Guanine nucleotide-binding protein G(S) subunit alpha

Overview
NameGuanine nucleotide-binding protein G(S) subunit alpha
Smed IDSMED30017055
Length (bp)1803
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Guanine nucleotide-binding protein G(S) subunit alpha (SMED30017055) t-SNE clustered cells

Violin plots show distribution of expression levels for Guanine nucleotide-binding protein G(S) subunit alpha (SMED30017055) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Guanine nucleotide-binding protein G(S) subunit alpha (SMED30017055) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Guanine nucleotide-binding protein G(S) subunit alpha (SMED30017055) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017055

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017055h1SMcG0003881 Contig4365GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017055h1SMcG0013369 Contig4365GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30017055h1SMcG0013369 dd_Smed_v4_4493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017055h1SMcG0013369 dd_Smed_v4_4493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017055h1SMcG0013369 Contig49379newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017055h1SMcG0013369 Contig49379uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Human
Match: GNAL (G protein subunit alpha L [Source:HGNC Symbol;Acc:HGNC:4388])

HSP 1 Score: 211.846 bits (538), Expect = 2.908e-62
Identity = 134/295 (45.42%), Postives = 189/295 (64.07%), Query Frame = 1
Query:  190 EENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKL-----QITPKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            +E R  N +IEK+L   +    +  +LLLLG GESGKSTI+KQM+I+HVNGF+  EK + I +I++NV+DAI+ IV +M+ +        P+    S+ IK +  A    + Y   FFD V +LW DE V+A F RSNEYQLID A+YFL+ I  +   DY P+ QD+LRCR +TSGI E  F+V +   +       DVGGQ+ ER++WIQ F +VTAI+++A CSS++  +RED + NRL +SL++F   W NR+L+ + II+F+NK DML  K+   +  IE    E  N T
Sbjct:   19 KERREANKKIEKQLQKERLAYKATHRLLLLGAGESGKSTIVKQMRILHVNGFNPEEKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKSI--APITDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMF-----DVGGQRDERRKWIQCFNDVTAIIYVAACSSYNMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFPEYANYT 306          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Human
Match: GNAL (G protein subunit alpha L [Source:HGNC Symbol;Acc:HGNC:4388])

HSP 1 Score: 211.846 bits (538), Expect = 2.908e-62
Identity = 134/295 (45.42%), Postives = 189/295 (64.07%), Query Frame = 1
Query:  190 EENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKL-----QITPKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            +E R  N +IEK+L   +    +  +LLLLG GESGKSTI+KQM+I+HVNGF+  EK + I +I++NV+DAI+ IV +M+ +        P+    S+ IK +  A    + Y   FFD V +LW DE V+A F RSNEYQLID A+YFL+ I  +   DY P+ QD+LRCR +TSGI E  F+V +   +       DVGGQ+ ER++WIQ F +VTAI+++A CSS++  +RED + NRL +SL++F   W NR+L+ + II+F+NK DML  K+   +  IE    E  N T
Sbjct:   19 KERREANKKIEKQLQKERLAYKATHRLLLLGAGESGKSTIVKQMRILHVNGFNPEEKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKSI--APITDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMF-----DVGGQRDERRKWIQCFNDVTAIIYVAACSSYNMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFPEYANYT 306          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Human
Match: GNAL (G protein subunit alpha L [Source:HGNC Symbol;Acc:HGNC:4388])

HSP 1 Score: 211.846 bits (538), Expect = 2.908e-62
Identity = 134/295 (45.42%), Postives = 189/295 (64.07%), Query Frame = 1
Query:  190 EENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKL-----QITPKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            +E R  N +IEK+L   +    +  +LLLLG GESGKSTI+KQM+I+HVNGF+  EK + I +I++NV+DAI+ IV +M+ +        P+    S+ IK +  A    + Y   FFD V +LW DE V+A F RSNEYQLID A+YFL+ I  +   DY P+ QD+LRCR +TSGI E  F+V +   +       DVGGQ+ ER++WIQ F +VTAI+++A CSS++  +RED + NRL +SL++F   W NR+L+ + II+F+NK DML  K+   +  IE    E  N T
Sbjct:   19 KERREANKKIEKQLQKERLAYKATHRLLLLGAGESGKSTIVKQMRILHVNGFNPEEKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKSI--APITDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMF-----DVGGQRDERRKWIQCFNDVTAIIYVAACSSYNMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFPEYANYT 306          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Human
Match: GNAS (GNAS complex locus [Source:HGNC Symbol;Acc:HGNC:4392])

HSP 1 Score: 210.69 bits (535), Expect = 9.347e-62
Identity = 133/311 (42.77%), Postives = 199/311 (63.99%), Query Frame = 1
Query:  139 CISKVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSE---KIKFLQTAFS-EQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            C+   +T++QR +    +  R  N +IEK+L   K    +  +LLLLG GESGKSTI+KQM+I+HVNGF+  EK   + +IK N+++AI  IV +M+ L + P +    E   ++ ++ +  +   + +P  F++    LW+DE V+A + RSNEYQLID A+YFLD I +I+Q DY+PS QD+LRCR +TSGI E  F+V +     VNF +FDVGGQ+ ER++WIQ F +VTAI+F+   SS++  +RED   NRL ++L +F   W NR+L+ + +I+F+NK D+L  K+   +  IE    E    T
Sbjct:    3 CLGNSKTEDQRNEE---KAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGDEKATKVQDIKNNLKEAIETIVAAMSNL-VPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDK-----VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYT 304          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Human
Match: GNAS (GNAS complex locus [Source:HGNC Symbol;Acc:HGNC:4392])

HSP 1 Score: 207.608 bits (527), Expect = 1.506e-60
Identity = 133/312 (42.63%), Postives = 199/312 (63.78%), Query Frame = 1
Query:  139 CISKVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGF-SKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSE---KIKFLQTAFS-EQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            C+   +T++QR +    +  R  N +IEK+L   K    +  +LLLLG GESGKSTI+KQM+I+HVNGF   +EK   + +IK N+++AI  IV +M+ L + P +    E   ++ ++ +  +   + +P  F++    LW+DE V+A + RSNEYQLID A+YFLD I +I+Q DY+PS QD+LRCR +TSGI E  F+V +     VNF +FDVGGQ+ ER++WIQ F +VTAI+F+   SS++  +RED   NRL ++L +F   W NR+L+ + +I+F+NK D+L  K+   +  IE    E    T
Sbjct:    3 CLGNSKTEDQRNEE---KAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNL-VPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDK-----VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYT 305          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Celegans
Match: gsa-1 (G protein, Subunit Alpha [Source:UniProtKB/TrEMBL;Acc:Q7KPV0])

HSP 1 Score: 214.927 bits (546), Expect = 7.196e-64
Identity = 139/294 (47.28%), Postives = 196/294 (66.67%), Query Frame = 1
Query:  193 ENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKFLQTAFSEQYT----------YPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQ-NEHSIESMINE 1041
            E R+ N QIE++LA  K    +  +LLLLG GESGKSTI+KQM+I+H+NGF++ EK E I++I+RNVRDA+  I+ +M+  +I PK   L +      TA S  Y           YP+ F+D +   W+D+ V A + RS+EYQLID A+YFLD + ++RQN+Y PS QDILRCR MT+GI E  FEV     +KV F +FDVGGQ+ ER++WIQ F +VTAI+F+   SS++  L ED ++NRL +SL +F   W NR+L+ + +I+F+NK D+L  KI+   + +ES   E
Sbjct:   17 EARKVNKQIEEQLAKDKQVMRATHRLLLLGAGESGKSTIVKQMRILHINGFNEAEKREKITDIRRNVRDAMQVILRAMD--EIVPK-VSLDDP----STAISRDYILRITNDPEDNYPSEFYDHILTCWKDKGVMACYERSSEYQLIDCAQYFLDKVDVVRQNNYDPSEQDILRCRVMTTGIFETKFEV-----DKVRFHMFDVGGQRDERRKWIQCFNDVTAIIFVCASSSYNLVLWEDNTQNRLRESLALFKNIWNNRWLKTISVILFLNKQDLLSEKIKAKRYLLESFFPE 298          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Celegans
Match: gsa-1 (G protein, Subunit Alpha [Source:UniProtKB/TrEMBL;Acc:Q7KPV0])

HSP 1 Score: 214.927 bits (546), Expect = 7.196e-64
Identity = 139/294 (47.28%), Postives = 196/294 (66.67%), Query Frame = 1
Query:  193 ENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKFLQTAFSEQYT----------YPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQ-NEHSIESMINE 1041
            E R+ N QIE++LA  K    +  +LLLLG GESGKSTI+KQM+I+H+NGF++ EK E I++I+RNVRDA+  I+ +M+  +I PK   L +      TA S  Y           YP+ F+D +   W+D+ V A + RS+EYQLID A+YFLD + ++RQN+Y PS QDILRCR MT+GI E  FEV     +KV F +FDVGGQ+ ER++WIQ F +VTAI+F+   SS++  L ED ++NRL +SL +F   W NR+L+ + +I+F+NK D+L  KI+   + +ES   E
Sbjct:   17 EARKVNKQIEEQLAKDKQVMRATHRLLLLGAGESGKSTIVKQMRILHINGFNEAEKREKITDIRRNVRDAMQVILRAMD--EIVPK-VSLDDP----STAISRDYILRITNDPEDNYPSEFYDHILTCWKDKGVMACYERSSEYQLIDCAQYFLDKVDVVRQNNYDPSEQDILRCRVMTTGIFETKFEV-----DKVRFHMFDVGGQRDERRKWIQCFNDVTAIIFVCASSSYNLVLWEDNTQNRLRESLALFKNIWNNRWLKTISVILFLNKQDLLSEKIKAKRYLLESFFPE 298          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Celegans
Match: gsa-1 (G protein, Subunit Alpha [Source:UniProtKB/TrEMBL;Acc:Q7KPV0])

HSP 1 Score: 166.007 bits (419), Expect = 1.449e-46
Identity = 87/179 (48.60%), Postives = 125/179 (69.83%), Query Frame = 1
Query:  511 YPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNE-HSIESMINEI 1044
            YP+ F+D +   W+D+ V A + RS+EYQLID A+YFLD + ++RQN+Y PS QDILRCR MT+GI E  FEV +     V F +FDVGGQ+ ER++WIQ F +VTAI+F+   SS++  L ED ++NRL +SL +F   W NR+L+ + +I+F+NK D+L  KI+ + + +ES   E 
Sbjct:   33 YPSEFYDHILTCWKDKGVMACYERSSEYQLIDCAQYFLDKVDVVRQNNYDPSEQDILRCRVMTTGIFETKFEVDK-----VRFHMFDVGGQRDERRKWIQCFNDVTAIIFVCASSSYNLVLWEDNTQNRLRESLALFKNIWNNRWLKTISVILFLNKQDLLSEKIKAKRYLLESFFPEF 206          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Celegans
Match: goa-1 (Guanine nucleotide-binding protein G(o) subunit alpha [Source:UniProtKB/Swiss-Prot;Acc:P51875])

HSP 1 Score: 158.303 bits (399), Expect = 4.687e-43
Identity = 114/283 (40.28%), Postives = 165/283 (58.30%), Query Frame = 1
Query:  169 REKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKFLQTAFS---EQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQ 1008
            +E+R  LE +R     IEK L     +    +KLLLLG GESGKSTI+KQMKIIH +GF+  +  ++   +  N   +++AI+ +M+ L ++    D     K +    +   +   +       +  LW D  VQ  F RSNEYQL DSAKYFLD +  + +  Y P+ QDILR R  T+GI E+ F  +      +NFK+FDVGGQ+ ERK+WI  F +VTAI+F    S +DQ L ED + NR+ +SL++F     N++  +  II+F+NK D+ E KI+
Sbjct:    7 QEERAALERSR----MIEKNLKEDGMQAAKDIKLLLLGAGESGKSTIVKQMKIIHESGFTAEDYKQYKPVVYSNTVQSLVAILRAMSNLGVSFGSADREVDAKLVMDVVARMEDTEPFSEELLSSMKRLWGDAGVQDCFSRSNEYQLNDSAKYFLDDLERLGEAIYQPTEQDILRTRVKTTGIVEVHFTFK-----NLNFKLFDVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDLFEEKIK 280          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Celegans
Match: gpa-1 (Guanine nucleotide-binding protein alpha-1 subunit [Source:UniProtKB/Swiss-Prot;Acc:P28051])

HSP 1 Score: 154.451 bits (389), Expect = 1.067e-41
Identity = 94/247 (38.06%), Postives = 147/247 (59.51%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVR-----DAIMAIVVSMNKLQITPKKFDLSEKI-----KFLQTAFSEQYTYP---NTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI 1005
            T+LKQMKIIH +GFS+ E    ISN KRNV       A+ A++  M +LQ     FD S ++     K ++   +++  Y    +  F+ ++ELW D+ VQ ++ +   + L DSAKYF D I  +   +Y+P+  DIL  R  T G+ E++F ++        F+VFDVGGQ+ +RK+WI  F +  A++++A  S +DQ L ED + NR+ +S+++F Q   N+Y  N  +I+F+NKID+ E KI
Sbjct:   48 TVLKQMKIIHNSGFSQEE----ISN-KRNVVCANTVQAMGALLDGMKQLQ-----FDFSTRVCNAHEKLIRETLNDKAEYGPFSDAMFNALTELWADKGVQCAYDKREFFYLHDSAKYFFDAIARVHTPNYVPTENDILHTRVPTMGVIEVNFTIK-----GKFFRVFDVGGQRSQRKKWIHCFDDAKAMIYVASLSEYDQVLLEDNTTNRMHESIQLFKQVINNKYFVNTSVILFLNKIDLFEEKI 279          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Fly
Match: Galphas (gene:FBgn0001123 transcript:FBtr0072142)

HSP 1 Score: 207.223 bits (526), Expect = 8.892e-61
Identity = 126/277 (45.49%), Postives = 189/277 (68.23%), Query Frame = 1
Query:  199 RRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQ--ITPKKFDLSEKIKFLQT-AFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHS 1020
            +R+++ I ++L   K    +  +LLLLG GESGKSTI+KQM+I+HV+GFS +EK + I +IK+N+RDAI+ I  +M+ L   +  +K +   +++++Q  A S  + YP  F++   ELW+D+ V  ++ RSNEYQLID AKYFLD +  I+  +Y P+ QDILRCR +TSGI E  F+V +   +       DVGGQ+ ER++WIQ F +VTAI+F+  CSS++  LRED ++NRL +SL++F   W NR+L+ + II+F+NK D+L  KI+   S
Sbjct:   23 KRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRILHVDGFSDSEKKQKIDDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQDYASSPDFNYPPEFYEHTEELWKDKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTSGIFETRFQVDKVNFHMF-----DVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESLDLFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKS 294          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Fly
Match: Galphas (gene:FBgn0001123 transcript:FBtr0343279)

HSP 1 Score: 207.223 bits (526), Expect = 8.892e-61
Identity = 126/277 (45.49%), Postives = 189/277 (68.23%), Query Frame = 1
Query:  199 RRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQ--ITPKKFDLSEKIKFLQT-AFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHS 1020
            +R+++ I ++L   K    +  +LLLLG GESGKSTI+KQM+I+HV+GFS +EK + I +IK+N+RDAI+ I  +M+ L   +  +K +   +++++Q  A S  + YP  F++   ELW+D+ V  ++ RSNEYQLID AKYFLD +  I+  +Y P+ QDILRCR +TSGI E  F+V +   +       DVGGQ+ ER++WIQ F +VTAI+F+  CSS++  LRED ++NRL +SL++F   W NR+L+ + II+F+NK D+L  KI+   S
Sbjct:   23 KRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRILHVDGFSDSEKKQKIDDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQDYASSPDFNYPPEFYEHTEELWKDKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTSGIFETRFQVDKVNFHMF-----DVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESLDLFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKS 294          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Fly
Match: Galphas (gene:FBgn0001123 transcript:FBtr0072144)

HSP 1 Score: 207.223 bits (526), Expect = 8.892e-61
Identity = 126/277 (45.49%), Postives = 189/277 (68.23%), Query Frame = 1
Query:  199 RRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQ--ITPKKFDLSEKIKFLQT-AFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHS 1020
            +R+++ I ++L   K    +  +LLLLG GESGKSTI+KQM+I+HV+GFS +EK + I +IK+N+RDAI+ I  +M+ L   +  +K +   +++++Q  A S  + YP  F++   ELW+D+ V  ++ RSNEYQLID AKYFLD +  I+  +Y P+ QDILRCR +TSGI E  F+V +   +       DVGGQ+ ER++WIQ F +VTAI+F+  CSS++  LRED ++NRL +SL++F   W NR+L+ + II+F+NK D+L  KI+   S
Sbjct:   23 KRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRILHVDGFSDSEKKQKIDDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQDYASSPDFNYPPEFYEHTEELWKDKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTSGIFETRFQVDKVNFHMF-----DVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESLDLFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKS 294          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Fly
Match: Galphas (gene:FBgn0001123 transcript:FBtr0301411)

HSP 1 Score: 207.223 bits (526), Expect = 1.057e-60
Identity = 126/277 (45.49%), Postives = 189/277 (68.23%), Query Frame = 1
Query:  199 RRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQ--ITPKKFDLSEKIKFLQT-AFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHS 1020
            +R+++ I ++L   K    +  +LLLLG GESGKSTI+KQM+I+HV+GFS +EK + I +IK+N+RDAI+ I  +M+ L   +  +K +   +++++Q  A S  + YP  F++   ELW+D+ V  ++ RSNEYQLID AKYFLD +  I+  +Y P+ QDILRCR +TSGI E  F+V +   +       DVGGQ+ ER++WIQ F +VTAI+F+  CSS++  LRED ++NRL +SL++F   W NR+L+ + II+F+NK D+L  KI+   S
Sbjct:   23 KRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRILHVDGFSDSEKKQKIDDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQDYASSPDFNYPPEFYEHTEELWKDKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTSGIFETRFQVDKVNFHMF-----DVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESLDLFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKS 294          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Fly
Match: Galphas (gene:FBgn0001123 transcript:FBtr0072143)

HSP 1 Score: 207.223 bits (526), Expect = 1.057e-60
Identity = 126/277 (45.49%), Postives = 189/277 (68.23%), Query Frame = 1
Query:  199 RRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQ--ITPKKFDLSEKIKFLQT-AFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHS 1020
            +R+++ I ++L   K    +  +LLLLG GESGKSTI+KQM+I+HV+GFS +EK + I +IK+N+RDAI+ I  +M+ L   +  +K +   +++++Q  A S  + YP  F++   ELW+D+ V  ++ RSNEYQLID AKYFLD +  I+  +Y P+ QDILRCR +TSGI E  F+V +   +       DVGGQ+ ER++WIQ F +VTAI+F+  CSS++  LRED ++NRL +SL++F   W NR+L+ + II+F+NK D+L  KI+   S
Sbjct:   23 KRRSDAISRQLQKDKQLYRATHRLLLLGAGESGKSTIVKQMRILHVDGFSDSEKKQKIDDIKKNIRDAILTITGAMSTLNPPVALEKKENEPRVEYIQDYASSPDFNYPPEFYEHTEELWKDKGVLQTYERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTSGIFETRFQVDKVNFHMF-----DVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESLDLFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKS 294          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Zebrafish
Match: gnal (guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type [Source:ZFIN;Acc:ZDB-GENE-041114-26])

HSP 1 Score: 219.935 bits (559), Expect = 4.762e-66
Identity = 146/334 (43.71%), Postives = 208/334 (62.28%), Query Frame = 1
Query:  139 CISKVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQ-----ITPKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEIT--NLTPHSTKNSAKQLNNRRSSLNI 1116
            C+   +T++QR   +  +  R  N +IEK+L   +    +  +LLLLG GESGKSTI+KQM+I+HVNGF+  EK + I +I++NV+DAI+ I+ +M+ L        P     +E IK +  A    + Y   FF+    LW DE V+A F RSNEYQLID A+YFL+ I  +RQNDY P+ QD+LRCR +TSGI E  F+V     +KVNF +FDVGGQ+ ER++WIQ F +VTAI+F+A  SS++  +RED S NRL +SL++F   W NR+L+ + +I+F+NK DML  KI   +  +E    E     L P +T +  +     R+   I
Sbjct:    3 CLGNSKTEDQR---IDEKAQREANKKIEKQLQKERQAYKATHRLLLLGAGESGKSTIVKQMRILHVNGFNAEEKKQKILDIRKNVKDAIVTIISAMSTLTPPVSIANPSNQPRAEYIKSI--APLSDFDYTEEFFEHAKHLWDDEGVKACFERSNEYQLIDCAQYFLERIESVRQNDYTPTDQDLLRCRVLTSGIFETRFQV-----DKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVAASSSYNMVIREDNSTNRLRESLDLFRSIWTNRFLRTISVILFLNKQDMLAEKILAGKSKLEDYFPEYARYTLPPEATPDPGEDPKVSRAKFFI 326          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Zebrafish
Match: gnal (guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type [Source:ZFIN;Acc:ZDB-GENE-041114-26])

HSP 1 Score: 220.32 bits (560), Expect = 1.381e-65
Identity = 146/334 (43.71%), Postives = 208/334 (62.28%), Query Frame = 1
Query:  139 CISKVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQ-----ITPKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEIT--NLTPHSTKNSAKQLNNRRSSLNI 1116
            C+   +T++QR   +  +  R  N +IEK+L   +    +  +LLLLG GESGKSTI+KQM+I+HVNGF+  EK + I +I++NV+DAI+ I+ +M+ L        P     +E IK +  A    + Y   FF+    LW DE V+A F RSNEYQLID A+YFL+ I  +RQNDY P+ QD+LRCR +TSGI E  F+V     +KVNF +FDVGGQ+ ER++WIQ F +VTAI+F+A  SS++  +RED S NRL +SL++F   W NR+L+ + +I+F+NK DML  KI   +  +E    E     L P +T +  +     R+   I
Sbjct:    3 CLGNSKTEDQR---IDEKAQREANKKIEKQLQKERQAYKATHRLLLLGAGESGKSTIVKQMRILHVNGFNAEEKKQKILDIRKNVKDAIVTIISAMSTLTPPVSIANPSNQPRAEYIKSI--APLSDFDYTEEFFEHAKHLWDDEGVKACFERSNEYQLIDCAQYFLERIESVRQNDYTPTDQDLLRCRVLTSGIFETRFQV-----DKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVAASSSYNMVIREDNSTNRLRESLDLFRSIWTNRFLRTISVILFLNKQDMLAEKILAGKSKLEDYFPEYARYTLPPEATPDPGEDPKVSRAKFFI 326          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Zebrafish
Match: gnas (GNAS complex locus [Source:ZFIN;Acc:ZDB-GENE-090417-2])

HSP 1 Score: 208.379 bits (529), Expect = 4.094e-61
Identity = 137/313 (43.77%), Postives = 196/313 (62.62%), Query Frame = 1
Query:  139 CISKVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMN------KLQITPKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            C+   +T++QR +    +  R  N +IEK+L   K    +  +LLLLG GESGKSTI+KQM+I+HVNGF+  EK + I +IK N+++AI  IV +M+      +L     KF +      L  A  + + +   F++    LWQDE V+A F RSNEYQLID A+YFLD I  ++Q+DY P+ QD+LRCR +TSGI E  F+V     +KVNF +FDVGGQ+ ER++WIQ F +VTAI+F+   SS++  LRED   NRL ++L +F   W NR+L+ + +I+F+NK D+L  K+   +  IE    E    T
Sbjct:    3 CLGNSKTEDQRNEE---KAQREANKKIEKQLQKDKQIYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNAEEKKQKIQDIKNNIKEAIETIVTAMSVLVPPVQLACPANKFRID---YILNLANQKDFEFTTEFYEHTKTLWQDEGVKACFERSNEYQLIDCAQYFLDRIDTVKQSDYTPTDQDLLRCRVLTSGIFETRFQV-----DKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVLREDNQTNRLQEALNLFKNIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYT 304          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Zebrafish
Match: gnat2 (guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-011128-10])

HSP 1 Score: 173.326 bits (438), Expect = 2.302e-48
Identity = 117/279 (41.94%), Postives = 175/279 (62.72%), Query Frame = 1
Query:  190 EENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQI---TPKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEH 1017
            +E  +K+ ++EK+L    +K+   +KLLLLG GESGKSTI+KQMKI+H  G++K E++EF S I  N+  + +AI+  M  L I   +P   + S+K++ L  +  E+ T P    DV+  LW+D  VQASF R+ EYQL DSA Y+L+ +  I + DY+P+ QD+LR R  T+GI E  F  +E     ++F++FDVGGQ+ ERK+WI  F  VT I+F    S++D  L ED   NR+ +SL +F     +R+     I++F+NK D+ + KI+  H
Sbjct:   10 KEMAKKSKELEKQLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKILHQGGYTKEEQMEFRSIIFGNILQSALAIIRGMEMLSINFGSPSAQEDSQKLQNLSDSI-EEGTMPPELADVIKRLWKDAGVQASFDRAAEYQLNDSAGYYLNEMDRICKPDYLPTEQDVLRSRVKTTGIIEEQFGCKE-----LHFRMFDVGGQRSERKKWIHCFEGVTCIIFCGALSAYDMVLVEDDEVNRMHESLHLFNSICNHRFFATTSIVLFLNKKDLFQEKIKKVH 282          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Zebrafish
Match: gna13a (guanine nucleotide binding protein (G protein), alpha 13a [Source:ZFIN;Acc:ZDB-GENE-030131-5024])

HSP 1 Score: 169.474 bits (428), Expect = 1.048e-46
Identity = 124/308 (40.26%), Postives = 169/308 (54.87%), Query Frame = 1
Query:  202 RKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQI------------TPKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHSIESMINEITNLTPHSTKNSAKQL 1089
            RK+ +I+K L+  K      +K+LLLG GESGKST LKQM+IIH   F +  K EF + I  NV   +  +V +  KL I            T   FD    +  +     E   + N F   +  LWQD  +Q ++ R  E+QL +S KYFLD++  + Q DY+PS +DIL  RK T GI E  FE++      V     DVGGQ+ ERKRW + F  VT+ILFL   S +DQ L EDR  NRL +SL +F     NR   NV II+F+NK D+LE K++  + I+   +E T   PH+ ++  K L
Sbjct:   28 RKSKEIDKSLSREKTYVKKLVKILLLGAGESGKSTFLKQMRIIHGQDFDQRAKEEFRATIYSNVIKGVRVLVDAREKLHIPWGNPENQAHGETVMAFDTRSSL--MAKGMMETKVFLN-FLPAIRALWQDSGIQNAYDRRREFQLGESVKYFLDNVDKLGQLDYLPSQKDILLARKPTKGIHEYEFEIKNVPFKMV-----DVGGQRSERKRWFECFDSVTSILFLVSSSEYDQVLMEDRQTNRLTESLNIFETIVNNRVFANVSIILFLNKTDLLEDKVKTVN-IKDYFSEFTG-EPHNLQDVQKFL 325          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Xenopus
Match: thap7 (THAP domain containing 7 [Source:Xenbase;Acc:XB-GENE-5916275])

HSP 1 Score: 171.4 bits (433), Expect = 1.703e-47
Identity = 97/241 (40.25%), Postives = 139/241 (57.68%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQIT---PKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEH 1017
            TI+KQMKIIH +G+S  E +EFIS I  N   +++AIV +MN L I    P + D S K+  L     E  + P    D++  LW+D  +QA F R++EYQL DSA Y+L+ +  +    Y+P+ QD+LR R  T+GI E  F  ++           DVGGQ+ ERK+WI  F  VT I+F+A  S++D  L ED   NR+ +SL +F     +RY     I++F+NK D+   KI+  H
Sbjct:   44 TIVKQMKIIHQDGYSLEECLEFISIIYGNTLQSMLAIVRAMNTLNIQYGDPARQDDSRKLLHLADTIDEG-SMPKEMSDIIGRLWKDTGIQACFDRASEYQLNDSAGYYLNDLERLVTPGYVPTEQDVLRSRVKTTGIIETQFGFKDLNFRMF-----DVGGQRSERKKWIHCFEGVTCIIFIAALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFATTSIVLFLNKKDVFTEKIKKAH 278          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Xenopus
Match: gnai2 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 2 [Source:NCBI gene;Acc:394861])

HSP 1 Score: 171.014 bits (432), Expect = 2.510e-47
Identity = 97/237 (40.93%), Postives = 145/237 (61.18%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQIT---PKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI 1005
            TI+KQMKIIH +G+S+ E  ++ + +  N   +IMAI+ +M  L+I    P + D + ++  L +   EQ   P+    V+  LW D  VQA F RS EYQL DSA Y+L+ +  I ++DY+P+ QD+LR R  T+GI E  F  ++     ++FK+FDVGGQ+ ERK+WI  F  VTAI+F    S++D  L ED   NR+ +S+++F     N++     II+F+NK D+ E KI
Sbjct:   48 TIVKQMKIIHEDGYSEEECRQYRAVVFSNTIQSIMAIIKAMGNLKIDFGDPARADDARQLFALSSTAEEQGILPDDLAGVIRRLWADPGVQACFSRSREYQLNDSAAYYLNDLERIARSDYVPTQQDVLRTRVKTTGIVETHFTFKD-----LHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKI 279          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Xenopus
Match: gnat2 (guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 [Source:NCBI gene;Acc:100216126])

HSP 1 Score: 168.318 bits (425), Expect = 2.736e-46
Identity = 112/278 (40.29%), Postives = 170/278 (61.15%), Query Frame = 1
Query:  190 EENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKFLQTAFS--EQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEH 1017
            +E  +++ ++EK+L          +KLLLLG GESGKSTI+KQMKIIH +G+S+ E IEF + I  N+  +I+AI+ +M+ L I       ++  + L       E+ T P    DV+ +LW+D+ VQA F R+ EYQL DSA Y+L+ +  I  ++YIP+ QD+LR R  T+GI E  F  ++     ++F++FDVGGQ+ ERK+WI  F  VT I+F    S++D  L ED   NR+ +SL +F     +++     I++F+NK D+ E KI+  H
Sbjct:   10 KELAKRSKELEKKLQEDAAMDAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSEQECIEFRAIIYGNILQSILAIIRAMSTLGIDYGDSSRADDGRILSHLADSIEEGTMPQELVDVIKKLWKDDGVQACFERAAEYQLNDSAAYYLNQLDRITASNYIPNEQDVLRSRVKTTGIIESQFSFKD-----LHFRMFDVGGQRSERKKWIHCFEGVTCIIFCGALSAYDMVLVEDEEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEQKIKKVH 282          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Xenopus
Match: gnai1 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 [Source:NCBI gene;Acc:100038283])

HSP 1 Score: 164.466 bits (415), Expect = 5.933e-45
Identity = 94/238 (39.50%), Postives = 138/238 (57.98%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQIT---PKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQ 1008
            TI+KQMKIIH  G+S+ E  ++ + +  N   +I+AI+ +M +L+I    P + D + ++  L  A  E +        V+  LW+D  VQA F RS EYQL DSA Y+L+ +  I QN YIP+ QD+LR R  T+GI E  F  ++           DVGGQ+ ERK+WI  F  VTAI+F    S +D  L ED   NR+ +S+++F     N++  +  II+F+NK D+ E KI+
Sbjct:   48 TIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDPSRADDARQLFVLAGAAEEGFMTAE-LAGVIKRLWKDGGVQACFNRSREYQLNDSAAYYLNDLDRIAQNSYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMF-----DVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIK 279          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Xenopus
Match: gnai1 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 [Source:NCBI gene;Acc:100038283])

HSP 1 Score: 164.851 bits (416), Expect = 1.387e-44
Identity = 94/238 (39.50%), Postives = 138/238 (57.98%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQIT---PKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQ 1008
            TI+KQMKIIH  G+S+ E  ++ + +  N   +I+AI+ +M +L+I    P + D + ++  L  A  E +        V+  LW+D  VQA F RS EYQL DSA Y+L+ +  I QN YIP+ QD+LR R  T+GI E  F  ++           DVGGQ+ ERK+WI  F  VTAI+F    S +D  L ED   NR+ +S+++F     N++  +  II+F+NK D+ E KI+
Sbjct:   91 TIVKQMKIIHEAGYSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDPSRADDARQLFVLAGAAEEGFMTAE-LAGVIKRLWKDGGVQACFNRSREYQLNDSAAYYLNDLDRIAQNSYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMF-----DVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIK 322          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Mouse
Match: Gnal (guanine nucleotide binding protein, alpha stimulating, olfactory type [Source:MGI Symbol;Acc:MGI:95774])

HSP 1 Score: 212.231 bits (539), Expect = 1.689e-62
Identity = 134/295 (45.42%), Postives = 189/295 (64.07%), Query Frame = 1
Query:  190 EENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKL-----QITPKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            +E R  N +IEK+L   +    +  +LLLLG GESGKSTI+KQM+I+HVNGF+  EK + I +I++NV+DAI+ IV +M+ +        P+    S+ IK +  A    + Y   FFD V +LW DE V+A F RSNEYQLID A+YFL+ I  +   DY P+ QD+LRCR +TSGI E  F+V +   +       DVGGQ+ ER++WIQ F +VTAI+++A CSS++  +RED + NRL +SL++F   W NR+L+ + II+F+NK DML  K+   +  IE    E  N T
Sbjct:   19 KERREANKKIEKQLQKERLAYKATHRLLLLGAGESGKSTIVKQMRILHVNGFNPEEKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKSI--APITDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMF-----DVGGQRDERRKWIQCFNDVTAIIYVAACSSYNMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFPEYANYT 306          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Mouse
Match: Gnal (guanine nucleotide binding protein, alpha stimulating, olfactory type [Source:MGI Symbol;Acc:MGI:95774])

HSP 1 Score: 212.231 bits (539), Expect = 1.689e-62
Identity = 134/295 (45.42%), Postives = 189/295 (64.07%), Query Frame = 1
Query:  190 EENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKL-----QITPKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            +E R  N +IEK+L   +    +  +LLLLG GESGKSTI+KQM+I+HVNGF+  EK + I +I++NV+DAI+ IV +M+ +        P+    S+ IK +  A    + Y   FFD V +LW DE V+A F RSNEYQLID A+YFL+ I  +   DY P+ QD+LRCR +TSGI E  F+V +   +       DVGGQ+ ER++WIQ F +VTAI+++A CSS++  +RED + NRL +SL++F   W NR+L+ + II+F+NK DML  K+   +  IE    E  N T
Sbjct:   19 KERREANKKIEKQLQKERLAYKATHRLLLLGAGESGKSTIVKQMRILHVNGFNPEEKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKSI--APITDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMF-----DVGGQRDERRKWIQCFNDVTAIIYVAACSSYNMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFPEYANYT 306          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Mouse
Match: Gnas (GNAS (guanine nucleotide binding protein, alpha stimulating) complex locus [Source:MGI Symbol;Acc:MGI:95777])

HSP 1 Score: 210.69 bits (535), Expect = 5.603e-62
Identity = 133/311 (42.77%), Postives = 199/311 (63.99%), Query Frame = 1
Query:  139 CISKVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSE---KIKFLQTAFS-EQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            C+   +T++QR +    +  R  N +IEK+L   K    +  +LLLLG GESGKSTI+KQM+I+HVNGF+  EK   + +IK N+++AI  IV +M+ L + P +    E   ++ ++ +  +   + +P  F++    LW+DE V+A + RSNEYQLID A+YFLD I +I+Q DY+PS QD+LRCR +TSGI E  F+V +     VNF +FDVGGQ+ ER++WIQ F +VTAI+F+   SS++  +RED   NRL ++L +F   W NR+L+ + +I+F+NK D+L  K+   +  IE    E    T
Sbjct:    3 CLGNSKTEDQRNEE---KAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGDEKATKVQDIKNNLKEAIETIVAAMSNL-VPPVELANPENQFRVDYILSVMNVPNFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDK-----VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYT 304          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Mouse
Match: Gnas (GNAS (guanine nucleotide binding protein, alpha stimulating) complex locus [Source:MGI Symbol;Acc:MGI:95777])

HSP 1 Score: 207.223 bits (526), Expect = 1.078e-60
Identity = 133/312 (42.63%), Postives = 199/312 (63.78%), Query Frame = 1
Query:  139 CISKVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGF-SKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSE---KIKFLQTAFS-EQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            C+   +T++QR +    +  R  N +IEK+L   K    +  +LLLLG GESGKSTI+KQM+I+HVNGF   +EK   + +IK N+++AI  IV +M+ L + P +    E   ++ ++ +  +   + +P  F++    LW+DE V+A + RSNEYQLID A+YFLD I +I+Q DY+PS QD+LRCR +TSGI E  F+V +     VNF +FDVGGQ+ ER++WIQ F +VTAI+F+   SS++  +RED   NRL ++L +F   W NR+L+ + +I+F+NK D+L  K+   +  IE    E    T
Sbjct:    3 CLGNSKTEDQRNEE---KAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNL-VPPVELANPENQFRVDYILSVMNVPNFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDK-----VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYT 305          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Mouse
Match: Gnal (guanine nucleotide binding protein, alpha stimulating, olfactory type [Source:MGI Symbol;Acc:MGI:95774])

HSP 1 Score: 207.223 bits (526), Expect = 6.806e-60
Identity = 115/256 (44.92%), Postives = 166/256 (64.84%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSE---KIKFLQT-AFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            TI+KQM+I+HVNGF+  EK + I +I++NV+DAI+ IV +M+ + I P      E   +  ++++ A    + Y   FFD V +LW DE V+A F RSNEYQLID A+YFL+ I  +   DY P+ QD+LRCR +TSGI E  F+V +   +       DVGGQ+ ER++WIQ F +VTAI+++A CSS++  +RED + NRL +SL++F   W NR+L+ + II+F+NK DML  K+   +  IE    E  N T
Sbjct:  124 TIVKQMRILHVNGFNPEEKKQKILDIRKNVKDAIVTIVSAMSTI-IPPVPLANPENQFRSDYIKSIAPITDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMF-----DVGGQRDERRKWIQCFNDVTAIIYVAACSSYNMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFPEYANYT 373          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. UniProt/SwissProt
Match: sp|P30684|GNAS_LYMST (Guanine nucleotide-binding protein G(s) subunit alpha OS=Lymnaea stagnalis OX=6523 PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 6.749e-69
Identity = 143/298 (47.99%), Postives = 200/298 (67.11%), Query Frame = 1
Query:  139 CISKVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSE---KIKFLQTAFSE-QYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHS 1020
            C  +   DE  + R      +  N +IEK+LA  K       +LLLLG GESGKSTI+KQM+I+HVNGFS  E+ + I +IKRNVRDAI+ I  +M+ L   P + +  +   K+ ++Q   S+ ++ YP  F++    LW+D+ VQA+F RSNEYQLID A+YFLD +HIIRQ +Y PS QDILRCR +TSGI E  F V     +KVNF +FDVGGQ+ ER++WIQ F +VTAI+F+  CS ++  LRED ++NRL +SL++F   W NR+L+ + +I+F+NK D+L  K++   S
Sbjct:    3 CFRQTRDDEDDKLR------KEANKKIEKQLAKDKLLYRGTHRLLLLGAGESGKSTIVKQMRILHVNGFSPEERKQKIEDIKRNVRDAILTITGAMSTLN-PPVQLEHPQNKAKVDYIQDKASQAEFDYPPIFYEYTEILWKDKGVQAAFERSNEYQLIDCAQYFLDRVHIIRQAEYTPSEQDILRCRVLTSGIFETKFSV-----DKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSGYNMVLREDATQNRLKESLDLFKSIWNNRWLRTISVILFLNKQDLLAEKVKAGKS 288          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. UniProt/SwissProt
Match: sp|P30669|GNAS_SCHMA (Guanine nucleotide-binding protein G(s) subunit alpha OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 9.950e-66
Identity = 116/238 (48.74%), Postives = 161/238 (67.65%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKF----LQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI 1005
            TI+KQM+I+H++GFS+ EK E I  I++N+RDAI +I  +M  L+  P K +LSE  K     L+TA    + YP  FF   ++LW+D  +Q +F RSNEYQLID AKYFLD    +   +YIPS QDILRCR +TSGI E  F V +   +       DVGGQ+ ER++WIQ F +VTAI+F+A CSS++  LRED S+NR+ +SLE+    W NR+L+N+ +I+F+NK D+L  K+
Sbjct:   54 TIVKQMRILHIDGFSEREKKEKIDAIRKNLRDAICSIAGAMGSLK-PPVKLELSENRKLRDYILETASKPDFDYPPEFFTYCAKLWKDGGIQETFERSNEYQLIDCAKYFLDKALEVGAPNYIPSEQDILRCRVLTSGIFETKFSVDKVNFHMF-----DVGGQREERRKWIQCFNDVTAIIFVAACSSYNMVLREDPSQNRVKESLELLASIWNNRWLRNISVILFLNKQDLLTEKV 285          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. UniProt/SwissProt
Match: sp|Q7PD79|GNAS_ANOGA (Guanine nucleotide-binding protein G(s) subunit alpha OS=Anopheles gambiae OX=7165 GN=G-s-alpha-60A PE=2 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.733e-64
Identity = 117/242 (48.35%), Postives = 170/242 (70.25%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQ--ITPKKFDLSEKIKFLQT-AFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHS 1020
            TI+KQM+I+HVNGFS +E+ + I +IK+N+RDAI+ I  +M+ L   I  +K +   ++ ++Q  A    + YP  F++   ELW+D  VQ ++ RSNEYQLID AKYFLD +  I+Q +Y P+ QDILRCR +TSGI E  F+V     +KVNF +FDVGGQ+ ER++WIQ F +VTAI+F+  CSS++  LRED ++NRL +SL++F   W NR+L+ + +I+F+NK D+L  KI+   S
Sbjct:   59 TIVKQMRILHVNGFSDSERKQKIEDIKKNIRDAILTITGAMSTLTPPIQLEKPENQARVDYIQDYASGPDFNYPPEFYEHTEELWKDRGVQQTYERSNEYQLIDCAKYFLDRVSEIKQPNYTPTEQDILRCRVLTSGIFETRFQV-----DKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPTQNRLRESLDLFKSIWNNRWLRTISVILFLNKQDLLAEKIKAGKS 295          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. UniProt/SwissProt
Match: sp|O16118|GNAS_HOMAM (Guanine nucleotide-binding protein G(s) subunit alpha OS=Homarus americanus OX=6706 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 2.650e-64
Identity = 118/242 (48.76%), Postives = 169/242 (69.83%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQ--ITPKKFDLSEKIKFLQTAFSEQ-YTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHS 1020
            TI+KQM+I+HV+GFS+ EK E I  I+ N+RDAI+ I  +M+ L   I  +      ++ ++Q   S++ + YP  F++    LW+D+ VQA + R+NEYQLID AKYFLD +HI+RQ DY P+ QDILRCR +T GI E  F+V     +KVNF +FDVGGQ+ ER++WIQ F +VTAI+F+  CSS++  LRED S+NRL +SL++F   W NR+L+ + +I+F+NK D+L  KI+   S
Sbjct:   55 TIVKQMRILHVDGFSEEEKREKIHAIRCNIRDAILTITGNMSTLTPPIALENPAHQFRVDYIQDVASQKDFDYPEEFYEHTEMLWKDKGVQACYERANEYQLIDCAKYFLDRVHIVRQTDYTPTEQDILRCRVLTLGIFETRFQV-----DKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPSQNRLRESLDLFKSIWNNRWLRTISVILFLNKQDLLAEKIRAGKS 291          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. UniProt/SwissProt
Match: sp|Q8CGK7|GNAL_MOUSE (Guanine nucleotide-binding protein G(olf) subunit alpha OS=Mus musculus OX=10090 GN=Gnal PE=1 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 1.182e-61
Identity = 134/295 (45.42%), Postives = 189/295 (64.07%), Query Frame = 1
Query:  190 EENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKL-----QITPKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            +E R  N +IEK+L   +    +  +LLLLG GESGKSTI+KQM+I+HVNGF+  EK + I +I++NV+DAI+ IV +M+ +        P+    S+ IK +  A    + Y   FFD V +LW DE V+A F RSNEYQLID A+YFL+ I  +   DY P+ QD+LRCR +TSGI E  F+V +   +       DVGGQ+ ER++WIQ F +VTAI+++A CSS++  +RED + NRL +SL++F   W NR+L+ + II+F+NK DML  K+   +  IE    E  N T
Sbjct:   19 KERREANKKIEKQLQKERLAYKATHRLLLLGAGESGKSTIVKQMRILHVNGFNPEEKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKSI--APITDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPTDQDLLRCRVLTSGIFETRFQVDKVNFHMF-----DVGGQRDERRKWIQCFNDVTAIIYVAACSSYNMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFPEYANYT 306          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. TrEMBL
Match: A0A1I8HTH1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010273g1 PE=4 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 7.771e-99
Identity = 189/493 (38.34%), Postives = 280/493 (56.80%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKFLQTAFSEQ------------YTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLRE----DRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHSIESMINEITNLTPHSTKNSAKQLNNRRSSLNINHKTNNDNMTSCSKCENSHPITDNNKCIHLCPESNSNSKICDRKISIRTIPSCSSRRFSKDNNFEFVAQTFSENPWGKYQPSNEECKEFVNSFP-VDQVD--LHSSGTHAA-------------KKKSKDVHNIHPDTIKTACYIKNIFAQITRNHPKNCDMKIS-NRRKCLFYYTCAVNTDNIQKVLDGCRSFLMEQHLERFGIL 1683
            TI KQM+IIH+NGFS  E+ E ++ ++RN+RD+I  I+ +M+KL I     + +    ++    +E             + Y   FFD V +LWQD+ VQ SF +S+ YQLID AKYFLD +H+ R   Y+P+ QDILRCR MT+ I++I F++++   + V F+VFDVGGQ+GERK+WIQ F  VTAIL+L D SSFD TL+E    DR KNRL++SL+ F + W+NRYLQ+V I++F+NKID LE K++   S+ SMI        +  +    +         I        M   S     HP                 +      + +R                +FV Q      + +++P+  + KEF+ SFP +D+++  + ++GT  A             ++K+ DV  +HP+T+KTACY+KN+F +I     +  D K   +   C  YYTCAVNTDN++KVL+GCR+F++++HLERFGIL
Sbjct:   50 TIRKQMQIIHINGFSSREREEKLAYMRRNIRDSIACIIAAMDKLGIAYTSEEAASLGAWVLRLMAENHVHNSVQADQDPFDYSQEFFDAVEKLWQDKGVQESFSQSSRYQLIDCAKYFLDRVHLFRDKSYMPTDQDILRCRIMTNDISDIQFDIKD-GHHSVKFRVFDVGGQKGERKKWIQCFNNVTAILYLCDVSSFDLTLKEDIDSDRPKNRLLESLDTFQEVWLNRYLQDVSILLFINKIDQLEEKVRAGKSLRSMIK-------YCQQGLQLEQQELEEQQQIGDGLTGQAMNGVSLSSRHHPGGGVVGLGGGGGGGKKKNV---GPLDLR----------------QFVCQF----DFDQFEPTENDKKEFLQSFPRLDELEEGITTAGTQEAARSNGQASGGGKRRRKTSDVPVVHPETVKTACYVKNVFMKIA-ERKRQSDFKYEYHHHTCCCYYTCAVNTDNVKKVLEGCRTFIIDKHLERFGIL 510          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. TrEMBL
Match: A0A4Z2CUN1 (Guanine nucleotide-binding protein G(S) subunit alpha isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_007363 PE=4 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 1.759e-98
Identity = 197/532 (37.03%), Postives = 291/532 (54.70%), Query Frame = 1
Query:  319 MKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIK-FLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHSIESM--------------------------------------INEITNLTPHSTKNSAKQLNNRRSSLNINHKTNNDNM--TSCSKCENSHPITDN--------NKCIHLCPESNSNSKI--CDRKISIRTIP--SCSSRRFSKDNNFEFVAQTFSENPWGKYQPSNEECKEF-----------------VNSFPVDQVDL----HSSGTHAAKKKSKDVHNI---HPDTIKTACYIKNIFAQITRNHPKNCDMKISNRRKCLFYYTCAVNTDNIQKVLDGCRSFLMEQHLERFGIL 1683
            MKIIH+NGFS  EK+++I  IK+N+RD I++I+  M  LQ+   +   ++ +K  ++ + ++ YTYP TFFD V E+W D  VQ ++ R+NE+QL DSA YF+    +IR+ DYIP+ QDILRCRKMT  ITE+ F++   +K+ V+F++ DV GQ+G RK+WIQ F  VTAIL+L DCSSFDQTL ED  +NRLIDSLEVF QAW N+YL+ VP+IVF+NKID+LE KI N H  +++                                      I+ I+    H    +  Q  N  SS ++     N     T      N HP+ ++        NK        +S+ ++  C    ++ +IP    SS   S+ +    +A+  ++ P+  ++P+ ++  EF                 VNS     ++L    H+       K+    H     HP+TI+TACYIK++F ++T    K         R CLFYYTCAVNT+ +  +L GC+ FL++ HLER+G++
Sbjct:    1 MKIIHINGFSTKEKLDYIPIIKQNIRDVILSILGGMKTLQLDFIQSRTADVVKSLIEKSLADNYTYPETFFDEVYEIWSDPGVQRAYTRANEFQLFDSATYFMRRFDVIRKPDYIPTDQDILRCRKMTDSITELQFDIPTGRKSSVHFRIIDVSGQRGARKKWIQFFDNVTAILYLVDCSSFDQTLIEDHRQNRLIDSLEVFEQAWSNKYLRKVPMIVFLNKIDLLEEKICNGHRADNLHKLAETWLQSAKSSRYKSLNVNLSKKISSSQKSTSSQKIDSISPNEKHILLTNPLQCTNSLSSASVEFNQINRKFSHTLGDTSINEHPLNNDKWTDQTQINKRFSSVYSLHSSIRLNQCSEYCTVLSIPCKPASSGMSSRVSCTTVIARLIADLPYRDFKPTAQQRTEFLTCLLPTTKSFKHYHDNVNSHRKKCINLDKYIHADDDGEMTKQFNQQHKFIVTHPETIRTACYIKHLFEELT----KRTTTAYYKNRTCLFYYTCAVNTNTMNHILQGCQRFLIQDHLERYGLI 528          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. TrEMBL
Match: A0A267FWY5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023675g2 PE=4 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 2.566e-96
Identity = 182/493 (36.92%), Postives = 274/493 (55.58%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKFLQTAFSEQ------------YTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLRED----RSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHSIESMINEITNLTPHSTKNSAKQLNNRRSSLNINHKTNNDNMTSCSKCENSHPITDNNKCIHLCPESNSNSKICDRKISIRTIPSCSSRRFSKDNNFEFVAQTFSENPWGKYQPSNEECKEFVNSFP-VDQVD--LHSSGTHAA-------------KKKSKDVHNIHPDTIKTACYIKNIFAQITRNHPKNCDMKIS-NRRKCLFYYTCAVNTDNIQKVLDGCRSFLMEQHLERFGIL 1683
            TI KQM+IIH+NGFS  E+ E ++ ++RN+RD+I  I+ +M+KL I     + +    ++    +E             + Y   FFD V +LWQD+ VQ SF +S+ YQLID AKYFLD +H+ R   Y+P+ QDILRCR MT+ I++I F++++   +       DVGGQ+GERK+WIQ F  VTAIL+L D SSFD TL+ED    R KNRL++SL+ F + W+NRYLQ+V I++F+NKID LE K++   S       + ++  +  +    +         I        M   S     HP               S           + +     R+F    +F+            +++P+  + KEF+ SFP +D+++  + ++GT  A             ++K+ DV  +HP+T+KTACY+KN+F +I     +  D K   +   C  YYTCAVNTDN++KVL+GCR+F++++HLERFGIL
Sbjct:   50 TIRKQMQIIHINGFSSREREEKLAYMRRNIRDSIACIIAAMDKLDIAYTSEEAASLGAWVLRLMAENHVHNSVQADQDPFDYSQEFFDAVEKLWQDKGVQESFSQSSRYQLIDCAKYFLDRVHLFRDKSYMPTDQDILRCRIMTNDISDIQFDIKDGHHSVKFRVF-DVGGQKGERKKWIQCFNNVTAILYLCDVSSFDLTLKEDIDSDRPKNRLLESLDTFQEVWLNRYLQDVSILLFINKIDQLEEKVRAGKS-------LRSMIKYCQQGLQLEQQELEEQQQIGDGLTGQAMNGVSLSSRHHPGGGVVGLGGGGGGGGSGGG----GGKKKNVGPLDLRQFVCQFDFD------------QFEPTENDKKEFLQSFPRLDELEEGITAAGTQEAARSNGQASGGGKRRRKTSDVPVVHPETVKTACYVKNVFMKIA-ERKRQSDFKYEYHHHTCCCYYTCAVNTDNVKKVLEGCRTFIIDKHLERFGIL 517          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. TrEMBL
Match: A0A267G5K2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023675g1 PE=4 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 2.795e-96
Identity = 182/493 (36.92%), Postives = 274/493 (55.58%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKFLQTAFSEQ------------YTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLRED----RSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHSIESMINEITNLTPHSTKNSAKQLNNRRSSLNINHKTNNDNMTSCSKCENSHPITDNNKCIHLCPESNSNSKICDRKISIRTIPSCSSRRFSKDNNFEFVAQTFSENPWGKYQPSNEECKEFVNSFP-VDQVD--LHSSGTHAA-------------KKKSKDVHNIHPDTIKTACYIKNIFAQITRNHPKNCDMKIS-NRRKCLFYYTCAVNTDNIQKVLDGCRSFLMEQHLERFGIL 1683
            TI KQM+IIH+NGFS  E+ E ++ ++RN+RD+I  I+ +M+KL I     + +    ++    +E             + Y   FFD V +LWQD+ VQ SF +S+ YQLID AKYFLD +H+ R   Y+P+ QDILRCR MT+ I++I F++++   +       DVGGQ+GERK+WIQ F  VTAIL+L D SSFD TL+ED    R KNRL++SL+ F + W+NRYLQ+V I++F+NKID LE K++   S       + ++  +  +    +         I        M   S     HP               S           + +     R+F    +F+            +++P+  + KEF+ SFP +D+++  + ++GT  A             ++K+ DV  +HP+T+KTACY+KN+F +I     +  D K   +   C  YYTCAVNTDN++KVL+GCR+F++++HLERFGIL
Sbjct:   50 TIRKQMQIIHINGFSSREREEKLAYMRRNIRDSIACIIAAMDKLGIAYTSEEAASLGAWVLRLMAENHVHNSVQADQDPFDYSQEFFDAVEKLWQDKGVQESFSQSSRYQLIDCAKYFLDRVHLFRDKSYMPTDQDILRCRIMTNDISDIQFDIKDGHHSVKFRVF-DVGGQKGERKKWIQCFNNVTAILYLCDVSSFDLTLKEDIDSDRPKNRLLESLDTFQEVWLNRYLQDVSILLFINKIDQLEEKVRAGKS-------LRSMIKYCQQGLQLEQQELEEQQQIGDGLTGQAMNGVSLSSRHHPGGGVVGLGGGGGGGGSGGG----GGKKKNVGPLDLRQFVCQFDFD------------QFEPTENDKKEFLQSFPRLDELEEGITTAGTQEAARSNGQASGGGKRRRKTSDVPVVHPETVKTACYVKNVFMKIA-ERKRQSDFKYEYHHHTCCCYYTCAVNTDNVKKVLEGCRTFIIDKHLERFGIL 517          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. TrEMBL
Match: A0A075AJS1 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_00318 PE=4 SV=1)

HSP 1 Score: 285.034 bits (728), Expect = 1.418e-84
Identity = 152/293 (51.88%), Postives = 198/293 (67.58%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKF----LQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHSIESMINEITN-----------LTPHSTKNSAKQLNNRRSSLNINHKTNND 1137
            TILKQMKIIH+NG++++EK EFI  + +N+RDA+M+++  M   ++  ++F  +E  K     L T+F E   YP +FFD V  LW D+ VQ  F ++NEYQL+DSAKYFLD I IIRQ DYIPS QDILRCR MT GI E+ F+++  +K  V F+VFDV GQ+G RK+WIQLF  VTAILFL D SSFDQTLREDR++NR++DSLEVF QAW N+YLQ+VP+IVF+NKID+L+ KI     I  + +   N            +P S  +S  Q  N   SL   +   ND
Sbjct:   56 TILKQMKIIHINGYTESEKKEFILPVYKNIRDAMMSLLGGM---RVLSEEFGTAENAKLAKDLLDTSFKEDSEYPPSFFDAVERLWNDQGVQRVFTKANEYQLLDSAKYFLDRIGIIRQADYIPSDQDILRCRTMTDGINEVRFDIQTGRKTSVRFRVFDVSGQRGARKKWIQLFDNVTAILFLVDSSSFDQTLREDRNQNRMVDSLEVFEQAWNNKYLQSVPMIVFLNKIDVLDEKIHAGQRITRLYSFAANWIDMYEMRSSVFSPASLADSRDQFLNLHDSLLSCYSQTND 345          

HSP 2 Score: 114.775 bits (286), Expect = 5.104e-23
Identity = 56/126 (44.44%), Postives = 82/126 (65.08%), Query Frame = 1
Query: 1315 VAQTFSENPWGKYQPSNEECKEFVNSFPVDQVDLHSSGTHAAKKKSKDVHNIHP---DTIKTACYIKNIFAQITRNHPKNCDMKISNRRKCLFYYTCAVNTDNIQKVLDGCRSFLMEQHLERFGIL 1683
            V Q   ++P+ K++PS EE  EF  +    +   HS     A  +S D+  + P   +TI+TACYIK++F ++T+  P   + ++  RR CLFYYTCAV+TD+++KVLD CR FL+E HLERFG+L
Sbjct:  463 VTQVIVQSPYHKFEPSVEEQYEFTRAIQYIERQPHS----LAGLESTDLRELRPPHRETIRTACYIKHLFQELTKQKPSGQN-QLGKRRHCLFYYTCAVSTDSVKKVLDACRKFLIEDHLERFGLL 583          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Cavefish
Match: gnal (guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type [Source:ZFIN;Acc:ZDB-GENE-041114-26])

HSP 1 Score: 218.779 bits (556), Expect = 4.031e-65
Identity = 138/293 (47.10%), Postives = 196/293 (66.89%), Query Frame = 1
Query:  139 CISKVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSE---KIKFLQT-AFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI 1005
            C+   +T++QR   +  +  R  N +IEK+L   +    +  +LLLLG GESGKSTI+KQM+I+HVNGF+  EK + I +I++NV+DAI+ IV +M+ L I P          ++ ++++ A    + Y   FF+    LW DE V+A F RSNEYQLID A+YFLD I  +RQNDY P+ QD+LRCR +TSGI E  F+V +     VNF +FDVGGQ+ ER++WIQ F +VTAI+F+A  SS++  +RED S NRL +SL++F   W NR+L+ + +I+F+NK DML  KI
Sbjct:    3 CLGNSKTEDQR---IDEKAQREANKKIEKQLQKERQAYKATHRLLLLGAGESGKSTIVKQMRILHVNGFNAEEKKQKILDIRKNVKDAIVTIVSAMSTL-IPPVPLGNPANQFRVDYIKSIAPLSDFDYTEEFFEHAKHLWDDEGVKACFERSNEYQLIDCAQYFLDRIDSVRQNDYTPTDQDLLRCRVLTSGIFETRFQVDK-----VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVAASSSYNMVIREDNSTNRLRESLDLFRSIWNNRFLRTISVILFLNKQDMLAEKI 286          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Cavefish
Match: gnal (guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type [Source:ZFIN;Acc:ZDB-GENE-041114-26])

HSP 1 Score: 218.779 bits (556), Expect = 4.031e-65
Identity = 138/293 (47.10%), Postives = 196/293 (66.89%), Query Frame = 1
Query:  139 CISKVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSE---KIKFLQT-AFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI 1005
            C+   +T++QR   +  +  R  N +IEK+L   +    +  +LLLLG GESGKSTI+KQM+I+HVNGF+  EK + I +I++NV+DAI+ IV +M+ L I P          ++ ++++ A    + Y   FF+    LW DE V+A F RSNEYQLID A+YFLD I  +RQNDY P+ QD+LRCR +TSGI E  F+V +     VNF +FDVGGQ+ ER++WIQ F +VTAI+F+A  SS++  +RED S NRL +SL++F   W NR+L+ + +I+F+NK DML  KI
Sbjct:    3 CLGNSKTEDQR---IDEKAQREANKKIEKQLQKERQAYKATHRLLLLGAGESGKSTIVKQMRILHVNGFNAEEKKQKILDIRKNVKDAIVTIVSAMSTL-IPPVPLGNPANQFRVDYIKSIAPLSDFDYTEEFFEHAKHLWDDEGVKACFERSNEYQLIDCAQYFLDRIDSVRQNDYTPTDQDLLRCRVLTSGIFETRFQVDK-----VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVAASSSYNMVIREDNSTNRLRESLDLFRSIWNNRFLRTISVILFLNKQDMLAEKI 286          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Cavefish
Match: gnal2 (guanine nucleotide-binding protein G(olf) subunit alpha [Source:NCBI gene;Acc:103040890])

HSP 1 Score: 215.312 bits (547), Expect = 7.962e-64
Identity = 139/311 (44.69%), Postives = 202/311 (64.95%), Query Frame = 1
Query:  139 CISKVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSE---KIKFLQT-AFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            C+   +T++QR   +  +  R  N +I+K+L   +    +  +LLLLG GESGKSTI+KQM+I+HVNGF+  EK + + +I++NV+DAI+ IV +M+ L I P      E   +I ++++ A    + Y   FFD   +LW DE V+A + RSNEYQLID A YFLD I  +RQ+DY P+ QD+LRCR +TSGI E  F+V     +KVNF +FDVGGQ+ ER++WIQ F +VTAI+F+   SS++  +RED + NRL ++LE+F   W NR+L+ + +I+F+NK DML  K+   +  IE    E    T
Sbjct:    3 CLGNSKTEDQR---IDEKAQREANKKIDKQLQKERQTYKATHRLLLLGAGESGKSTIVKQMRILHVNGFNAEEKKQKVLDIRKNVKDAIVTIVSAMSTL-IPPVPLANPEGQFRIDYIKSIAPLSDFDYSQEFFDHAKKLWDDEGVKACYERSNEYQLIDCAHYFLDRIDAVRQSDYTPTDQDLLRCRVLTSGIFETRFQV-----DKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNTTNRLREALELFRSIWNNRWLRTISVILFLNKQDMLAEKVLAGKSKIEDYFPEYARYT 304          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Cavefish
Match: gnal2 (guanine nucleotide-binding protein G(olf) subunit alpha [Source:NCBI gene;Acc:103040890])

HSP 1 Score: 212.231 bits (539), Expect = 2.389e-61
Identity = 119/256 (46.48%), Postives = 170/256 (66.41%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSE---KIKFLQT-AFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            TI+KQM+I+HVNGF+  EK + + +I++NV+DAI+ IV +M+ L I P      E   +I ++++ A    + Y   FFD   +LW DE V+A + RSNEYQLID A YFLD I  +RQ+DY P+ QD+LRCR +TSGI E  F+V     +KVNF +FDVGGQ+ ER++WIQ F +VTAI+F+   SS++  +RED + NRL ++LE+F   W NR+L+ + +I+F+NK DML  K+   +  IE    E    T
Sbjct:  169 TIVKQMRILHVNGFNAEEKKQKVLDIRKNVKDAIVTIVSAMSTL-IPPVPLANPEGQFRIDYIKSIAPLSDFDYSQEFFDHAKKLWDDEGVKACYERSNEYQLIDCAHYFLDRIDAVRQSDYTPTDQDLLRCRVLTSGIFETRFQV-----DKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNTTNRLREALELFRSIWNNRWLRTISVILFLNKQDMLAEKVLAGKSKIEDYFPEYARYT 418          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Cavefish
Match: gnal2 (guanine nucleotide-binding protein G(olf) subunit alpha [Source:NCBI gene;Acc:103040890])

HSP 1 Score: 187.578 bits (475), Expect = 2.286e-52
Identity = 108/239 (45.19%), Postives = 155/239 (64.85%), Query Frame = 1
Query:  355 EKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSE---KIKFLQT-AFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            EK + + +I++NV+DAI+ IV +M+ L I P      E   +I ++++ A    + Y   FFD   +LW DE V+A + RSNEYQLID A YFLD I  +RQ+DY P+ QD+LRCR +TSGI E  F+V     +KVNF +FDVGGQ+ ER++WIQ F +VTAI+F+   SS++  +RED + NRL ++LE+F   W NR+L+ + +I+F+NK DML  K+   +  IE    E    T
Sbjct:  174 EKKQKVLDIRKNVKDAIVTIVSAMSTL-IPPVPLANPEGQFRIDYIKSIAPLSDFDYSQEFFDHAKKLWDDEGVKACYERSNEYQLIDCAHYFLDRIDAVRQSDYTPTDQDLLRCRVLTSGIFETRFQV-----DKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNTTNRLREALELFRSIWNNRWLRTISVILFLNKQDMLAEKVLAGKSKIEDYFPEYARYT 406          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Sea Lamprey
Match: gnat2 (guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-011128-10])

HSP 1 Score: 163.696 bits (413), Expect = 1.131e-45
Identity = 111/271 (40.96%), Postives = 162/271 (59.78%), Query Frame = 1
Query:  214 QIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQIT---PKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEH 1017
            ++EK+LA    K+   +KLLLLG GESGKSTI+KQMKIIH NG+S+ E +EF + I  N   +I+AIV +M    I    P +     ++  L  +  E+ + PN    ++  LW+D  VQASF R++EYQL DSA Y+L+ +  +    Y+P+ QD+LR R  T+GI E SF  ++ +         DVGGQ+ ERK+WI  F  VT I+F    S++D  L ED   NR+ +SL +F     +RY  +  I++F+NK D+ E K++  H
Sbjct:    5 ELEKKLAEDAEKEARTVKLLLLGAGESGKSTIVKQMKIIHKNGYSEAECLEFKAIIYSNTLQSILAIVRAMETFSIDYGDPARAADGRQLFNLADSL-EEGSMPNELSAIIIRLWKDTGVQASFDRASEYQLNDSASYYLNDLDRLMNPSYLPNEQDVLRSRVKTTGIIEDSFCFKDLQFRMF-----DVGGQRSERKKWIHCFEGVTCIIFCGALSAYDMVLVEDDEVNRMHESLHLFNSICNHRYFNDTSIVLFLNKKDLFEEKVKKVH 269          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004355.1 (pep scaffold:Pmarinus_7.0:GL477714:209323:228779:-1 gene:ENSPMAG00000003914.1 transcript:ENSPMAT00000004355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.999 bits (406), Expect = 6.943e-45
Identity = 91/236 (38.56%), Postives = 134/236 (56.78%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIK--FLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI 1005
            TI+KQMKIIH +G+S+ E  ++ + +  N   +I+AI+ +M KL+I       +E  +  F+    +E+        +V+  LW D  VQA F RS EYQL DSA Y+L+ +  I    YIP+ QD+LR R  T+GI E  F  ++           DVGGQ+ ERK+WI  F  VTAI+F    S++D  L ED   NR+ +S+++F     N++     II+F+NK D+ E KI
Sbjct:   16 TIVKQMKIIHEDGYSEDECKQYTAVVFSNAIQSIIAIIRAMGKLKIDFGDVSRAEDARQLFVLAGVAEEGVMTPDLSEVIKRLWSDSGVQACFRRSREYQLNDSAAYYLNDLERISNLSYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMF-----DVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEETNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKI 246          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Sea Lamprey
Match: gnai3 (guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 3 [Source:ZFIN;Acc:ZDB-GENE-070713-6])

HSP 1 Score: 151.369 bits (381), Expect = 4.067e-41
Identity = 86/237 (36.29%), Postives = 133/237 (56.12%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQIT---PKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI 1005
            TI+KQMKIIH  G+++ E  ++ + +  N   +++AI+ +M  L+I      + D + ++  L  +  +    P     V+  LW D  VQA F R+ EYQL DSA Y+L+ +  I Q  Y+P+ QD+LR R  T+GI E  F  ++           DVGGQ+ ERK+WI  F  VTAI+F    S++D  L ED   NR+ +S+++F     N++     II+F+NK D+ E K+
Sbjct:   48 TIVKQMKIIHEAGYTEEECKQYKAVVYSNTIQSVIAIIRAMGNLRIDFGDAGRADDARQLFVLAGSAEDGLMTPE-LAQVIKRLWADPGVQACFRRAREYQLNDSAAYYLNDLERISQPSYVPTQQDVLRTRVKTTGIVETHFTFKDLHFKMF-----DVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFIETSIILFLNKKDLFEEKV 278          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007354.1 (pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 gene:ENSPMAG00000006632.1 transcript:ENSPMAT00000007354.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 2.059e-39
Identity = 86/242 (35.54%), Postives = 136/242 (56.20%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKFLQTAFSEQY-TYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHSIE 1026
            T +KQM+IIH +G+++ +K  FI  + +NV  A+ A++ +M  L I           + L+    E+  +    + + V  LW D  ++  + R  E+QL DSAKY+L+ +  I   +Y+P+ QDILR R  T+GI E  F++       V     DVGGQ+ ER++WI  F  VT+I+FL   S +DQ L E  S+NR+ +S  +F       + QN  +I+F+NK D+LE KI + H ++
Sbjct:   13 TFIKQMRIIHGSGYTEDDKRSFIKLVHQNVFSAMQAMIRAMETLGIPYANAGNQAHAQLLREVDVEKICSLDKPYIEAVRCLWADPGIEECYDRRREFQLTDSAKYYLNDLARISAVNYLPTQQDILRVRIPTTGIIEYPFDLENIIFRMV-----DVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIIHSHLVD 249          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007349.1 (pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 gene:ENSPMAG00000006632.1 transcript:ENSPMAT00000007349.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 2.353e-39
Identity = 86/242 (35.54%), Postives = 136/242 (56.20%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKFLQTAFSEQY-TYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHSIE 1026
            T +KQM+IIH +G+++ +K  FI  + +NV  A+ A++ +M  L I           + L+    E+  +    + + V  LW D  ++  + R  E+QL DSAKY+L+ +  I   +Y+P+ QDILR R  T+GI E  F++       V     DVGGQ+ ER++WI  F  VT+I+FL   S +DQ L E  S+NR+ +S  +F       + QN  +I+F+NK D+LE KI + H ++
Sbjct:   13 TFIKQMRIIHGSGYTEDDKRSFIKLVHQNVFSAMQAMIRAMETLGIPYANAGNQAHAQLLREVDVEKICSLDKPYIEAVRCLWADPGIEECYDRRREFQLTDSAKYYLNDLARISAVNYLPTQQDILRVRIPTTGIIEYPFDLENIIFRMV-----DVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIIHSHLVD 249          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Yeast
Match: GPA2 (Nucleotide binding alpha subunit of the heterotrimeric G protein; interacts with the receptor Gpr1p, has signaling role in response to nutrients; required for the recruitment of Ras-GTP at the plasma membrane and in the nucleus [Source:SGD;Acc:S000000822])

HSP 1 Score: 129.028 bits (323), Expect = 1.067e-32
Identity = 80/244 (32.79%), Postives = 135/244 (55.33%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQIT--PK----KFDLSEKIKFLQTAFSEQYT--YPNTFFDVVSELWQDEDVQ--ASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI 1005
            T+L+Q+KI+H NGFS+ E  E+I  I +N+ +    ++ +  +  +   P+    + DLS  + +        YT  +P     V+S LW     Q   +   ++++ L+DS  YF+++   I   +Y P+ QDILR R+MTSGI    F+      + +   ++DVGGQ+ ERK+WI  F  VT ++F    S +DQTL ED+++NR  +SL +F     +R+     +++F+NKID+   K+
Sbjct:  138 TVLQQLKILHQNGFSEQEIKEYIPLIYQNLLEIGRNLIQARTRFNVNLEPECELTQQDLSRTMSY---EMPNNYTGQFPEDIAGVISTLWALPSTQDLVNGPNASKFYLMDSTPYFMENFTRITSPNYRPTQQDILRSRQMTSGI----FDTVIDMGSDIKMHIYDVGGQRSERKKWIHCFDNVTLVIFCVSLSEYDQTLMEDKNQNRFQESLVLFDNIVNSRWFARTSVVLFLNKIDLFAEKL 374          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Yeast
Match: GPA1 (Subunit of the G protein involved in pheromone response; GTP-binding alpha subunit of the heterotrimeric G protein; negatively regulates the mating pathway by sequestering G(beta)gamma and by triggering an adaptive response; activates Vps34p at the endosome; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001047])

HSP 1 Score: 114.775 bits (286), Expect = 1.134e-27
Identity = 62/161 (38.51%), Postives = 98/161 (60.87%), Query Frame = 1
Query:  532 VVSELWQ-DEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQN 1011
             + +LW  D+ ++  F RSNE+QL  SA Y+ D+I      +Y+ + +DIL+ R  T+GITE  F +         FKV D GGQ+ ERK+WI  F  +TA+LF+   S +DQ L ED   NR+ +S+ +F     +++ ++ P I+F+NKID+ E K+++
Sbjct:  244 AIKQLWNNDKGIKQCFARSNEFQLEGSAAYYFDNIEKFASPNYVCTDEDILKGRIKTTGITETEFNI-----GSSKFKVLDAGGQRSERKKWIHCFEGITAVLFVLAMSEYDQMLFEDERVNRMHESIMLFDTLLNSKWFKDTPFILFLNKIDLFEEKVKS 399          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Nematostella
Match: EDO49193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHA6])

HSP 1 Score: 209.149 bits (531), Expect = 6.539e-62
Identity = 112/243 (46.09%), Postives = 166/243 (68.31%), Query Frame = 1
Query:  304 TILKQMKIIH-VNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKF---LQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHS 1020
            TI+KQM+I+H V+GF++ EK + I +IK+N+RDAI+ I  +M+ L    K  + + + +     + A +  + YP  F++    LWQD  V   + RSNEYQLID A+YFLD +  I+Q DY+P+ QD+LRCR +TSGI E  FEV     ++V F +FDVGGQ+ ER++WIQ F +VTAI+F+  CSS++  LRED S+NRL +SLE+F   W NR+L+ + +I+F+NK D+L+ K++   S
Sbjct:   55 TIVKQMRILHDVHGFTELEKRQKIEDIKKNIRDAILTITGAMSTLTPPVKLANPNNQFRLDYVHEVATAPDFDYPPEFYEHTKILWQDAGVLECYERSNEYQLIDCAQYFLDRVDTIQQQDYLPTEQDLLRCRVLTSGIIETRFEV-----DRVKFHMFDVGGQRDERRKWIQCFNDVTAIIFVVACSSYNLVLREDASQNRLKESLELFKSIWNNRWLRTISVILFLNKQDLLKDKVRAGKS 292          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Nematostella
Match: EDO41465 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S470])

HSP 1 Score: 160.229 bits (404), Expect = 4.341e-44
Identity = 111/279 (39.78%), Postives = 166/279 (59.50%), Query Frame = 1
Query:  193 ENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKFLQTAFSEQYT-YPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHSIE 1026
            E +R N +IEK++   K  +   LKLLLLGTGESGKST +KQM+IIH  G+S  +K  +I  + +N+  A+ ++  +M  L+I  K     EK  +++T   +  T +   +++    LW D  +Q  + R  EYQL DSAKY+L  +  + + DY+P+ QD+LR R  TSGI E  F++       + F++ DVGGQ+ ER++WI  F  VT+I+FL   S +DQ L E  S+NR+ +S  +F       + QN  II+F+NK D+LE KI   H +E
Sbjct:   11 ERKRINAEIEKQIRQDKRNQRRELKLLLLGTGESGKSTFIKQMRIIHGQGYSDEDKRGYIPLVYQNIITAMHSLTRAMETLKIPYKDSSNLEKASYIRTVDPKNVTTFEREYYEATKSLWSDAGMQECYDRRREYQLSDSAKYYLTDLDRLAKPDYLPTEQDVLRARAPTSGIIEYPFDLE-----TIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDSENRMEESKALFRTIITYPWFQNSSIILFLNKKDLLEEKIMFSHLVE 284          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Nematostella
Match: EDO49692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG04])

HSP 1 Score: 158.688 bits (400), Expect = 1.899e-43
Identity = 87/237 (36.71%), Postives = 134/237 (56.54%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQIT---PKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI 1005
            TI+KQMKIIH +G+SK E  ++   +  N   +++AI+ +M  L+I    P + D + ++ F      E   +      ++  LW D  +QA F RS EYQL DSA Y+L+ +  +   DY+P+ QD+LR R  T+GI E  F  ++           DVGGQ+ ERK+WI  F  VTAI+F    S++D  L ED   NR+++S+++F     N++  +  II+F+NK D+   KI
Sbjct:   48 TIVKQMKIIHEHGYSKEECTQYKQVVYSNTIQSMIAIIRAMGTLKIEFGHPDRADDAREM-FALAGSMEDVKFTAELISIMKRLWSDSGIQACFARSREYQLNDSASYYLNALDRLGSPDYVPTEQDVLRTRVKTTGIVETHFTFKDLHFKMF-----DVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMMESMKLFDSICNNKWFTDTSIILFLNKKDLFAEKI 278          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Nematostella
Match: EDO47993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKI8])

HSP 1 Score: 155.221 bits (391), Expect = 3.147e-42
Identity = 114/305 (37.38%), Postives = 167/305 (54.75%), Query Frame = 1
Query:  124 IFMNTCISKVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQI---TPKKFDLSEKIKFLQ------TAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQN 1011
            +F   C+++ E            E R ++ +I+K++A  K +    +K+LLLG GESGKST LKQM+II+   F      E+   +  N+   +  +  +  KL+I    P     +E+I  LQ      T F  QY       + V  LW D  ++ SF R  E+QL DS +YFLDH+  I + DYIP+ QD+L  RK T GI E  F ++      V     DVGGQ+ +R +W Q F EVT+ILFL   S++DQ L EDR+ NRL++S  +F     N++  NV II+F+NK D+L  K+++
Sbjct:    2 VFEGCCLTQEEA-----------EQRAQSQKIDKQIAQEKAQLRRQVKILLLGAGESGKSTFLKQMRIIYGKDFDADALQEYKPVVYSNILKGMKVLADARRKLRIDWDAPDNEMHAERILTLQAPPRIDTEFFLQYA------ESVRRLWTDAGIRDSFDRRREFQLGDSTRYFLDHLDRICRADYIPTKQDMLHSRKATKGIVEHEFMIKSIPFKMV-----DVGGQRSQRAKWFQCFDEVTSILFLVSSSAYDQVLMEDRTTNRLVESCNIFETIVNNKFFANVSIILFLNKTDLLTEKVKH 284          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Nematostella
Match: EDO32540 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUS4])

HSP 1 Score: 150.214 bits (378), Expect = 1.892e-40
Identity = 100/291 (34.36%), Postives = 160/291 (54.98%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFD-----LSEKIKFLQTAFSEQYTYPNT--FFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHSIESMINEITNLTPHSTKNSAKQLNNRRSSLNINHKTNNDNMTSCS 1155
            TI+KQM+IIH +GFS  + I++   +  N   +++ I+ +M+KL+I    F+     +  K+ F   A ++  T P T    + +  LW+D  VQ  F RS EYQL DSAKY+LD +  I   +Y  + QD+LR R  T+GI E+ F+ +            DVGGQ+ ERK+WI  F +VTAI++    S++D TL ED S NR+ +SL++F     N++  +  +I+F+NK D+ E KI ++  +     E +   P +    AK +  +  S N+N +       +C+
Sbjct:   48 TIVKQMRIIHDHGFSPEDYIQYRPLVFSNTIYSLLTIIRAMDKLRI---DFENDARLMDAKLVFDVIARADD-TEPFTPELTESMERLWKDAGVQQCFHRSREYQLGDSAKYYLDSLQRIGAPNYEATEQDLLRTRVKTTGIVEVQFDYKRLHFKLF-----DVGGQRSERKKWIHCFEDVTAIIYCVALSAYDLTLEEDESTNRMEESLKLFESIINNKWFVDTSVILFLNKKDLFEEKI-SKFPLTLCFPEYSG--PSTFDEGAKYIRKQFESKNLNDEKEIYTHLTCA 326          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000007195.2 (guanine nucleotide-binding protein G(s) subunit alpha [Source:NCBI gene;Acc:101166373])

HSP 1 Score: 214.157 bits (544), Expect = 2.422e-63
Identity = 139/312 (44.55%), Postives = 198/312 (63.46%), Query Frame = 1
Query:  139 CISKVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKF-----LQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            C+   +T++QR +    +  R  N +IEK+L   K    +  +LLLLG GESGKSTI+KQM+I+HVNGF+  EK + I +IK N+++AI  IV +M  L  TP         +F     L  A  + + +P  F+D    LWQDE V+A + RSNEYQLID A+YFLD I ++RQNDY P+ QD+LRCR +TSGI E  F++     +KVNF +FDVGGQ+ ER++WIQ F +VTAI+F+   SS++  +RED   NRL ++L +F   W NR+L+ + +I+F+NK D+L  K+   +  IE    E +  T
Sbjct:    3 CLGNSKTEDQRNEE---KAQREANKKIEKQLQKDKQIYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNAEEKKQKIHDIKNNIKEAIETIVAAMTTL--TPPCQLACPANRFRIDYVLNQASQKDFDFPKEFYDHTKILWQDEGVRACWERSNEYQLIDCAQYFLDRIDVVRQNDYTPTDQDLLRCRVLTSGIFETKFQI-----DKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKNIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEEYFPEFSRYT 304          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Medaka
Match: ENSORLT00000045692.1 (guanine nucleotide-binding protein G(s) subunit alpha [Source:NCBI gene;Acc:101166373])

HSP 1 Score: 213.772 bits (543), Expect = 2.424e-63
Identity = 138/312 (44.23%), Postives = 197/312 (63.14%), Query Frame = 1
Query:  139 CISKVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKF-----LQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            C+   +T++QR +    +  R  N +IEK+L   K    +  +LLLLG GESGKSTI+KQM+I+HVNGF+  EK + I +IK N+++AI  IV +M  L  TP         +F     L  A  + + +P  F+D    LWQDE V+A + RSNEYQLID A+YFLD I ++RQNDY P+ QD+LRCR +TSGI E  F++ +     VNF +FDVGGQ+ ER++WIQ F +VTAI+F+   SS++  +RED   NRL ++L +F   W NR+L+ + +I+F+NK D+L  K+   +  IE    E +  T
Sbjct:    3 CLGNSKTEDQRNEE---KAQREANKKIEKQLQKDKQIYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNAEEKKQKIHDIKNNIKEAIETIVAAMTTL--TPPCQLACPANRFRIDYVLNQASQKDFDFPKEFYDHTKILWQDEGVRACWERSNEYQLIDCAQYFLDRIDVVRQNDYTPTDQDLLRCRVLTSGIFETKFQIDK-----VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKNIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEEYFPEFSRYT 304          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Medaka
Match: GNAL (G protein subunit alpha L [Source:NCBI gene;Acc:101174132])

HSP 1 Score: 217.238 bits (552), Expect = 2.622e-63
Identity = 121/256 (47.27%), Postives = 173/256 (67.58%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSE---KIKFLQT-AFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            TI+KQMKI+HVNGF+  EK + + +I++NV+DAI+ IV +M+ L I P      E   +I+++++ A    + YP  FFD   +LW DE V+A F RSNEYQLID A+YFLD I  +RQ DY P+ QD+LRCR +TSGI E  F+V     +KVNF +FDVGGQ+ ER++WIQ F +VTAI+F+   SS++  +RED + NRL ++L++F   W NR+L+ + +I+F+NK DML  K+   +  IE    E +  T
Sbjct:  171 TIVKQMKILHVNGFNAEEKKQKVQDIRKNVKDAIVTIVSAMSTL-IPPVPLANPENQFRIEYIKSIAPLSDFDYPQEFFDHAKKLWDDEGVKACFERSNEYQLIDCAQYFLDRIDSVRQGDYTPTDQDLLRCRVLTSGIFETRFQV-----DKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNNTNRLREALDLFRSIWNNRWLRTISVILFLNKQDMLAEKVLAGKSKIEDYFPEYSRYT 420          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Medaka
Match: GNAS (GNAS complex locus [Source:NCBI gene;Acc:101163657])

HSP 1 Score: 212.231 bits (539), Expect = 1.249e-62
Identity = 139/312 (44.55%), Postives = 197/312 (63.14%), Query Frame = 1
Query:  139 CISKVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQ-----ITPKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI-QNEHSIESMINEITNLT 1056
            C+   +T++QR +    +  R  N +IEK+L   K    +  +LLLLG GESGKSTI+KQM+I+HVNGF+  EK + I +IK N+++AI  +V +M+ L       +P      E I  L     + + +P  F+D    LWQDE V+A F RSNEYQLID A+YFLD I I++Q+DY PS QD+LRCR +TSGI E  F+V     +KVNF +FDVGGQ+ ER++WIQ F +VTAI+F+   SS++  +RED   NRL ++L +F   W NR+L+ + +I+F+NK D+L  K+   +  IE    E    T
Sbjct:    3 CLGNSKTEDQRNEE---KAQREANKKIEKQLQKDKQIYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNAEEKKQKIQDIKNNIKEAIETVVTAMSTLTPPVQLASPGNQHRVEYI--LNLVNQKDFEFPYEFYDHAKMLWQDEGVRACFERSNEYQLIDCAQYFLDKIDIVKQSDYTPSDQDLLRCRVLTSGIFETRFQV-----DKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKNIWNNRWLRTISVILFLNKQDLLADKVLAGKSKIEEYFPEFARYT 304          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Medaka
Match: GNAL (G protein subunit alpha L [Source:NCBI gene;Acc:101174132])

HSP 1 Score: 204.142 bits (518), Expect = 1.731e-59
Identity = 129/279 (46.24%), Postives = 187/279 (67.03%), Query Frame = 1
Query:  139 CISKVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSE---KIKFLQT-AFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPI 963
            C+   +T++QR   +  ++ R  N +IEK+L   +    +  +LLLLG GESGKSTI+KQMKI+HVNGF+  EK + + +I++NV+DAI+ IV +M+ L I P      E   +I+++++ A    + YP  FFD   +LW DE V+A F RSNEYQLID A+YFLD I  +RQ DY P+ QD+LRCR +TSGI E  F+V +     VNF +FDVGGQ+ ER++WIQ F +VTAI+F+   SS++  +RED + NRL ++L++F   W NR ++ V +
Sbjct:    3 CLGNSKTEDQR---IDEKQQREANKKIEKQLQKERQAYKATHRLLLLGAGESGKSTIVKQMKILHVNGFNAEEKKQKVQDIRKNVKDAIVTIVSAMSTL-IPPVPLANPENQFRIEYIKSIAPLSDFDYPQEFFDHAKKLWDDEGVKACFERSNEYQLIDCAQYFLDRIDSVRQGDYTPTDQDLLRCRVLTSGIFETRFQVDK-----VNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNNTNRLREALDLFRSIWNNRSVREVDL 272          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Planmine SMEST
Match: SMESG000068578.1 (SMESG000068578.1)

HSP 1 Score: 989.949 bits (2558), Expect = 0.000e+0
Identity = 518/518 (100.00%), Postives = 518/518 (100.00%), Query Frame = 1
Query:  130 MNTCISKVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHSIESMINEITNLTPHSTKNSAKQLNNRRSSLNINHKTNNDNMTSCSKCENSHPITDNNKCIHLCPESNSNSKICDRKISIRTIPSCSSRRFSKDNNFEFVAQTFSENPWGKYQPSNEECKEFVNSFPVDQVDLHSSGTHAAKKKSKDVHNIHPDTIKTACYIKNIFAQITRNHPKNCDMKISNRRKCLFYYTCAVNTDNIQKVLDGCRSFLMEQHLERFGIL 1683
            MNTCISKVETDEQREKRVLLEENRRKNNQIEKELALYKNKKLSCLKLLLLGTGESGKSTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREKKKNKVNFKVFDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHSIESMINEITNLTPHSTKNSAKQLNNRRSSLNINHKTNNDNMTSCSKCENSHPITDNNKCIHLCPESNSNSKICDRKISIRTIPSCSSRRFSKDNNFEFVAQTFSENPWGKYQPSNEECKEFVNSFPVDQVDLHSSGTHAAKKKSKDVHNIHPDTIKTACYIKNIFAQITRNHPKNCDMKISNRRKCLFYYTCAVNTDNIQKVLDGCRSFLMEQHLERFGIL
Sbjct:    1 MNTCISKVETDEQREKRVLLEENRRKNNQIEKELALYKNKKLSCLKLLLLGTGESGKSTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREKKKNKVNFKVFDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHSIESMINEITNLTPHSTKNSAKQLNNRRSSLNINHKTNNDNMTSCSKCENSHPITDNNKCIHLCPESNSNSKICDRKISIRTIPSCSSRRFSKDNNFEFVAQTFSENPWGKYQPSNEECKEFVNSFPVDQVDLHSSGTHAAKKKSKDVHNIHPDTIKTACYIKNIFAQITRNHPKNCDMKISNRRKCLFYYTCAVNTDNIQKVLDGCRSFLMEQHLERFGIL 518          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Planmine SMEST
Match: SMESG000062022.1 (SMESG000062022.1)

HSP 1 Score: 217.238 bits (552), Expect = 1.179e-64
Identity = 135/290 (46.55%), Postives = 189/290 (65.17%), Query Frame = 1
Query:  148 KVETDEQREKRVLLEENRRKNNQIEKELAXXXXXXXXXXXXXXXXXXXXXXXTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKFL----QTAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKI 1005
            K ET+EQ+ ++   E N+R    IEKE    K    S  +LLLLG GESGKSTI+KQM+I+H++GFS  EK +   +I++N+RDAI+ I  +M+ +   P K    E  KFL     TA    + YP+ F++  + LW D+ V  ++ RSNEYQLID AKYFLD   I+ Q +Y P+ QDILRCR +TSGI E  F V +   +       DVGGQ+ ER++WIQ F +VTAI+F+  CSS++  LRED S+NRL +SLE+    W NR+L+N+ +I+F+NK D+L+ K+
Sbjct:    9 KTETEEQKNRK---ESNKRIEKCIEKE----KRSFKSTHRLLLLGAGESGKSTIVKQMRILHIDGFSNEEKKQKAEDIRKNLRDAILTITSAMSNIN-PPTKLGNPENQKFLDYMQHTASKPDFRYPSEFYEYCAVLWADKGVLETYERSNEYQLIDCAKYFLDQALILGQQNYTPTEQDILRCRVLTSGIFETKFTVDKVNFHMF-----DVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDASQNRLRESLELLKSIWNNRWLRNISVILFLNKQDVLKEKV 285          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Planmine SMEST
Match: SMESG000069284.1 (SMESG000069284.1)

HSP 1 Score: 207.223 bits (526), Expect = 5.929e-61
Identity = 111/293 (37.88%), Postives = 177/293 (60.41%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEK---IKFLQ-TAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHSIESMINEITNLTPHSTKNSAKQLNNRRSSLNINHKTNNDNMTSCSKCENS 1170
            T++KQM+I+++NGF+  E+   I +I+ N++D ++A+  +M  L+  P   + +E    + F+Q  A    +TY   FFD    LW D  VQA+F R+NEYQLIDS KYFLD +  I ++DY+P+ QD+LRCR +TSGI E  F + +     V F +FDVGGQ+ ER++WIQ+F +VTA++F+  CS +D TLRE + +NRL + + +F + W NRYL+   II+F+NK D+   K+ +  +   +++       + +KN+    ++  S +        D   S +K E  
Sbjct:   49 TLIKQMQILYINGFNDEERKSKIKDIRGNIKDGMLAVTGAMKTLK-PPVDLEHAENQTLLDFIQHNAVKPDFTYTKEFFDYCYTLWIDAGVQATFARANEYQLIDSTKYFLDQVQTIAKDDYLPTDQDLLRCRVLTSGIFETKFTMNK-----VCFHMFDVGGQREERRKWIQVFSDVTAVIFVCACSGYDMTLREAQKQNRLRECISLFSEVWGNRYLRQTSIILFLNKQDLFVQKLTSGKT--KIVDFFPEFAEYQSKNTFDSQSDEPSEVTYAKNFVKDKFMSTTKKEEG 333          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Planmine SMEST
Match: SMESG000055191.1 (SMESG000055191.1)

HSP 1 Score: 165.622 bits (418), Expect = 1.040e-45
Identity = 91/238 (38.24%), Postives = 134/238 (56.30%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKFLQ---TAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQ 1008
            TI+KQMKIIH  GF++ +  ++   +  N   +++AI+ +M  L I+    D     K +     A  +   +     + +  LW D  VQ  F RSNEYQL DSAKYFLD +  +   DY+P+ QDILR R  T+GI E+ F  +            DVGGQ+ ERK+WI  F +VTAI+F    S +DQ L ED + NR+ +SL++F     N++  +  II+F+NK D+ + KI+
Sbjct:   48 TIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLF-----DVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIK 280          
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Planmine SMEST
Match: SMESG000055191.1 (SMESG000055191.1)

HSP 1 Score: 165.622 bits (418), Expect = 1.067e-45
Identity = 91/238 (38.24%), Postives = 134/238 (56.30%), Query Frame = 1
Query:  304 TILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMNKLQITPKKFDLSEKIKFLQ---TAFSEQYTYPNTFFDVVSELWQDEDVQASFLRSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEVREXXXXXXXXXXXDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLREDRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQ 1008
            TI+KQMKIIH  GF++ +  ++   +  N   +++AI+ +M  L I+    D     K +     A  +   +     + +  LW D  VQ  F RSNEYQL DSAKYFLD +  +   DY+P+ QDILR R  T+GI E+ F  +            DVGGQ+ ERK+WI  F +VTAI+F    S +DQ L ED + NR+ +SL++F     N++  +  II+F+NK D+ + KI+
Sbjct:   44 TIVKQMKIIHEGGFTQEDNKQYKPVVYSNTTQSMIAILRAMTTLGISFGDIDRGADAKVVSDVIQAMEDTEPFSEELLEAMKRLWADPGVQECFGRSNEYQLNDSAKYFLDDLDRLGAKDYMPTEQDILRTRVKTTGIVEVHFMFKNMNFKLF-----DVGGQRSERKKWIHCFEDVTAIIFCVAMSEYDQVLHEDETTNRMQESLKLFDSICNNKWFTSTSIILFLNKKDLFDEKIK 276          
The following BLAST results are available for this feature:
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GNAL2.908e-6245.42G protein subunit alpha L [Source:HGNC Symbol;Acc:... [more]
GNAL2.908e-6245.42G protein subunit alpha L [Source:HGNC Symbol;Acc:... [more]
GNAL2.908e-6245.42G protein subunit alpha L [Source:HGNC Symbol;Acc:... [more]
GNAS9.347e-6242.77GNAS complex locus [Source:HGNC Symbol;Acc:HGNC:43... [more]
GNAS1.506e-6042.63GNAS complex locus [Source:HGNC Symbol;Acc:HGNC:43... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsa-17.196e-6447.28G protein, Subunit Alpha [Source:UniProtKB/TrEMBL... [more]
gsa-17.196e-6447.28G protein, Subunit Alpha [Source:UniProtKB/TrEMBL... [more]
gsa-11.449e-4648.60G protein, Subunit Alpha [Source:UniProtKB/TrEMBL... [more]
goa-14.687e-4340.28Guanine nucleotide-binding protein G(o) subunit al... [more]
gpa-11.067e-4138.06Guanine nucleotide-binding protein alpha-1 subunit... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Galphas8.892e-6145.49gene:FBgn0001123 transcript:FBtr0072142[more]
Galphas8.892e-6145.49gene:FBgn0001123 transcript:FBtr0343279[more]
Galphas8.892e-6145.49gene:FBgn0001123 transcript:FBtr0072144[more]
Galphas1.057e-6045.49gene:FBgn0001123 transcript:FBtr0301411[more]
Galphas1.057e-6045.49gene:FBgn0001123 transcript:FBtr0072143[more]
back to top
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnal4.762e-6643.71guanine nucleotide binding protein (G protein), al... [more]
gnal1.381e-6543.71guanine nucleotide binding protein (G protein), al... [more]
gnas4.094e-6143.77GNAS complex locus [Source:ZFIN;Acc:ZDB-GENE-09041... [more]
gnat22.302e-4841.94guanine nucleotide binding protein (G protein), al... [more]
gna13a1.048e-4640.26guanine nucleotide binding protein (G protein), al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
thap71.703e-4740.25THAP domain containing 7 [Source:Xenbase;Acc:XB-GE... [more]
gnai22.510e-4740.93guanine nucleotide binding protein (G protein), al... [more]
gnat22.736e-4640.29guanine nucleotide binding protein (G protein), al... [more]
gnai15.933e-4539.50guanine nucleotide binding protein (G protein), al... [more]
gnai11.387e-4439.50guanine nucleotide binding protein (G protein), al... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gnal1.689e-6245.42guanine nucleotide binding protein, alpha stimulat... [more]
Gnal1.689e-6245.42guanine nucleotide binding protein, alpha stimulat... [more]
Gnas5.603e-6242.77GNAS (guanine nucleotide binding protein, alpha st... [more]
Gnas1.078e-6042.63GNAS (guanine nucleotide binding protein, alpha st... [more]
Gnal6.806e-6044.92guanine nucleotide binding protein, alpha stimulat... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P30684|GNAS_LYMST6.749e-6947.99Guanine nucleotide-binding protein G(s) subunit al... [more]
sp|P30669|GNAS_SCHMA9.950e-6648.74Guanine nucleotide-binding protein G(s) subunit al... [more]
sp|Q7PD79|GNAS_ANOGA1.733e-6448.35Guanine nucleotide-binding protein G(s) subunit al... [more]
sp|O16118|GNAS_HOMAM2.650e-6448.76Guanine nucleotide-binding protein G(s) subunit al... [more]
sp|Q8CGK7|GNAL_MOUSE1.182e-6145.42Guanine nucleotide-binding protein G(olf) subunit ... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HTH17.771e-9938.34Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4Z2CUN11.759e-9837.03Guanine nucleotide-binding protein G(S) subunit al... [more]
A0A267FWY52.566e-9636.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G5K22.795e-9636.92Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A075AJS11.418e-8451.88Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnal4.031e-6547.10guanine nucleotide binding protein (G protein), al... [more]
gnal4.031e-6547.10guanine nucleotide binding protein (G protein), al... [more]
gnal27.962e-6444.69guanine nucleotide-binding protein G(olf) subunit ... [more]
gnal22.389e-6146.48guanine nucleotide-binding protein G(olf) subunit ... [more]
gnal22.286e-5245.19guanine nucleotide-binding protein G(olf) subunit ... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnat21.131e-4540.96guanine nucleotide binding protein (G protein), al... [more]
ENSPMAT00000004355.16.943e-4538.56pep scaffold:Pmarinus_7.0:GL477714:209323:228779:-... [more]
gnai34.067e-4136.29guanine nucleotide binding protein (G protein), al... [more]
ENSPMAT00000007354.12.059e-3935.54pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 g... [more]
ENSPMAT00000007349.12.353e-3935.54pep scaffold:Pmarinus_7.0:GL488470:4533:13151:-1 g... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
GPA21.067e-3232.79Nucleotide binding alpha subunit of the heterotrim... [more]
GPA11.134e-2738.51Subunit of the G protein involved in pheromone res... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491936.539e-6246.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414654.341e-4439.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496921.899e-4336.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479933.147e-4237.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325401.892e-4034.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000007195.22.422e-6344.55guanine nucleotide-binding protein G(s) subunit al... [more]
ENSORLT00000045692.12.424e-6344.23guanine nucleotide-binding protein G(s) subunit al... [more]
GNAL2.622e-6347.27G protein subunit alpha L [Source:NCBI gene;Acc:10... [more]
GNAS1.249e-6244.55GNAS complex locus [Source:NCBI gene;Acc:101163657... [more]
GNAL1.731e-5946.24G protein subunit alpha L [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Guanine nucleotide-binding protein G(S) subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068578.10.000e+0100.00SMESG000068578.1[more]
SMESG000062022.11.179e-6446.55SMESG000062022.1[more]
SMESG000069284.15.929e-6137.88SMESG000069284.1[more]
SMESG000055191.11.040e-4538.24SMESG000055191.1[more]
SMESG000055191.11.067e-4538.24SMESG000055191.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017055 ID=SMED30017055|Name=Guanine nucleotide-binding protein G(S) subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=1803bp
GAGACAACTTACTTAGTGTGTCAAATTCATGTTTTAAATATCCGATAGTT
ACAAAATCAATTGTTATTTTTATTTGACTGGTTACTGGTTACTATTTTAA
TAGGGAATTAAATAAGAAACTTCATTTTTATGAATACATGCATTTCTAAA
GTTGAGACAGATGAACAACGAGAAAAACGTGTCTTATTAGAGGAAAACAG
AAGAAAAAATAATCAAATCGAAAAGGAATTAGCATTATATAAAAATAAGA
AATTATCATGCCTGAAGCTTTTACTATTAGGGACTGGCGAATCCGGAAAA
AGCACAATTCTCAAACAAATGAAAATCATACATGTAAATGGATTTTCCAA
AACTGAGAAAATTGAATTCATTTCCAACATCAAACGAAACGTTCGGGATG
CAATAATGGCGATTGTCGTGTCAATGAATAAACTACAAATTACACCGAAG
AAATTCGATCTTTCCGAGAAAATTAAATTCCTTCAAACTGCCTTTTCAGA
ACAATATACCTATCCTAATACTTTTTTCGACGTTGTTTCTGAGCTATGGC
AAGACGAAGATGTTCAAGCTAGTTTTTTGAGATCCAACGAATATCAACTT
ATTGATTCAGCTAAATATTTTTTAGATCATATCCATATAATTCGTCAAAA
TGATTATATACCATCGTTACAGGATATATTAAGATGTCGAAAAATGACTA
GCGGAATTACCGAAATCAGTTTTGAAGTCCGAGAGAAAAAGAAAAATAAA
GTCAATTTTAAGGTATTTGATGTCGGCGGCCAACAAGGAGAAAGGAAACG
ATGGATTCAACTGTTCGGCGAAGTCACTGCCATTTTATTTTTGGCAGATT
GTAGCAGTTTTGATCAGACTTTACGTGAAGATCGGTCAAAAAACCGACTA
ATTGATTCATTGGAGGTGTTTTATCAAGCCTGGATGAATAGGTATTTGCA
AAATGTTCCAATAATTGTATTTGTCAACAAGATCGATATGCTGGAATTAA
AAATCCAAAACGAGCACAGTATTGAATCAATGATCAATGAGATCACAAAT
TTGACGCCCCATAGCACAAAGAATTCAGCGAAACAGTTAAACAATCGCCG
ATCATCACTTAACATCAATCACAAAACCAACAATGACAATATGACCTCAT
GTAGCAAATGTGAGAATAGCCATCCTATCACCGACAATAACAAGTGTATC
CACCTCTGTCCAGAATCGAATTCAAATTCTAAAATTTGCGATCGAAAAAT
TAGCATCAGAACAATCCCCTCTTGTTCTTCAAGGAGATTTTCTAAGGATA
ATAATTTCGAATTTGTTGCTCAAACATTTTCGGAAAATCCCTGGGGAAAA
TATCAGCCATCTAACGAAGAATGTAAAGAATTTGTCAATTCATTTCCAGT
GGATCAAGTGGACTTACACTCTAGTGGAACGCATGCTGCGAAAAAGAAGT
CCAAAGACGTGCATAATATTCACCCCGATACTATTAAAACCGCCTGCTAT
ATCAAAAATATTTTCGCGCAAATTACTAGAAACCATCCAAAAAACTGTGA
TATGAAAATTAGCAACCGTAGAAAATGTTTATTCTATTACACGTGTGCCG
TAAATACAGATAATATTCAGAAAGTCTTGGATGGTTGCAGATCATTCCTT
ATGGAGCAACATTTAGAAAGATTTGGTATCTTATAAGAACTTAGAATGCG
TATGATTATTTGATTCGTGATGAATTACTAGTTATTTGAATTTGTTTGAC
TTAACTAATATTAATCAGCCTGTACACTTCACATGTTTTTAAATACATTT
TTC
back to top

protein sequence of SMED30017055-orf-1

>SMED30017055-orf-1 ID=SMED30017055-orf-1|Name=SMED30017055-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=519bp
MNTCISKVETDEQREKRVLLEENRRKNNQIEKELALYKNKKLSCLKLLLL
GTGESGKSTILKQMKIIHVNGFSKTEKIEFISNIKRNVRDAIMAIVVSMN
KLQITPKKFDLSEKIKFLQTAFSEQYTYPNTFFDVVSELWQDEDVQASFL
RSNEYQLIDSAKYFLDHIHIIRQNDYIPSLQDILRCRKMTSGITEISFEV
REKKKNKVNFKVFDVGGQQGERKRWIQLFGEVTAILFLADCSSFDQTLRE
DRSKNRLIDSLEVFYQAWMNRYLQNVPIIVFVNKIDMLELKIQNEHSIES
MINEITNLTPHSTKNSAKQLNNRRSSLNINHKTNNDNMTSCSKCENSHPI
TDNNKCIHLCPESNSNSKICDRKISIRTIPSCSSRRFSKDNNFEFVAQTF
SENPWGKYQPSNEECKEFVNSFPVDQVDLHSSGTHAAKKKSKDVHNIHPD
TIKTACYIKNIFAQITRNHPKNCDMKISNRRKCLFYYTCAVNTDNIQKVL
DGCRSFLMEQHLERFGIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR001019Gprotein_alpha_su
IPR027417P-loop_NTPase
IPR011025GproteinA_insert
Vocabulary: molecular function
TermDefinition
GO:0031683G-protein beta/gamma-subunit complex binding
GO:0004871signal transducer activity
GO:0003924GTPase activity
GO:0019001guanyl nucleotide binding
GO:0000166nucleotide binding
GO:0005525GTP binding
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 20..40
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 29..329
e-value: 3.4E-92
score: 311.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 420..518
e-value: 1.5E-9
score: 39.9
NoneNo IPR availablePANTHERPTHR10218:SF212GUANINE NUCLEOTIDE-BINDING PROTEIN G(F) SUBUNIT ALPHAcoord: 447..516
coord: 12..323
NoneNo IPR availablePROSITEPS51882G_ALPHAcoord: 43..377
score: 62.919
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitPRINTSPR00318GPROTEINAcoord: 46..61
score: 84.15
coord: 210..227
score: 61.95
coord: 176..198
score: 54.48
coord: 278..287
score: 55.42
coord: 232..260
score: 46.07
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitSMARTSM00275galpha_1coord: 24..517
e-value: 1.6E-89
score: 313.4
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitPFAMPF00503G-alphacoord: 25..338
e-value: 5.0E-72
score: 243.0
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitPANTHERPTHR10218GTP-BINDING PROTEIN ALPHA SUBUNITcoord: 447..516
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitPANTHERPTHR10218GTP-BINDING PROTEIN ALPHA SUBUNITcoord: 12..323
IPR001019Guanine nucleotide binding protein (G-protein), alpha subunitCDDcd00066G-alphacoord: 51..296
e-value: 2.04116E-96
score: 292.893
IPR011025G protein alpha subunit, helical insertionGENE3DG3DSA:1.10.400.10coord: 73..189
e-value: 3.4E-92
score: 311.0
IPR011025G protein alpha subunit, helical insertionSUPERFAMILYSSF47895Transducin (alpha subunit), insertion domaincoord: 72..190
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 44..307