTTCTTTCTCTGGCTCGGATTTTTTATTATTCTCTGCATTGGCTTGTT
AGTTTGTATGATTCTTTTACTGTTGCAATATTTAGACTATAATGTCATAC
ATCCGCCGAGAGTTTTAAGTAATAAAGAGTCGCCCTTTCCGTCATTTACG
ATCTGTAATTTAAGACCACTTTCTCCGGATGTCCGATCATTTCTGGCAAA
TGAAAAGTTAAGGAATCCTCGAGAATTTGCCTCACGCCTCAATCAGTATG
CCGTGAGTCGATATTTAAAGAAAAATGATTCCTTTCATTACGCGGCCAGC
ACGGCAATATCCTCGATGGGAGGTTATTTAGAATCGATGCCAAACACTTC
ATACTTTAAAGAATTGGGTCATGGCTTGGATGAAATGGTGATTTTCTGTA
AGGTTAATTATGTAGATGGAAACCAGCCTATTTTAGACGAATGTCCTTCC
GTTGGAAGATGGAGAACAATTTTACATCCACAATATATTAACTGCTATTC
CTATGTTTTGTATGAAAGATTCAGTCTCAAAACGAATACAGTTGAATTGT
TTGTTTATTTGGGAGAGGAGGTAAACACCACAGAGTGCATTGATTGTTTT
TTCTCGAATGTTAAAACTCAACTTTCCGGAGCTGCGTTAGTTATACATAA
TCGAGCATCCTTTCCTGACATAAATCAGTATAGTGTCAACTTACAGCCTG
GAACGTTAACTGAAGTAAAGCTTAAGACCATTAAAAACATAATGAAAACC
CCACCATATGGAAGATGCTCAAAGTATACTCAAGAACACTTGTACATGTA
TAAAGAAGATTACACATATACAGAAGGGGCTTGTAAATTTGTCACATTTC
AACAAAAAATAAACGAAGAATGTAAATGCATTGCTATAGATTTTCCTTTT
AACGAAAGCTCTTCAATGCCATTTTGCACATCTTTACCTCATTTTATTCA
TAAAAAATCATGTCCAAGCATCAAGAGTAAGTTAACAAATGTTTCACTGG
ACAAAGACTGTGTTAGTGACATTGAAAAGGCCCTAGAAAGAATTATTTGC
AAAAATAATGTAACCAGGCGTTACCATGGAGATAGAGTGGAGGGATGTTA
TTTGCCATGCACGTTTTACTCTTATGAAACAGATCGGTCTATTTCATCAT
GGCCAACGAAATCCTATCATTTGAAATGGATTCAATCCTCTGCAGCCAAG
GCCATCAAAAATAAGCCAGAACTGAAAAAATATCGGGAAGCTATAAAAAT
ATTAAACGATGGAAATGAAGCGAATGCGTATGACATATTAGCCAGTCAAA
ATATTCTTGAAAAGAAACTTGTTGGAATAGTCATTAATAAACCTGACTAT
AATTTGCATGTAGTTGAAGAGAAAGAGGTGTTGAGCTTGACTAGTTTTCT
CAGTCAATCAGGAGGTCTATTTAGTATATGGATTGGTCTGACAATGATTA
ACATTGTGGAAATCATAGAAATGCTCATTCATTTTGCTGAAATTGATACT
AACCAAGGCGAAACTAAAACCATTCGAACATTAGAGATTCGAACTCGCCC
ATGTTCGTCTCGTCGGTGTGTGCTAAATGATGTCGACACTCGCGGTGTTG
ATGTGCTAGAATCGCTTACCGCCAGTAATCAATTGCGAGAAGCTGTGATT
TAATAAATTGTTTAACTTTTTAATTCGTAAAAAATGGTTTTTTTGTATTC
AAATATAAATTTTTAAATGACATAAAATTGTGTTCGCAATTTAAATTTTA
TTGTTAATTGTTG
back to top

protein sequence of SMED30017073-orf-1

>SMED30017073-orf-1 ID=SMED30017073-orf-1|Name=SMED30017073-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=647bp
MESSNFNFNDTNLKENPYAVIDNRNFKLPPSYNNCNKIRSNSYSPTQSIK
KRNSPSTCQSDDKPKRGECMKKEFLLFCQNTTIRGVSRIVKSTDKKIFFL
WLGFFIILCIGLLVCMILLLLQYLDYNVIHPPRVLSNKESPFPSFTICNL
RPLSPDVRSFLANEKLRNPREFASRLNQYAVSRYLKKNDSFHYAASTAIS
SMGGYLESMPNTSYFKELGHGLDEMVIFCKVNYVDGNQPILDECPSVGRW
RTILHPQYINCYSYVLYERFSLKTNTVELFVYLGEEVNTTECIDCFFSNV
KTQLSGAALVIHNRASFPDINQYSVNLQPGTLTEVKLKTIKNIMKTPPYG
RCSKYTQEHLYMYKEDYTYTEGACKFVTFQQKINEECKCIAIDFPFNESS
SMPFCTSLPHFIHKKSCPSIKSKLTNVSLDKDCVSDIEKALERIICKNNV
TRRYHGDRVEGCYLPCTFYSYETDRSISSWPTKSYHLKWIQSSAAKAIKN
KPELKKYREAIKILNDGNEANAYDILASQNILEKKLVGIVINKPDYNLHV
VEEKEVLSLTSFLSQSGGLFSIWIGLTMINIVEIIEMLIHFAEIDTNQGE
TKTIRTLEIRTRPCSSRRCVLNDVDTRGVDVLESLTASNQLREAVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002056medial muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity