SMED30017053

Overview
NameSMED30017053
Smed IDSMED30017053
Length (bp)3112
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30017053 (SMED30017053) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30017053 (SMED30017053) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30017053 (SMED30017053) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30017053 (SMED30017053) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017053

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30017053SMESG000004885.1 dd_Smed_v4_5297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30017053SMESG000004885.1 dd_Smed_v4_5297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30017053SMESG000004885.1 dd_Smed_v4_5297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017053SMESG000004885.1 dd_Smed_v4_5297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017053SMESG000004885.1 dd_Smed_v4_5297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30017053SMESG000004885.1 dd_Smed_v4_5297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30017053SMESG000004885.1 dd_Smed_v4_5297_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017053SMESG000004885.1 Contig29402newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017053SMESG000004885.1 Contig29402uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017053SMESG000004885.1 Contig29436newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017053SMESG000004885.1 Contig29436uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017053SMESG000004885.1 Contig39867newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017053SMESG000004885.1 Contig39867uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30017053SMESG000004885.1 dd_Smed_v6_5297_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017053SMESG000004885.1 dd_Smed_v6_5297_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017053SMESG000004885.1 dd_Smed_v4_5297_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30017053SMESG000004885.1 dd_Smed_v4_5297_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30017053 vs. TrEMBL
Match: A0A267F2Q6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013043g1 PE=4 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 9.356e-43
Identity = 234/833 (28.09%), Postives = 417/833 (50.06%), Query Frame = 3
Query:  582 SPRETLERKVVELDQLSSSVQKATIEHQQLCKELQVMQHQLRKNQAEVRLSERMALDNKEKVEFVHKELKSAESRRNQTLRHLDLVNEELALKRAKLKSFDLQMSREMASIRKLDQHGXXXXXXXXXLAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIENLEDELECSLKKIKQLQFEKDELEAQLEHLRQH---LCKAEDQACKSSREVSEL-------RDEYQNRIKKKLDDYETDXXXXXXXXXXXXXXXXXXXANLKSHIEKLKSEMVIIERERKD-----LRELVSELEEQLRKSVQSRCQILEEQEYKVRQIQNDKEEAMQKQRKDLLNEQKMLLDEKDLQFGHEKNK----IQKQCNEEIXXXXXXXXXXXXEISELYEQQREIESELNCQLQ------REKAKFEGLLQKEKVNLIESSNKKKQNEINKILSDCEAKNHSLNNHIEQLTLTLKDRENELSNLKQDICNIRMENQKTMNNSILATRKIKDNVKQDTIKELKTRYEEKMDKELIKVKSEYDKKLNSKMSVILKEKAAIEDSEKKSK--QLLCKVVKTVVHEINGECCKMALLLNVHPRKVDHSKISDNFSKS---------DNIITQALANLEACGSETRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHELEAEKLKDISEIRENLLKEHLREINRLAKSPDIGLENLLREKEKEISKLLANRQMWXXXXXXXXX----XXFNQINQKKINELRNMLLKKESEIRQLKAIRGRSNSPTRRDVRASSALALEKTDLNFSSFPSN-VISSLQDNLDNLRKENNQLRHKLI 2957
            +PRE+L+RKV ELD+L+  V+K   E +++  EL  +Q  LRK+QAEVRLSE+++ DNK + +    EL  AE RR+   + LD +NEEL  K+ +LK  +      M  ++ L+  GI +EEIE ILAERDELYQ++++ ED + E+YEL K+L   R+++ ++   A +++  LE+ELE SL KI +   +++ L+ +L  + +    L  + D   +++R ++         R E   R+K+++   +TD  +I+R  +  E         LK  +E  +SE+      RKD     LRE ++ LE +L    +++  ++ E E  +++   + E  ++  R+++  E +  L  +   +  E  K     Q++    I  +   +  KD+++S L E  +  E+E     Q      RE  +    ++ EK    + S+++ + E+  +  +      SL     + + T+   E  L  +  ++   R  ++    +   A  + +++ +++  +E+++  E+       +++ E ++  +++ ++        E   ++++   LL K+ + VV + N EC ++A +L V PRKV         S            N +T ALANLEACG E R    EL  + +   ++L  E    E +       L AEK  ++   RE L+ EH+ EI ++AK+ +  LE  ++EKE E+ +L AN + WK   AE+LA    E+F +   KKI +LRN +  K+ E++  +               A  A A  K        PS+ V++ LQ+ + +LR+EN  LR  L 
Sbjct:  360 TPRESLDRKVHELDELNFQVRKTLQEKEKILAELHYVQDCLRKHQAEVRLSEKLSKDNKSRADDTKTELMLAEMRRDSAAKELDGLNEELHQKKEQLKRMEESCRSRMKELQDLESIGIAREEIENILAERDELYQLIRQNEDAEFERYELEKKLTQTREEMQTQASMAQQKVIALEEELEASLTKIAETTEDRNTLKMRLSDMDEKMRVLGSSLDDLTEANRRLARAKELAEKERAEEVERLKQRM---QTDLAQIQRRTEDEELAFKRQIQQLKESLEGAQSELT-----RKDEINCALREQIAHLEHELGHEAETKTHLISETERHLQKTGAEAERRLEAVRQEMRKEAEERLKRERATWQAEAAKEARTAQEKLQRTISELEFQLSSKDEDLSSLQEALKSKEAEAKAAEQDFRTELRE--RLRATVRSEKEKWEKESSERWRRELGALKEETSRTIESLQAESAKKSETIASLEAALERVSGELEAERESSKAAQRDRQTAVSRARESAREEAAREVRSVREQCESAAQEELQRERERARSAEAALSAARAELGESGRREAELAGLLEKLERAVVGQANAECARIAQVLGVTPRKVAAGSYRQQPSAEQPASPKEHRTNPVTAALANLEACGEELRTYTSELLEQSQKHRDRLAQEVKAREDDAAR----LGAEKTAELQAQRERLIGEHMAEIAKMAKAQNESLETSVKEKEAEVRELRANMKKWKSDTAERLAVRLQEEFRREFDKKIRDLRNAVRSKDQELQSYRK-------------EADPAQARPKNFEASGGDPSSAVVAQLQERVRSLREENLGLRKTLF 1165          
BLAST of SMED30017053 vs. TrEMBL
Match: A0A267GKW5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013043g2 PE=4 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 9.520e-43
Identity = 234/833 (28.09%), Postives = 417/833 (50.06%), Query Frame = 3
Query:  582 SPRETLERKVVELDQLSSSVQKATIEHQQLCKELQVMQHQLRKNQAEVRLSERMALDNKEKVEFVHKELKSAESRRNQTLRHLDLVNEELALKRAKLKSFDLQMSREMASIRKLDQHGXXXXXXXXXLAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIENLEDELECSLKKIKQLQFEKDELEAQLEHLRQH---LCKAEDQACKSSREVSEL-------RDEYQNRIKKKLDDYETDXXXXXXXXXXXXXXXXXXXANLKSHIEKLKSEMVIIERERKD-----LRELVSELEEQLRKSVQSRCQILEEQEYKVRQIQNDKEEAMQKQRKDLLNEQKMLLDEKDLQFGHEKNK----IQKQCNEEIXXXXXXXXXXXXEISELYEQQREIESELNCQLQ------REKAKFEGLLQKEKVNLIESSNKKKQNEINKILSDCEAKNHSLNNHIEQLTLTLKDRENELSNLKQDICNIRMENQKTMNNSILATRKIKDNVKQDTIKELKTRYEEKMDKELIKVKSEYDKKLNSKMSVILKEKAAIEDSEKKSK--QLLCKVVKTVVHEINGECCKMALLLNVHPRKVDHSKISDNFSKS---------DNIITQALANLEACGSETRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHELEAEKLKDISEIRENLLKEHLREINRLAKSPDIGLENLLREKEKEISKLLANRQMWXXXXXXXXX----XXFNQINQKKINELRNMLLKKESEIRQLKAIRGRSNSPTRRDVRASSALALEKTDLNFSSFPSN-VISSLQDNLDNLRKENNQLRHKLI 2957
            +PRE+L+RKV ELD+L+  V+K   E +++  EL  +Q  LRK+QAEVRLSE+++ DNK + +    EL  AE RR+   + LD +NEEL  K+ +LK  +      M  ++ L+  GI +EEIE ILAERDELYQ++++ ED + E+YEL K+L   R+++ ++   A +++  LE+ELE SL KI +   +++ L+ +L  + +    L  + D   +++R ++         R E   R+K+++   +TD  +I+R  +  E         LK  +E  +SE+      RKD     LRE ++ LE +L    +++  ++ E E  +++   + E  +   R+++  E +  L  +   +  E  K    +Q++    I  +   +  KD+++S L E  +  E+E     Q      RE  +    ++ EK    + S+++ + E+  +  +      SL     + + T+   E  L  +  ++   R  ++    +   A  + +++ +++  +E+++  E+       +++ E ++  +++ ++        E   ++++   LL K+ + VV + N EC ++A +L V PRKV         S            N +T ALANLEACG E R    EL  + +   ++L  E    E +       L AEK  ++   RE L+ EH+ EI ++AK+ +  LE  ++EKE E+ +L AN + WK   AE+LA    E+F +   KKI +LRN +  K+ E++  +               A  A A  K        PS+ V++ LQ+ + +LR+EN  LR  L 
Sbjct:  360 TPRESLDRKVHELDELNFQVRKTLQEKEKILAELHYVQDCLRKHQAEVRLSEKLSKDNKSRADDTKTELMLAEMRRDSAAKELDGLNEELHQKKEQLKRMEESCRSRMKELQDLESIGIAREEIENILAERDELYQLIRQNEDAEFERYELEKKLTQTREEMQTQASMAQQKVIALEEELEASLTKIAETTEDRNTLKMRLSDMDEKMRVLGSSLDDLTEANRRLARAKELAEKERAEEVERLKQRM---QTDLAQIQRRTEDEELAFKRQIQQLKESLEGAQSELT-----RKDEINCALREQIAHLEHELGHEAETKTHLISETERHLQKTGAEAERRLDAVRQEMRKEAEERLARERATWQAEAAKEARTMQEKLQRTISELEFQLSSKDEDLSSLQEALKSKEAEAKAAEQDFRTELRE--RLRATVRSEKEKWEKESSERWRRELGALKEETSRTIESLQAESAKKSETIASLEAALERVSGELEAERESSKAAQRDRQTAVSRARESAREEAAREVRSVREQCESAAQEELQRERERARSAEAALSAARAELGESGRREAELAGLLEKLERAVVGQANAECARIAQVLGVTPRKVAAGSYRQQPSAEQPVSPKEHRTNPVTAALANLEACGEELRTYTSELLEQSQKHRDRLAQEVKAREDDAAR----LGAEKTAELQAQRERLIGEHMAEIAKMAKAQNESLETSVKEKEAEVRELRANMKKWKSDTAERLAVRLQEEFRREFDKKIRDLRNAVRSKDQELQSYRK-------------EADPAQARPKNFEASGGDPSSAVVAQLQERVRSLREENLGLRKTLF 1165          
BLAST of SMED30017053 vs. TrEMBL
Match: A0A267F1P4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001939g1 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.119e-19
Identity = 79/206 (38.35%), Postives = 132/206 (64.08%), Query Frame = 3
Query:  588 RETLERKVVELDQLSSSVQKATIEHQQLCKELQVMQHQLRKNQAEVRLSERMALDNKEKVEFVHKELKSAESRRNQTLRHLDLVNEELALKRAKLKSFDLQMSREMASIRKLDQHGXXXXXXXXXLAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIENLEDELECSLKKIKQLQFEKDELEAQLEHLRQHL 1205
            +ETL+RKV+ELD+L+  V+K   E +++  EL  +Q  LR++QAEVRLSE++  DNK   E    EL  A+++R+ T + ++ + EEL  K+ +L+  +         ++  +  G+ KEEIE ILAERDELYQ+V++ ED + ++YEL K+L+  R+++ ++   + +++  LE+ELE SL KI +   E++ L+ +L  L   L
Sbjct:  331 KETLDRKVLELDELNQQVRKTLQEKEKIVGELHYVQDCLRRHQAEVRLSEKLCKDNKSLAEDTKTELMLAQTKRDSTAKEVEQLGEELNQKKEQLRRMEESCRARAKELQDFESIGVAKEEIENILAERDELYQLVRQNEDAEFQRYELEKKLNQTREEMQAQAYMSQQKVIALEEELEASLMKIAETSEERNSLKLRLGDLEDRL 536          
BLAST of SMED30017053 vs. TrEMBL
Match: A0A267H479 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030482g1 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 4.666e-19
Identity = 78/202 (38.61%), Postives = 130/202 (64.36%), Query Frame = 3
Query:  588 RETLERKVVELDQLSSSVQKATIEHQQLCKELQVMQHQLRKNQAEVRLSERMALDNKEKVEFVHKELKSAESRRNQTLRHLDLVNEELALKRAKLKSFDLQMSREMASIRKLDQHGXXXXXXXXXLAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIENLEDELECSLKKIKQLQFEKDELEAQLEHL 1193
            +ETL+RKV+ELD+L+  V+K   E +++  EL  +Q  LR++QAEVRLSE++  DNK   E    EL  A+ +R+ T + ++ + EEL  K+ +L+  +         ++  +  G+ KEEIE ILAERDELYQ+V++ ED + ++YEL K+L+  R+++ ++   + +++  LE+ELE SL KI +   E++ L+ +L  L
Sbjct:  364 KETLDRKVLELDELNQQVRKTLQEKEKIVGELHYVQDCLRRHQAEVRLSEKLCKDNKSLAEDTKTELMLAQMKRDSTAKEVEQLGEELNQKKEQLRRMEESCRARAKELQDFESIGVAKEEIENILAERDELYQLVRQNEDAEFQRYELEKKLNQTREEMQAQAYMSQQKVIALEEELEASLMKIAETSEERNSLKLRLGDL 565          
BLAST of SMED30017053 vs. TrEMBL
Match: A0A1I8IR99 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.227e-16
Identity = 112/412 (27.18%), Postives = 203/412 (49.27%), Query Frame = 3
Query: 1797 LQKEKVNLIESSNKKKQNEINKILSDCEAKNHSLNNHIEQLTLTLKDRENELSNLKQDICNIRMENQKTMNNSILATRKIKDNVKQDTIKELKTRYEEKMDKELIKVKSEYDKKLNSKMSVILKEKAAIEDSEKK---SKQLLCKVVKTVVHEINGECCKMALLLNVHPRKVDHSKISDN-----FSKSDNIITQALANLEACGSETRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHELEAEKLKDISEIRENLLKEHLREINRLAKSPDIGLENLLREKEKEISKLLANRQMWXXXXXXXXXXX----FNQINQKKINELRNMLLKKESEIRQLKAIRGRSNSPTRRDVRASSALAL-EKTDLNFSSFPSNVISSLQDNLDNLRKENNQLRHKLIGFESNDRKSKIE 2993
            L+ EK      ++++ Q E+  + S+      SL N  ++    +K+ E EL  L  ++   R + +    + + A  ++K+  K++  KE++    E+++        +  ++L      + + +A  E++ K+   S   L +  + +V++ N EC +++ +L V PR+V+  +   +      S   + IT ALANLEAC  E      EL  + + L   L  E      EI ++RHEL  EK  ++  +RE L++EH++EI++LAK+    +E  ++EKE E+ +L +  Q WK + AE+LA +    F +   KKI ELRN +  K+ E++  K      +  T    RA +   L E   L+ S   +  ++ LQ+ +  LR+EN  LR + +      R   I+
Sbjct:  243 LRTEKEKWDRDNSERWQRELGSVRSEAARTIESLQNESKKRGDAVKELEEELHKLASELEREREKYRAAQRDRVTAINRLKEVAKEEAAKEVRA-VREQVEAAAAGEVEQAQERLRYAEETLAELRAEFEETAKREAESTAALERTERALVNQANAECLRISEMLGVTPRRVNQGQSGGDQSHRSLSSPGHPITAALANLEACSEELLTYCAELRDESRKLQNSLAQESKERSEEIESLRHELTKEKEAELQALRERLIQEHMQEISKLAKAQGESVEAAVKEKEAEVRELRSGMQKWKSETAERLAARLQDEFRREFDKKIRELRNAVRSKDQELQNFK-----KDIETMEQERAGAFKPLAEGGSLDAS---AKAMAQLQERVKALREENLSLRRQAMQGPGGGRVPTIQ 645          
BLAST of SMED30017053 vs. Planmine SMEST
Match: SMESG000004885.1 (SMESG000004885.1)

HSP 1 Score: 1394.41 bits (3608), Expect = 0.000e+0
Identity = 809/812 (99.63%), Postives = 811/812 (99.88%), Query Frame = 3
Query:  567 FMTQLSPRETLERKVVELDQLSSSVQKATIEHQQLCKELQVMQHQLRKNQAEVRLSERMALDNKEKVEFVHKELKSAESRRNQTLRHLDLVNEELALKRAKLKSFDLQMSREMASIRKLDQHGXXXXXXXXXLAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIENLEDELECSLKKIKQLQFEKDELEAQLEHLRQHLCKAEDQACKSSREVSELRDEYQNRIKKKLDDYETDXXXXXXXXXXXXXXXXXXXANLKSHIEKLKSEMVIIERERKDLRELVSELEEQLRKSVQSRCQILEEQEYKVRQIQNDKEEAMQKQRKDLLNEQKMLLDEKDLQFGHEKNKIQKQCNEEIXXXXXXXXXXXXEISELYEQQREIESELNCQLQREKAKFEGLLQKEKVNLIESSNKKKQNEINKILSDCEAKNHSLNNHIEQLTLTLKDRENELSNLKQDICNIRMENQKTMNNSILATRKIKDNVKQDTIKELKTRYEEKMDKELIKVKSEYDKKLNSKMSVILKEKAAIEDSEKKSKQLLCKVVKTVVHEINGECCKMALLLNVHPRKVDHSKISDNFSKSDNIITQALANLEACGSETRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHELEAEKLKDISEIRENLLKEHLREINRLAKSPDIGLENLLREKEKEISKLLANRQMWXXXXXXXXXXXFNQINQKKINELRNMLLKKESEIRQLKAIRGRSNSPTRRDVRASSALALEKTDLNFSSFPSNVISSLQDNLDNLRKENNQLRHKLIGFESNDRKSKIEKEL 3002
            FMTQLSPRETLERKVVELDQLSSSVQKATIEHQQLCKELQVMQHQLRKNQAEVRLSERMALDNKEKVEFVHKELKSAESRRNQTLRHLDLVNEELALKRAKLKSFDLQMSREMA+IRKLDQHGIEKEEIEKILAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIENLEDELECSLKKIKQLQFEKDELEAQLEHLRQHLCKAEDQACKSSREVSELRDEYQNRIKKKLDDYETDKERIERELKKLEDEKSSDEANLKSHIEKLKSEMVIIERERKDLRELVSELEEQLRKSVQSRCQILEEQEYKVRQIQNDKEEA+QKQRKDLLNEQKMLLDEKDLQ GHEKNKIQKQCNEEIDRMMRDMQMKDKEISELYEQQREIESELNCQLQREKAKFEGLLQKEKVNLIESSNKKKQNEINKILSDCEAKNHSLNNHIEQLTLTLKDRENELSNLKQDICNIRMENQKTMNNSILATRKIKDNVKQDTIKELKTRYEEKMDKELIKVKSEYDKKLNSKMSVILKEKAAIEDSEKKSKQLLCKVVKTVVHEINGECCKMALLLNVHPRKVDHSKISDNFSKSDNIITQALANLEACGSETRNLLEELESKVKSLTEKLNNEEINLETEIRNIRHELEAEKLKDISEIRENLLKEHLREINRLAKSPDIGLENLLREKEKEISKLLANRQMWKEKAAEKLAEKFNQINQKKINELRNMLLKKESEIRQLKAIRGRSNSPTRRDVRASSALALEKTDLNFSSFPSNVISSLQDNLDNLRKENNQLRHKLIGFESNDRKSKIEKEL
Sbjct:   22 FMTQLSPRETLERKVVELDQLSSSVQKATIEHQQLCKELQVMQHQLRKNQAEVRLSERMALDNKEKVEFVHKELKSAESRRNQTLRHLDLVNEELALKRAKLKSFDLQMSREMANIRKLDQHGIEKEEIEKILAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIENLEDELECSLKKIKQLQFEKDELEAQLEHLRQHLCKAEDQACKSSREVSELRDEYQNRIKKKLDDYETDKERIERELKKLEDEKSSDEANLKSHIEKLKSEMVIIERERKDLRELVSELEEQLRKSVQSRCQILEEQEYKVRQIQNDKEEALQKQRKDLLNEQKMLLDEKDLQLGHEKNKIQKQCNEEIDRMMRDMQMKDKEISELYEQQREIESELNCQLQREKAKFEGLLQKEKVNLIESSNKKKQNEINKILSDCEAKNHSLNNHIEQLTLTLKDRENELSNLKQDICNIRMENQKTMNNSILATRKIKDNVKQDTIKELKTRYEEKMDKELIKVKSEYDKKLNSKMSVILKEKAAIEDSEKKSKQLLCKVVKTVVHEINGECCKMALLLNVHPRKVDHSKISDNFSKSDNIITQALANLEACGSETRNLLEELESKVKSLTEKLNNEEINLETEIRNIRHELEAEKLKDISEIRENLLKEHLREINRLAKSPDIGLENLLREKEKEISKLLANRQMWKEKAAEKLAEKFNQINQKKINELRNMLLKKESEIRQLKAIRGRSNSPTRRDVRASSALALEKTDLNFSSFPSNVISSLQDNLDNLRKENNQLRHKLIGFESNDRKSKIEKEL 833          
BLAST of SMED30017053 vs. Planmine SMEST
Match: SMESG000004885.1 (SMESG000004885.1)

HSP 1 Score: 1393.25 bits (3605), Expect = 0.000e+0
Identity = 809/812 (99.63%), Postives = 811/812 (99.88%), Query Frame = 3
Query:  567 FMTQLSPRETLERKVVELDQLSSSVQKATIEHQQLCKELQVMQHQLRKNQAEVRLSERMALDNKEKVEFVHKELKSAESRRNQTLRHLDLVNEELALKRAKLKSFDLQMSREMASIRKLDQHGXXXXXXXXXLAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIENLEDELECSLKKIKQLQFEKDELEAQLEHLRQHLCKAEDQACKSSREVSELRDEYQNRIKKKLDDYETDXXXXXXXXXXXXXXXXXXXANLKSHIEKLKSEMVIIERERKDLRELVSELEEQLRKSVQSRCQILEEQEYKVRQIQNDKEEAMQKQRKDLLNEQKMLLDEKDLQFGHEKNKIQKQCNEEIXXXXXXXXXXXXEISELYEQQREIESELNCQLQREKAKFEGLLQKEKVNLIESSNKKKQNEINKILSDCEAKNHSLNNHIEQLTLTLKDRENELSNLKQDICNIRMENQKTMNNSILATRKIKDNVKQDTIKELKTRYEEKMDKELIKVKSEYDKKLNSKMSVILKEKAAIEDSEKKSKQLLCKVVKTVVHEINGECCKMALLLNVHPRKVDHSKISDNFSKSDNIITQALANLEACGSETRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHELEAEKLKDISEIRENLLKEHLREINRLAKSPDIGLENLLREKEKEISKLLANRQMWXXXXXXXXXXXFNQINQKKINELRNMLLKKESEIRQLKAIRGRSNSPTRRDVRASSALALEKTDLNFSSFPSNVISSLQDNLDNLRKENNQLRHKLIGFESNDRKSKIEKEL 3002
            FMTQLSPRETLERKVVELDQLSSSVQKATIEHQQLCKELQVMQHQLRKNQAEVRLSERMALDNKEKVEFVHKELKSAESRRNQTLRHLDLVNEELALKRAKLKSFDLQMSREMA+IRKLDQHGIEKEEIEKILAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIENLEDELECSLKKIKQLQFEKDELEAQLEHLRQHLCKAEDQACKSSREVSELRDEYQNRIKKKLDDYETDKERIERELKKLEDEKSSDEANLKSHIEKLKSEMVIIERERKDLRELVSELEEQLRKSVQSRCQILEEQEYKVRQIQNDKEEA+QKQRKDLLNEQKMLLDEKDLQ GHEKNKIQKQCNEEIDRMMRDMQMKDKEISELYEQQREIESELNCQLQREKAKFEGLLQKEKVNLIESSNKKKQNEINKILSDCEAKNHSLNNHIEQLTLTLKDRENELSNLKQDICNIRMENQKTMNNSILATRKIKDNVKQDTIKELKTRYEEKMDKELIKVKSEYDKKLNSKMSVILKEKAAIEDSEKKSKQLLCKVVKTVVHEINGECCKMALLLNVHPRKVDHSKISDNFSKSDNIITQALANLEACGSETRNLLEELESKVKSLTEKLNNEEINLETEIRNIRHELEAEKLKDISEIRENLLKEHLREINRLAKSPDIGLENLLREKEKEISKLLANRQMWKEKAAEKLAEKFNQINQKKINELRNMLLKKESEIRQLKAIRGRSNSPTRRDVRASSALALEKTDLNFSSFPSNVISSLQDNLDNLRKENNQLRHKLIGFESNDRKSKIEKEL
Sbjct:   94 FMTQLSPRETLERKVVELDQLSSSVQKATIEHQQLCKELQVMQHQLRKNQAEVRLSERMALDNKEKVEFVHKELKSAESRRNQTLRHLDLVNEELALKRAKLKSFDLQMSREMANIRKLDQHGIEKEEIEKILAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIENLEDELECSLKKIKQLQFEKDELEAQLEHLRQHLCKAEDQACKSSREVSELRDEYQNRIKKKLDDYETDKERIERELKKLEDEKSSDEANLKSHIEKLKSEMVIIERERKDLRELVSELEEQLRKSVQSRCQILEEQEYKVRQIQNDKEEALQKQRKDLLNEQKMLLDEKDLQLGHEKNKIQKQCNEEIDRMMRDMQMKDKEISELYEQQREIESELNCQLQREKAKFEGLLQKEKVNLIESSNKKKQNEINKILSDCEAKNHSLNNHIEQLTLTLKDRENELSNLKQDICNIRMENQKTMNNSILATRKIKDNVKQDTIKELKTRYEEKMDKELIKVKSEYDKKLNSKMSVILKEKAAIEDSEKKSKQLLCKVVKTVVHEINGECCKMALLLNVHPRKVDHSKISDNFSKSDNIITQALANLEACGSETRNLLEELESKVKSLTEKLNNEEINLETEIRNIRHELEAEKLKDISEIRENLLKEHLREINRLAKSPDIGLENLLREKEKEISKLLANRQMWKEKAAEKLAEKFNQINQKKINELRNMLLKKESEIRQLKAIRGRSNSPTRRDVRASSALALEKTDLNFSSFPSNVISSLQDNLDNLRKENNQLRHKLIGFESNDRKSKIEKEL 905          

HSP 2 Score: 167.933 bits (424), Expect = 3.088e-42
Identity = 75/76 (98.68%), Postives = 76/76 (100.00%), Query Frame = 3
Query:   54 MSYTESILTEDYANKFNECMLTSPSKSRLHLQSYKSDIDQDSVFTEDIETKIRNQRDSFKYSNPNINSGDFDILRD 281
            MSYTESILTEDYANKFNECMLTSPSKSRLHLQSYKSDIDQDSVFTEDIETKIRNQRDSFKYSNPNINSGDFDILR+
Sbjct:    1 MSYTESILTEDYANKFNECMLTSPSKSRLHLQSYKSDIDQDSVFTEDIETKIRNQRDSFKYSNPNINSGDFDILRE 76          
BLAST of SMED30017053 vs. Planmine SMEST
Match: SMESG000004885.1 (SMESG000004885.1)

HSP 1 Score: 1392.1 bits (3602), Expect = 0.000e+0
Identity = 809/812 (99.63%), Postives = 811/812 (99.88%), Query Frame = 3
Query:  567 FMTQLSPRETLERKVVELDQLSSSVQKATIEHQQLCKELQVMQHQLRKNQAEVRLSERMALDNKEKVEFVHKELKSAESRRNQTLRHLDLVNEELALKRAKLKSFDLQMSREMASIRKLDQHGXXXXXXXXXLAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIENLEDELECSLKKIKQLQFEKDELEAQLEHLRQHLCKAEDQACKSSREVSELRDEYQNRIKKKLDDYETDXXXXXXXXXXXXXXXXXXXANLKSHIEKLKSEMVIIERERKDLRELVSELEEQLRKSVQSRCQILEEQEYKVRQIQNDKEEAMQKQRKDLLNEQKMLLDEKDLQFGHEKNKIQKQCNEEIXXXXXXXXXXXXEISELYEQQREIESELNCQLQREKAKFEGLLQKEKVNLIESSNKKKQNEINKILSDCEAKNHSLNNHIEQLTLTLKDRENELSNLKQDICNIRMENQKTMNNSILATRKIKDNVKQDTIKELKTRYEEKMDKELIKVKSEYDKKLNSKMSVILKEKAAIEDSEKKSKQLLCKVVKTVVHEINGECCKMALLLNVHPRKVDHSKISDNFSKSDNIITQALANLEACGSETRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHELEAEKLKDISEIRENLLKEHLREINRLAKSPDIGLENLLREKEKEISKLLANRQMWXXXXXXXXXXXFNQINQKKINELRNMLLKKESEIRQLKAIRGRSNSPTRRDVRASSALALEKTDLNFSSFPSNVISSLQDNLDNLRKENNQLRHKLIGFESNDRKSKIEKEL 3002
            FMTQLSPRETLERKVVELDQLSSSVQKATIEHQQLCKELQVMQHQLRKNQAEVRLSERMALDNKEKVEFVHKELKSAESRRNQTLRHLDLVNEELALKRAKLKSFDLQMSREMA+IRKLDQHGIEKEEIEKILAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIENLEDELECSLKKIKQLQFEKDELEAQLEHLRQHLCKAEDQACKSSREVSELRDEYQNRIKKKLDDYETDKERIERELKKLEDEKSSDEANLKSHIEKLKSEMVIIERERKDLRELVSELEEQLRKSVQSRCQILEEQEYKVRQIQNDKEEA+QKQRKDLLNEQKMLLDEKDLQ GHEKNKIQKQCNEEIDRMMRDMQMKDKEISELYEQQREIESELNCQLQREKAKFEGLLQKEKVNLIESSNKKKQNEINKILSDCEAKNHSLNNHIEQLTLTLKDRENELSNLKQDICNIRMENQKTMNNSILATRKIKDNVKQDTIKELKTRYEEKMDKELIKVKSEYDKKLNSKMSVILKEKAAIEDSEKKSKQLLCKVVKTVVHEINGECCKMALLLNVHPRKVDHSKISDNFSKSDNIITQALANLEACGSETRNLLEELESKVKSLTEKLNNEEINLETEIRNIRHELEAEKLKDISEIRENLLKEHLREINRLAKSPDIGLENLLREKEKEISKLLANRQMWKEKAAEKLAEKFNQINQKKINELRNMLLKKESEIRQLKAIRGRSNSPTRRDVRASSALALEKTDLNFSSFPSNVISSLQDNLDNLRKENNQLRHKLIGFESNDRKSKIEKEL
Sbjct:  125 FMTQLSPRETLERKVVELDQLSSSVQKATIEHQQLCKELQVMQHQLRKNQAEVRLSERMALDNKEKVEFVHKELKSAESRRNQTLRHLDLVNEELALKRAKLKSFDLQMSREMANIRKLDQHGIEKEEIEKILAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIENLEDELECSLKKIKQLQFEKDELEAQLEHLRQHLCKAEDQACKSSREVSELRDEYQNRIKKKLDDYETDKERIERELKKLEDEKSSDEANLKSHIEKLKSEMVIIERERKDLRELVSELEEQLRKSVQSRCQILEEQEYKVRQIQNDKEEALQKQRKDLLNEQKMLLDEKDLQLGHEKNKIQKQCNEEIDRMMRDMQMKDKEISELYEQQREIESELNCQLQREKAKFEGLLQKEKVNLIESSNKKKQNEINKILSDCEAKNHSLNNHIEQLTLTLKDRENELSNLKQDICNIRMENQKTMNNSILATRKIKDNVKQDTIKELKTRYEEKMDKELIKVKSEYDKKLNSKMSVILKEKAAIEDSEKKSKQLLCKVVKTVVHEINGECCKMALLLNVHPRKVDHSKISDNFSKSDNIITQALANLEACGSETRNLLEELESKVKSLTEKLNNEEINLETEIRNIRHELEAEKLKDISEIRENLLKEHLREINRLAKSPDIGLENLLREKEKEISKLLANRQMWKEKAAEKLAEKFNQINQKKINELRNMLLKKESEIRQLKAIRGRSNSPTRRDVRASSALALEKTDLNFSSFPSNVISSLQDNLDNLRKENNQLRHKLIGFESNDRKSKIEKEL 936          
BLAST of SMED30017053 vs. Planmine SMEST
Match: SMESG000004885.1 (SMESG000004885.1)

HSP 1 Score: 1373.61 bits (3554), Expect = 0.000e+0
Identity = 801/804 (99.63%), Postives = 803/804 (99.88%), Query Frame = 3
Query:  591 ETLERKVVELDQLSSSVQKATIEHQQLCKELQVMQHQLRKNQAEVRLSERMALDNKEKVEFVHKELKSAESRRNQTLRHLDLVNEELALKRAKLKSFDLQMSREMASIRKLDQHGXXXXXXXXXLAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIENLEDELECSLKKIKQLQFEKDELEAQLEHLRQHLCKAEDQACKSSREVSELRDEYQNRIKKKLDDYETDXXXXXXXXXXXXXXXXXXXANLKSHIEKLKSEMVIIERERKDLRELVSELEEQLRKSVQSRCQILEEQEYKVRQIQNDKEEAMQKQRKDLLNEQKMLLDEKDLQFGHEKNKIQKQCNEEIXXXXXXXXXXXXEISELYEQQREIESELNCQLQREKAKFEGLLQKEKVNLIESSNKKKQNEINKILSDCEAKNHSLNNHIEQLTLTLKDRENELSNLKQDICNIRMENQKTMNNSILATRKIKDNVKQDTIKELKTRYEEKMDKELIKVKSEYDKKLNSKMSVILKEKAAIEDSEKKSKQLLCKVVKTVVHEINGECCKMALLLNVHPRKVDHSKISDNFSKSDNIITQALANLEACGSETRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHELEAEKLKDISEIRENLLKEHLREINRLAKSPDIGLENLLREKEKEISKLLANRQMWXXXXXXXXXXXFNQINQKKINELRNMLLKKESEIRQLKAIRGRSNSPTRRDVRASSALALEKTDLNFSSFPSNVISSLQDNLDNLRKENNQLRHKLIGFESNDRKSKIEKEL 3002
            ETLERKVVELDQLSSSVQKATIEHQQLCKELQVMQHQLRKNQAEVRLSERMALDNKEKVEFVHKELKSAESRRNQTLRHLDLVNEELALKRAKLKSFDLQMSREMA+IRKLDQHGIEKEEIEKILAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIENLEDELECSLKKIKQLQFEKDELEAQLEHLRQHLCKAEDQACKSSREVSELRDEYQNRIKKKLDDYETDKERIERELKKLEDEKSSDEANLKSHIEKLKSEMVIIERERKDLRELVSELEEQLRKSVQSRCQILEEQEYKVRQIQNDKEEA+QKQRKDLLNEQKMLLDEKDLQ GHEKNKIQKQCNEEIDRMMRDMQMKDKEISELYEQQREIESELNCQLQREKAKFEGLLQKEKVNLIESSNKKKQNEINKILSDCEAKNHSLNNHIEQLTLTLKDRENELSNLKQDICNIRMENQKTMNNSILATRKIKDNVKQDTIKELKTRYEEKMDKELIKVKSEYDKKLNSKMSVILKEKAAIEDSEKKSKQLLCKVVKTVVHEINGECCKMALLLNVHPRKVDHSKISDNFSKSDNIITQALANLEACGSETRNLLEELESKVKSLTEKLNNEEINLETEIRNIRHELEAEKLKDISEIRENLLKEHLREINRLAKSPDIGLENLLREKEKEISKLLANRQMWKEKAAEKLAEKFNQINQKKINELRNMLLKKESEIRQLKAIRGRSNSPTRRDVRASSALALEKTDLNFSSFPSNVISSLQDNLDNLRKENNQLRHKLIGFESNDRKSKIEKEL
Sbjct:   92 ETLERKVVELDQLSSSVQKATIEHQQLCKELQVMQHQLRKNQAEVRLSERMALDNKEKVEFVHKELKSAESRRNQTLRHLDLVNEELALKRAKLKSFDLQMSREMANIRKLDQHGIEKEEIEKILAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIENLEDELECSLKKIKQLQFEKDELEAQLEHLRQHLCKAEDQACKSSREVSELRDEYQNRIKKKLDDYETDKERIERELKKLEDEKSSDEANLKSHIEKLKSEMVIIERERKDLRELVSELEEQLRKSVQSRCQILEEQEYKVRQIQNDKEEALQKQRKDLLNEQKMLLDEKDLQLGHEKNKIQKQCNEEIDRMMRDMQMKDKEISELYEQQREIESELNCQLQREKAKFEGLLQKEKVNLIESSNKKKQNEINKILSDCEAKNHSLNNHIEQLTLTLKDRENELSNLKQDICNIRMENQKTMNNSILATRKIKDNVKQDTIKELKTRYEEKMDKELIKVKSEYDKKLNSKMSVILKEKAAIEDSEKKSKQLLCKVVKTVVHEINGECCKMALLLNVHPRKVDHSKISDNFSKSDNIITQALANLEACGSETRNLLEELESKVKSLTEKLNNEEINLETEIRNIRHELEAEKLKDISEIRENLLKEHLREINRLAKSPDIGLENLLREKEKEISKLLANRQMWKEKAAEKLAEKFNQINQKKINELRNMLLKKESEIRQLKAIRGRSNSPTRRDVRASSALALEKTDLNFSSFPSNVISSLQDNLDNLRKENNQLRHKLIGFESNDRKSKIEKEL 895          

HSP 2 Score: 204.142 bits (518), Expect = 6.378e-54
Identity = 95/101 (94.06%), Postives = 97/101 (96.04%), Query Frame = 3
Query:   54 MSYTESILTEDYANKFNECMLTSPSKSRLHLQSYKSDIDQDSVFTEDIETKIRNQRDSFKYSNPNINSGDFDILRDNQIKPLEFEDKDAFN--VERKYQEI 350
            MSYTESILTEDYANKFNECMLTSPSKSRLHLQSYKSDIDQDSVFTEDIETKIRNQRDSFKYSNPNINSGDFDILRDNQIKPLEFEDKDAFN  +ERK  E+
Sbjct:    1 MSYTESILTEDYANKFNECMLTSPSKSRLHLQSYKSDIDQDSVFTEDIETKIRNQRDSFKYSNPNINSGDFDILRDNQIKPLEFEDKDAFNETLERKVVEL 101          
BLAST of SMED30017053 vs. Planmine SMEST
Match: SMESG000013596.1 (SMESG000013596.1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.652e-19
Identity = 127/466 (27.25%), Postives = 239/466 (51.29%), Query Frame = 3
Query:   54 MSYT---ESILTEDYANKFNECMLTSPS------------KSRLHLQSYKSDIDQDSVFTEDIETKIRNQRDSFKYSNPNIN----------SGDFDILRDNQIKPL------EFEDKDAFNVERKYQEILKKRRNRTANLIQPYQNPVS---------QFQENYRHQDDQSTVYE-----DYSMEIRNKKNEIQMDXXXXXXXXXXXXXXXXXXXFMTQLSPRETLERKVVELDQLSSSVQKATIEHQQLCKELQVMQHQLRKNQAEVRLSERM--ALDNKEKVEFVHKELKSAESRRNQT-LRHLDLVNEELALKRAKLKSFDLQMSREMASIRKLDQHGXXXXXXXXXLAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIENLEDELECSLKKIKQLQFEKDELEAQLEHLRQHLCKAEDQACKSSREVSELRDEYQ--NRIKKKLDDY 1301
            M +T   ESILTED+A+KF E +LT  S            K +L+ QS+    D +SV T+  +  ++N  +     NPN +          S + D+   + ++P+      +F  K AF+  + + E     R       +PY+N ++         Q+  N++ +D+Q  + E     D + EI+ K   IQ ++  ER+R   S  E      +  ++PRE LE KV ELD L+  +++A  + +++  EL  ++++L+    E+  ++       N +++   H  + + + +  Q+ L HL   N +L  K+++L+  +  + + +  I  L+  G+ K+EI++++ ER++LY+I++  E+  N++YEL KQL   ++DL +E +R+  +I NLE+EL+   KKI +LQ +K++   +L   + ++ + +D          ++ D YQ  N +K +LD Y
Sbjct:    1 MDFTSDCESILTEDFASKFKE-ILTEDSRVFTDKSKLQSIKPQLNKQSFYRIQDIESVTTDVYDDHLQNIFNGTNKCNPNSDRSFPAESCNTSINVDMGNISNVQPMRRDIMNKFLAKYAFDENQIFNEKGTGER-------KPYENNITYPKESSKNIQYNSNFKLKDEQRKLKENAMRIDLANEIKAKSLRIQNEIHEERKRKLESIQEKV---ILNDVTPREKLELKVRELDHLTDRMRQARSDRERITAELDDLKNKLKVRPIEIHKNKTWTDGSKNMDEIRAFHNYVPNNKIQATQSQLSHL---NCQLNEKKSQLRDLENVIRQRLKEIEDLECIGLSKQEIKQVIEERNDLYEILRLSEEHGNDRYELEKQLTEAKEDLSTEYKRSREKIMNLEEELDICFKKITELQEDKEKQSRELYITKDNMQRLQD----------DINDLYQERNELKSQLDKY 442          
The following BLAST results are available for this feature:
BLAST of SMED30017053 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017053 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017053 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017053 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017053 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017053 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017053 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017053 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267F2Q69.356e-4328.09Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GKW59.520e-4328.09Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F1P41.119e-1938.35Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H4794.666e-1938.61Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IR992.227e-1627.18Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SMED30017053 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017053 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017053 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017053 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017053 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017053 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004885.10.000e+099.63SMESG000004885.1[more]
SMESG000004885.13.088e-4299.63SMESG000004885.1[more]
SMESG000004885.10.000e+099.63SMESG000004885.1[more]
SMESG000004885.16.378e-5499.63SMESG000004885.1[more]
SMESG000013596.12.652e-1927.25SMESG000013596.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017053 ID=SMED30017053|Name=SMED30017053|organism=Schmidtea mediterranea sexual|type=transcript|length=3112bp
CTATTAGCCGGTATCACAATTAATTTTGAGTTCATTAAGTAAATTTAAAT
TCAATGTCTTACACAGAAAGTATTTTAACAGAAGATTACGCTAACAAATT
TAATGAATGCATGTTGACAAGTCCTTCTAAATCACGTCTCCATTTACAAA
GTTATAAATCAGATATCGATCAAGATTCGGTTTTCACGGAAGACATTGAA
ACGAAAATTCGAAATCAACGAGATTCATTTAAATATTCAAATCCTAACAT
TAATTCGGGTGATTTTGATATTTTAAGAGACAACCAAATCAAACCATTGG
AATTCGAAGACAAAGATGCCTTTAATGTTGAAAGAAAATATCAAGAAATT
CTAAAAAAACGGAGAAATAGGACTGCAAATTTGATTCAACCATATCAAAA
TCCCGTTTCTCAATTTCAAGAAAATTACAGACATCAAGATGATCAAAGTA
CAGTTTATGAAGATTATTCTATGGAAATAAGAAATAAAAAAAATGAAATT
CAAATGGATTTAGAAAGAGAAAGACGTCGAAATCGAAGCTCTAGTCCAGA
ATTGAGAAGAAATAATTTCATGACCCAACTTTCGCCTAGAGAGACATTAG
AGAGAAAAGTAGTTGAACTTGATCAACTCTCCTCAAGTGTTCAAAAGGCT
ACTATAGAACACCAACAATTGTGCAAGGAATTGCAAGTAATGCAGCACCA
GCTGAGGAAAAATCAAGCCGAGGTTCGTTTGAGTGAACGAATGGCACTGG
ACAATAAAGAAAAGGTTGAATTTGTTCATAAAGAATTGAAAAGTGCCGAA
AGTCGAAGAAATCAGACTTTAAGGCATCTTGATTTAGTCAACGAGGAATT
GGCCTTAAAGAGAGCAAAATTAAAATCTTTTGATTTGCAAATGTCACGGG
AAATGGCCAGTATTAGAAAACTAGATCAGCATGGAATAGAAAAGGAAGAG
ATTGAGAAAATTCTTGCTGAACGTGATGAACTGTATCAGATTGTTAAACG
CCAGGAGGATATTCAAAATGAAAAATATGAACTTGCCAAACAATTGGATT
TAATGAGAGATGATCTTTATTCAGAACAAGAAAGAGCTGCAAGACAAATC
GAAAATTTAGAAGATGAATTGGAATGTAGCCTTAAAAAAATTAAACAACT
TCAATTTGAAAAAGATGAATTAGAAGCTCAACTTGAACATCTTCGTCAAC
ATCTGTGTAAAGCAGAAGATCAAGCTTGCAAATCATCAAGAGAAGTTTCA
GAATTGAGAGATGAATATCAAAATAGAATAAAAAAAAAGTTGGATGACTA
TGAAACAGATAAAGAACGTATTGAACGTGAACTGAAGAAATTAGAAGATG
AAAAATCAAGTGATGAAGCTAATTTGAAGAGTCATATTGAAAAATTGAAA
TCAGAAATGGTTATAATTGAAAGAGAAAGAAAAGATTTGAGGGAATTAGT
CTCAGAATTAGAGGAGCAATTGAGGAAATCGGTTCAGTCTCGGTGCCAAA
TACTGGAAGAGCAAGAATATAAAGTCAGACAAATACAAAATGATAAAGAA
GAAGCTATGCAAAAACAAAGAAAGGATTTATTAAACGAACAAAAGATGTT
GCTTGACGAAAAAGACCTTCAATTTGGTCATGAGAAAAACAAAATTCAAA
AGCAATGTAATGAAGAAATCGACAGAATGATGAGAGATATGCAAATGAAA
GACAAAGAAATTTCTGAACTTTACGAGCAGCAAAGAGAAATCGAAAGTGA
ATTGAATTGTCAGTTACAACGAGAAAAGGCCAAATTTGAAGGTCTTCTCC
AAAAAGAAAAAGTCAATTTGATAGAATCGAGCAATAAAAAGAAACAAAAC
GAAATTAATAAAATCCTCTCAGATTGTGAAGCAAAAAATCATTCTTTAAA
TAATCATATTGAACAACTTACACTGACATTAAAAGACAGGGAAAATGAAT
TATCAAATTTAAAACAAGATATCTGTAATATTCGAATGGAAAATCAAAAA
ACGATGAATAATAGCATTTTAGCTACTCGAAAAATAAAAGACAACGTGAA
GCAGGATACGATCAAAGAATTAAAGACTCGTTATGAAGAAAAAATGGATA
AAGAATTGATAAAAGTCAAATCAGAATATGACAAAAAATTAAATTCAAAA
ATGTCAGTAATTCTCAAAGAAAAAGCAGCAATAGAAGATTCAGAGAAAAA
AAGCAAGCAATTACTCTGTAAAGTTGTAAAAACAGTTGTCCATGAGATTA
ATGGTGAATGTTGTAAAATGGCTTTACTGCTTAATGTTCATCCAAGAAAA
GTCGATCATTCAAAAATATCGGATAACTTTTCAAAGTCGGATAATATAAT
CACCCAAGCCCTAGCGAATCTTGAAGCATGCGGTTCTGAAACTAGAAATC
TTCTAGAAGAGCTTGAATCCAAAGTAAAATCATTAACTGAAAAATTAAAT
AATGAAGAAATTAATTTGGAAACTGAAATAAGAAACATAAGACATGAACT
TGAAGCAGAAAAATTAAAAGATATTAGTGAAATTCGTGAAAATCTTTTAA
AGGAACATTTAAGAGAAATCAATAGATTGGCAAAATCACCTGACATCGGA
TTAGAAAACTTGCTCCGGGAAAAAGAAAAAGAAATTTCGAAACTTCTTGC
TAATCGACAGATGTGGAAAGAAAAGGCGGCCGAAAAATTGGCTGAGAAGT
TTAATCAAATTAATCAAAAAAAAATAAATGAACTGAGAAATATGCTATTG
AAAAAAGAATCTGAAATCCGTCAACTGAAAGCGATCAGAGGTCGATCAAA
TAGTCCCACTCGACGTGATGTTAGAGCTTCTTCGGCGTTGGCATTAGAGA
AAACGGACTTGAATTTCTCCTCATTTCCATCGAATGTGATATCGAGCTTA
CAGGATAACCTGGATAATTTGAGAAAAGAAAATAATCAATTAAGACATAA
ATTAATTGGTTTCGAATCAAACGATCGAAAGTCTAAAATTGAAAAAGAGT
TAAGAAGCAATTCCAGAAGTAGGGAACGTTGAATATGCTTTAGATTTTGA
CTTTTTGCTTTCGCTTGCTTTTTTATACATTTATAACATTAAAGCTAAAC
TCAAATTTGTAG
back to top

protein sequence of SMED30017053-orf-1

>SMED30017053-orf-1 ID=SMED30017053-orf-1|Name=SMED30017053-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=993bp
MSYTESILTEDYANKFNECMLTSPSKSRLHLQSYKSDIDQDSVFTEDIET
KIRNQRDSFKYSNPNINSGDFDILRDNQIKPLEFEDKDAFNVERKYQEIL
KKRRNRTANLIQPYQNPVSQFQENYRHQDDQSTVYEDYSMEIRNKKNEIQ
MDLERERRRNRSSSPELRRNNFMTQLSPRETLERKVVELDQLSSSVQKAT
IEHQQLCKELQVMQHQLRKNQAEVRLSERMALDNKEKVEFVHKELKSAES
RRNQTLRHLDLVNEELALKRAKLKSFDLQMSREMASIRKLDQHGIEKEEI
EKILAERDELYQIVKRQEDIQNEKYELAKQLDLMRDDLYSEQERAARQIE
NLEDELECSLKKIKQLQFEKDELEAQLEHLRQHLCKAEDQACKSSREVSE
LRDEYQNRIKKKLDDYETDKERIERELKKLEDEKSSDEANLKSHIEKLKS
EMVIIERERKDLRELVSELEEQLRKSVQSRCQILEEQEYKVRQIQNDKEE
AMQKQRKDLLNEQKMLLDEKDLQFGHEKNKIQKQCNEEIDRMMRDMQMKD
KEISELYEQQREIESELNCQLQREKAKFEGLLQKEKVNLIESSNKKKQNE
INKILSDCEAKNHSLNNHIEQLTLTLKDRENELSNLKQDICNIRMENQKT
MNNSILATRKIKDNVKQDTIKELKTRYEEKMDKELIKVKSEYDKKLNSKM
SVILKEKAAIEDSEKKSKQLLCKVVKTVVHEINGECCKMALLLNVHPRKV
DHSKISDNFSKSDNIITQALANLEACGSETRNLLEELESKVKSLTEKLNN
EEINLETEIRNIRHELEAEKLKDISEIRENLLKEHLREINRLAKSPDIGL
ENLLREKEKEISKLLANRQMWKEKAAEKLAEKFNQINQKKINELRNMLLK
KESEIRQLKAIRGRSNSPTRRDVRASSALALEKTDLNFSSFPSNVISSLQ
DNLDNLRKENNQLRHKLIGFESNDRKSKIEKELRSNSRSRER*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:00324402-alkenal reductase [NAD(P)] activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 539..566
NoneNo IPR availableCOILSCoilCoilcoord: 189..223
NoneNo IPR availableCOILSCoilCoilcoord: 484..519
NoneNo IPR availableCOILSCoilCoilcoord: 854..911
NoneNo IPR availableCOILSCoilCoilcoord: 612..639
NoneNo IPR availableCOILSCoilCoilcoord: 335..390
NoneNo IPR availableCOILSCoilCoilcoord: 402..479
NoneNo IPR availableCOILSCoilCoilcoord: 139..159
NoneNo IPR availableCOILSCoilCoilcoord: 946..973
NoneNo IPR availableCOILSCoilCoilcoord: 770..822
NoneNo IPR availableCOILSCoilCoilcoord: 245..265
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 147..164
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 147..175