Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30017052
Length (bp)2517
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30017052) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30017052) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30017052) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30017052) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017052

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30017052h1SMcG0011459 Contig28845uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30017052h1SMcG0011459 Contig28845newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30017052h1SMcG0011459 dd_Smed_v4_8461_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30017052h1SMcG0011459 dd_Smed_v4_8461_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30017052h1SMcG0011459 dd_Smed_v4_8461_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: CLK2 (CDC like kinase 2 [Source:HGNC Symbol;Acc:HGNC:2069])

HSP 1 Score: 500.36 bits (1287), Expect = 4.383e-169
Identity = 241/356 (67.70%), Postives = 285/356 (80.06%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRL---PPHQRLHTLSSRRIS 2356
            DD EGHLIY  GD +  RY IV TLGEGTFG+VV+CVD+ +   RVALKIIKNVEKY+EAA LEINVL+ I EKDP++K L ++M +WFD++GHMCISFEL G S FDFLK+N+Y PYP+  VRH+++QLC AVKFLHD  LTHTDLKPENILFVNSD  L  N ++KRD+R VK++ +R++DFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI CIIFE Y G+TLFQTHDN+EHLAMMERILG  P RM RK+ K  +FY G+LDWD  +  GRYVRENC+PL RY T E +E  ++FDL+  MLEYEPA R++LG AL HPFF RL   PP++     SSR IS
Sbjct:  143 DDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLDWDENTSAGRYVRENCKPLRRYLTSEAEEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFARLRAEPPNKLWD--SSRDIS 496          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: CLK2 (CDC like kinase 2 [Source:HGNC Symbol;Acc:HGNC:2069])

HSP 1 Score: 500.36 bits (1287), Expect = 4.383e-169
Identity = 241/356 (67.70%), Postives = 285/356 (80.06%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRL---PPHQRLHTLSSRRIS 2356
            DD EGHLIY  GD +  RY IV TLGEGTFG+VV+CVD+ +   RVALKIIKNVEKY+EAA LEINVL+ I EKDP++K L ++M +WFD++GHMCISFEL G S FDFLK+N+Y PYP+  VRH+++QLC AVKFLHD  LTHTDLKPENILFVNSD  L  N ++KRD+R VK++ +R++DFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI CIIFE Y G+TLFQTHDN+EHLAMMERILG  P RM RK+ K  +FY G+LDWD  +  GRYVRENC+PL RY T E +E  ++FDL+  MLEYEPA R++LG AL HPFF RL   PP++     SSR IS
Sbjct:  143 DDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLDWDENTSAGRYVRENCKPLRRYLTSEAEEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFARLRAEPPNKLWD--SSRDIS 496          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: CLK2 (CDC like kinase 2 [Source:HGNC Symbol;Acc:HGNC:2069])

HSP 1 Score: 499.975 bits (1286), Expect = 5.568e-169
Identity = 241/356 (67.70%), Postives = 285/356 (80.06%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRL---PPHQRLHTLSSRRIS 2356
            DD EGHLIY  GD +  RY IV TLGEGTFG+VV+CVD+ +   RVALKIIKNVEKY+EAA LEINVL+ I EKDP++K L ++M +WFD++GHMCISFEL G S FDFLK+N+Y PYP+  VRH+++QLC AVKFLHD  LTHTDLKPENILFVNSD  L  N ++KRD+R VK++ +R++DFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI CIIFE Y G+TLFQTHDN+EHLAMMERILG  P RM RK+ K  +FY G+LDWD  +  GRYVRENC+PL RY T E +E  ++FDL+  MLEYEPA R++LG AL HPFF RL   PP++     SSR IS
Sbjct:  144 DDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLDWDENTSAGRYVRENCKPLRRYLTSEAEEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFARLRAEPPNKLWD--SSRDIS 497          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: CLK2 (CDC like kinase 2 [Source:HGNC Symbol;Acc:HGNC:2069])

HSP 1 Score: 499.975 bits (1286), Expect = 5.568e-169
Identity = 241/356 (67.70%), Postives = 285/356 (80.06%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRL---PPHQRLHTLSSRRIS 2356
            DD EGHLIY  GD +  RY IV TLGEGTFG+VV+CVD+ +   RVALKIIKNVEKY+EAA LEINVL+ I EKDP++K L ++M +WFD++GHMCISFEL G S FDFLK+N+Y PYP+  VRH+++QLC AVKFLHD  LTHTDLKPENILFVNSD  L  N ++KRD+R VK++ +R++DFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI CIIFE Y G+TLFQTHDN+EHLAMMERILG  P RM RK+ K  +FY G+LDWD  +  GRYVRENC+PL RY T E +E  ++FDL+  MLEYEPA R++LG AL HPFF RL   PP++     SSR IS
Sbjct:  144 DDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLDWDENTSAGRYVRENCKPLRRYLTSEAEEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFARLRAEPPNKLWD--SSRDIS 497          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: CLK2 (CDC like kinase 2 [Source:HGNC Symbol;Acc:HGNC:2069])

HSP 1 Score: 499.975 bits (1286), Expect = 5.762e-169
Identity = 241/356 (67.70%), Postives = 285/356 (80.06%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRL---PPHQRLHTLSSRRIS 2356
            DD EGHLIY  GD +  RY IV TLGEGTFG+VV+CVD+ +   RVALKIIKNVEKY+EAA LEINVL+ I EKDP++K L ++M +WFD++GHMCISFEL G S FDFLK+N+Y PYP+  VRH+++QLC AVKFLHD  LTHTDLKPENILFVNSD  L  N ++KRD+R VK++ +R++DFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI CIIFE Y G+TLFQTHDN+EHLAMMERILG  P RM RK+ K  +FY G+LDWD  +  GRYVRENC+PL RY T E +E  ++FDL+  MLEYEPA R++LG AL HPFF RL   PP++     SSR IS
Sbjct:  145 DDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLDWDENTSAGRYVRENCKPLRRYLTSEAEEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFARLRAEPPNKLWD--SSRDIS 498          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: madd-3 (Probable dual specificity protein kinase madd-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EDB2])

HSP 1 Score: 437.573 bits (1124), Expect = 7.778e-144
Identity = 208/338 (61.54%), Postives = 253/338 (74.85%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLP 2314
            DDK+GHLIY  GD I+ R+ I  TLGEGTFGKVV  V++  S   +ALKIIKNV KYREAA LE+ VL+ + EKDPE K   I M ++FD+ GH+C+ F+L G S+FDFLK N Y PYPME   HI++QLC AVKFLHD  LTHTDLKPENILFV  DS        K+  RV+ ++ +RLIDFGSATFDHEHHS IVSTRHYRAPEVILELGWS+ CDVWSI CI++ELYTG TLFQTH+N+EHLAMMER+LG  P RMA+++KT FF +G+LDW   S D  YVR+NC+PL R  +  + E +E+F+L+  ML +EP  R+ L  AL H +F RLP
Sbjct:  239 DDKDGHLIYSKGDFILNRFTIYDTLGEGTFGKVVR-VNDSLSDTFMALKIIKNVSKYREAAKLEVKVLQKLAEKDPEKKNWVIHMGSYFDYNGHICLLFDLMGSSIFDFLKANHYKPYPMEQTLHITWQLCNAVKFLHDNKLTHTDLKPENILFV--DSRYTTKLVDKKPLRVLHSTHVRLIDFGSATFDHEHHSIIVSTRHYRAPEVILELGWSQPCDVWSIGCILYELYTGVTLFQTHENREHLAMMERVLGDIPLRMAKRTKTKFFINGRLDWVNTSADAAYVRDNCKPLRRSMSCTDPEHVELFELIENMLMFEPLARMKLPEALQHRYFNRLP 573          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: madd-3 (Probable dual specificity protein kinase madd-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EDB2])

HSP 1 Score: 442.195 bits (1136), Expect = 5.705e-142
Identity = 209/340 (61.47%), Postives = 256/340 (75.29%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNS--DSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLP 2314
            DDK+GHLIY  GD I+ R+ I  TLGEGTFGKVV  V++  S   +ALKIIKNV KYREAA LE+ VL+ + EKDPE K   I M ++FD+ GH+C+ F+L G S+FDFLK N Y PYPME   HI++QLC AVKFLHD  LTHTDLKPENILFV+S   + LV     K+  RV+ ++ +RLIDFGSATFDHEHHS IVSTRHYRAPEVILELGWS+ CDVWSI CI++ELYTG TLFQTH+N+EHLAMMER+LG  P RMA+++KT FF +G+LDW   S D  YVR+NC+PL R  +  + E +E+F+L+  ML +EP  R+ L  AL H +F RLP
Sbjct:  533 DDKDGHLIYSKGDFILNRFTIYDTLGEGTFGKVVR-VNDSLSDTFMALKIIKNVSKYREAAKLEVKVLQKLAEKDPEKKNWVIHMGSYFDYNGHICLLFDLMGSSIFDFLKANHYKPYPMEQTLHITWQLCNAVKFLHDNKLTHTDLKPENILFVDSRYTTKLV----DKKPLRVLHSTHVRLIDFGSATFDHEHHSIIVSTRHYRAPEVILELGWSQPCDVWSIGCILYELYTGVTLFQTHENREHLAMMERVLGDIPLRMAKRTKTKFFINGRLDWVNTSADAAYVRDNCKPLRRSMSCTDPEHVELFELIENMLMFEPLARMKLPEALQHRYFNRLP 867          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: madd-3 (Probable dual specificity protein kinase madd-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EDB2])

HSP 1 Score: 431.409 bits (1108), Expect = 2.518e-141
Identity = 207/341 (60.70%), Postives = 253/341 (74.19%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS---KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLP 2314
            DDK+GHLIY  GD I+ R+ I  TLGEGTFGKVV  V++  S   +ALKIIKNV KYREAA LE+ VL+ + EKDPE K   I M ++FD+ GH+C+ F+L G S+FDFLK N Y PYPME   HI++QLC AVKFLHD  LTHTDLKPENILFV  DS        K+  RV+ ++ +RLIDFGSATFDHEHHS IVSTRHYRAPEVILELGWS+ CDVWSI CI++ELYTG TLFQTH+N+EHLAMMER+LG  P RMA+++   +T FF +G+LDW   S D  YVR+NC+PL R  +  + E +E+F+L+  ML +EP  R+ L  AL H +F RLP
Sbjct:  239 DDKDGHLIYSKGDFILNRFTIYDTLGEGTFGKVVR-VNDSLSDTFMALKIIKNVSKYREAAKLEVKVLQKLAEKDPEKKNWVIHMGSYFDYNGHICLLFDLMGSSIFDFLKANHYKPYPMEQTLHITWQLCNAVKFLHDNKLTHTDLKPENILFV--DSRYTTKLVDKKPLRVLHSTHVRLIDFGSATFDHEHHSIIVSTRHYRAPEVILELGWSQPCDVWSIGCILYELYTGVTLFQTHENREHLAMMERVLGDIPLRMAKRTNTFRTKFFINGRLDWVNTSADAAYVRDNCKPLRRSMSCTDPEHVELFELIENMLMFEPLARMKLPEALQHRYFNRLP 576          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: madd-3 (Probable dual specificity protein kinase madd-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EDB2])

HSP 1 Score: 436.032 bits (1120), Expect = 1.622e-139
Identity = 208/343 (60.64%), Postives = 256/343 (74.64%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNS--DSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS---KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLP 2314
            DDK+GHLIY  GD I+ R+ I  TLGEGTFGKVV  V++  S   +ALKIIKNV KYREAA LE+ VL+ + EKDPE K   I M ++FD+ GH+C+ F+L G S+FDFLK N Y PYPME   HI++QLC AVKFLHD  LTHTDLKPENILFV+S   + LV     K+  RV+ ++ +RLIDFGSATFDHEHHS IVSTRHYRAPEVILELGWS+ CDVWSI CI++ELYTG TLFQTH+N+EHLAMMER+LG  P RMA+++   +T FF +G+LDW   S D  YVR+NC+PL R  +  + E +E+F+L+  ML +EP  R+ L  AL H +F RLP
Sbjct:  533 DDKDGHLIYSKGDFILNRFTIYDTLGEGTFGKVVR-VNDSLSDTFMALKIIKNVSKYREAAKLEVKVLQKLAEKDPEKKNWVIHMGSYFDYNGHICLLFDLMGSSIFDFLKANHYKPYPMEQTLHITWQLCNAVKFLHDNKLTHTDLKPENILFVDSRYTTKLV----DKKPLRVLHSTHVRLIDFGSATFDHEHHSIIVSTRHYRAPEVILELGWSQPCDVWSIGCILYELYTGVTLFQTHENREHLAMMERVLGDIPLRMAKRTNTFRTKFFINGRLDWVNTSADAAYVRDNCKPLRRSMSCTDPEHVELFELIENMLMFEPLARMKLPEALQHRYFNRLP 870          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: madd-3 (Probable dual specificity protein kinase madd-3 [Source:UniProtKB/Swiss-Prot;Acc:G5EDB2])

HSP 1 Score: 331.643 bits (849), Expect = 1.480e-107
Identity = 157/254 (61.81%), Postives = 193/254 (75.98%), Query Frame = 2
Query: 1553 MLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLP 2314
            M ++FD+ GH+C+ F+L G S+FDFLK N Y PYPME   HI++QLC AVKFLHD  LTHTDLKPENILFV  DS        K+  RV+ ++ +RLIDFGSATFDHEHHS IVSTRHYRAPEVILELGWS+ CDVWSI CI++ELYTG TLFQTH+N+EHLAMMER+LG  P RMA+++KT FF +G+LDW   S D  YVR+NC+PL R  +  + E +E+F+L+  ML +EP  R+ L  AL H +F RLP
Sbjct:    1 MGSYFDYNGHICLLFDLMGSSIFDFLKANHYKPYPMEQTLHITWQLCNAVKFLHDNKLTHTDLKPENILFV--DSRYTTKLVDKKPLRVLHSTHVRLIDFGSATFDHEHHSIIVSTRHYRAPEVILELGWSQPCDVWSIGCILYELYTGVTLFQTHENREHLAMMERVLGDIPLRMAKRTKTKFFINGRLDWVNTSADAAYVRDNCKPLRRSMSCTDPEHVELFELIENMLMFEPLARMKLPEALQHRYFNRLP 252          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Doa (gene:FBgn0265998 transcript:FBtr0299748)

HSP 1 Score: 498.049 bits (1281), Expect = 2.575e-168
Identity = 231/350 (66.00%), Postives = 284/350 (81.14%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRLHTLSSRR 2350
            DD +GHLIY  GD++  RY+I+ TLGEGTFG+VV+  D ++    +ALKIIKNVEKYREAA LEIN L+ I +KDP   +L +KM++WFD++GHMCI FE+ G SVFDFL+EN+Y PYP++ VRH++YQLC++VKFLHD  LTHTDLKPENILFV+SD     N K  R+ R VKN+++RLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI CI+FELY G TLFQTHDN+EHLAMMERILG  PYRMARK+KT +FYHGKLDWD  S  GRYVR++C+PL      ++++  E+F L+ KMLEYEP+ RI+LG AL HPFF RLPPH R+  +S+++
Sbjct:  146 DDADGHLIYHTGDILHHRYKIMATLGEGTFGRVVKVKDMERDYC-MALKIIKNVEKYREAAKLEINALEKIAQKDPHCDHLCVKMIDWFDYHGHMCIVFEMLGLSVFDFLRENNYEPYPLDQVRHMAYQLCYSVKFLHDNRLTHTDLKPENILFVDSDYTSHYNHKINREVRRVKNTDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCILFELYLGITLFQTHDNREHLAMMERILGQIPYRMARKTKTKYFYHGKLDWDEKSSAGRYVRDHCKPLFLCQLSDSEDHCELFSLIKKMLEYEPSSRITLGEALHHPFFDRLPPHHRVGEVSNKQ 494          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Doa (gene:FBgn0265998 transcript:FBtr0299752)

HSP 1 Score: 498.049 bits (1281), Expect = 2.575e-168
Identity = 231/350 (66.00%), Postives = 284/350 (81.14%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRLHTLSSRR 2350
            DD +GHLIY  GD++  RY+I+ TLGEGTFG+VV+  D ++    +ALKIIKNVEKYREAA LEIN L+ I +KDP   +L +KM++WFD++GHMCI FE+ G SVFDFL+EN+Y PYP++ VRH++YQLC++VKFLHD  LTHTDLKPENILFV+SD     N K  R+ R VKN+++RLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI CI+FELY G TLFQTHDN+EHLAMMERILG  PYRMARK+KT +FYHGKLDWD  S  GRYVR++C+PL      ++++  E+F L+ KMLEYEP+ RI+LG AL HPFF RLPPH R+  +S+++
Sbjct:  146 DDADGHLIYHTGDILHHRYKIMATLGEGTFGRVVKVKDMERDYC-MALKIIKNVEKYREAAKLEINALEKIAQKDPHCDHLCVKMIDWFDYHGHMCIVFEMLGLSVFDFLRENNYEPYPLDQVRHMAYQLCYSVKFLHDNRLTHTDLKPENILFVDSDYTSHYNHKINREVRRVKNTDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCILFELYLGITLFQTHDNREHLAMMERILGQIPYRMARKTKTKYFYHGKLDWDEKSSAGRYVRDHCKPLFLCQLSDSEDHCELFSLIKKMLEYEPSSRITLGEALHHPFFDRLPPHHRVGEVSNKQ 494          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Doa (gene:FBgn0265998 transcript:FBtr0299745)

HSP 1 Score: 499.975 bits (1286), Expect = 5.114e-168
Identity = 231/350 (66.00%), Postives = 284/350 (81.14%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRLHTLSSRR 2350
            DD +GHLIY  GD++  RY+I+ TLGEGTFG+VV+  D ++    +ALKIIKNVEKYREAA LEIN L+ I +KDP   +L +KM++WFD++GHMCI FE+ G SVFDFL+EN+Y PYP++ VRH++YQLC++VKFLHD  LTHTDLKPENILFV+SD     N K  R+ R VKN+++RLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI CI+FELY G TLFQTHDN+EHLAMMERILG  PYRMARK+KT +FYHGKLDWD  S  GRYVR++C+PL      ++++  E+F L+ KMLEYEP+ RI+LG AL HPFF RLPPH R+  +S+++
Sbjct:  215 DDADGHLIYHTGDILHHRYKIMATLGEGTFGRVVKVKDMERDYC-MALKIIKNVEKYREAAKLEINALEKIAQKDPHCDHLCVKMIDWFDYHGHMCIVFEMLGLSVFDFLRENNYEPYPLDQVRHMAYQLCYSVKFLHDNRLTHTDLKPENILFVDSDYTSHYNHKINREVRRVKNTDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCILFELYLGITLFQTHDNREHLAMMERILGQIPYRMARKTKTKYFYHGKLDWDEKSSAGRYVRDHCKPLFLCQLSDSEDHCELFSLIKKMLEYEPSSRITLGEALHHPFFDRLPPHHRVGEVSNKQ 563          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Doa (gene:FBgn0265998 transcript:FBtr0299742)

HSP 1 Score: 499.975 bits (1286), Expect = 5.114e-168
Identity = 231/350 (66.00%), Postives = 284/350 (81.14%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRLHTLSSRR 2350
            DD +GHLIY  GD++  RY+I+ TLGEGTFG+VV+  D ++    +ALKIIKNVEKYREAA LEIN L+ I +KDP   +L +KM++WFD++GHMCI FE+ G SVFDFL+EN+Y PYP++ VRH++YQLC++VKFLHD  LTHTDLKPENILFV+SD     N K  R+ R VKN+++RLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI CI+FELY G TLFQTHDN+EHLAMMERILG  PYRMARK+KT +FYHGKLDWD  S  GRYVR++C+PL      ++++  E+F L+ KMLEYEP+ RI+LG AL HPFF RLPPH R+  +S+++
Sbjct:  215 DDADGHLIYHTGDILHHRYKIMATLGEGTFGRVVKVKDMERDYC-MALKIIKNVEKYREAAKLEINALEKIAQKDPHCDHLCVKMIDWFDYHGHMCIVFEMLGLSVFDFLRENNYEPYPLDQVRHMAYQLCYSVKFLHDNRLTHTDLKPENILFVDSDYTSHYNHKINREVRRVKNTDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCILFELYLGITLFQTHDNREHLAMMERILGQIPYRMARKTKTKYFYHGKLDWDEKSSAGRYVRDHCKPLFLCQLSDSEDHCELFSLIKKMLEYEPSSRITLGEALHHPFFDRLPPHHRVGEVSNKQ 563          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: Doa (gene:FBgn0265998 transcript:FBtr0299750)

HSP 1 Score: 499.975 bits (1286), Expect = 5.114e-168
Identity = 231/350 (66.00%), Postives = 284/350 (81.14%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRLHTLSSRR 2350
            DD +GHLIY  GD++  RY+I+ TLGEGTFG+VV+  D ++    +ALKIIKNVEKYREAA LEIN L+ I +KDP   +L +KM++WFD++GHMCI FE+ G SVFDFL+EN+Y PYP++ VRH++YQLC++VKFLHD  LTHTDLKPENILFV+SD     N K  R+ R VKN+++RLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI CI+FELY G TLFQTHDN+EHLAMMERILG  PYRMARK+KT +FYHGKLDWD  S  GRYVR++C+PL      ++++  E+F L+ KMLEYEP+ RI+LG AL HPFF RLPPH R+  +S+++
Sbjct:  215 DDADGHLIYHTGDILHHRYKIMATLGEGTFGRVVKVKDMERDYC-MALKIIKNVEKYREAAKLEINALEKIAQKDPHCDHLCVKMIDWFDYHGHMCIVFEMLGLSVFDFLRENNYEPYPLDQVRHMAYQLCYSVKFLHDNRLTHTDLKPENILFVDSDYTSHYNHKINREVRRVKNTDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCILFELYLGITLFQTHDNREHLAMMERILGQIPYRMARKTKTKYFYHGKLDWDEKSSAGRYVRDHCKPLFLCQLSDSEDHCELFSLIKKMLEYEPSSRITLGEALHHPFFDRLPPHHRVGEVSNKQ 563          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: clk2b (CDC-like kinase 2b [Source:ZFIN;Acc:ZDB-GENE-060929-1126])

HSP 1 Score: 483.797 bits (1244), Expect = 8.684e-163
Identity = 222/335 (66.27%), Postives = 274/335 (81.79%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            DD+EGHLIY  GD++  RY I +TLGEGTFGKVVECVD+ +   R+ALKIIKNVEKY+EAA LEINVL+ I ++DPE+K L ++ML+WFD++GHMC+SFEL G S FDF+KEN+Y PY +  VRH++YQ+C AVKFLHD  LTHTDLKPENILFV+SD  ++ N+++KRD+R V ++ +R++DFGSATFDHEHHS+IVSTRHYRAPEVILELGWS+ CDVWSI CI+FE Y GYTL+QTHDN+EHLAMMERI G  P RM RK+ K  +FY G+LDWD  +  GRYVRENCRPL RY   E+++  + FDL+  +LEYEP  R+SL AAL HPFF
Sbjct:  147 DDEEGHLIYRAGDVLQDRYEITQTLGEGTFGKVVECVDHQRGGSRIALKIIKNVEKYKEAARLEINVLEKINQRDPENKNLCVQMLDWFDYHGHMCLSFELLGLSTFDFMKENNYLPYSISQVRHMAYQICLAVKFLHDNKLTHTDLKPENILFVSSDYSVLYNAEKKRDERSVNSTAVRIVDFGSATFDHEHHSSIVSTRHYRAPEVILELGWSQPCDVWSIGCILFEFYCGYTLYQTHDNREHLAMMERIHGPVPSRMIRKTRKQKYFYRGRLDWDESTSAGRYVRENCRPLRRYMLCESEDHHQFFDLLEGLLEYEPEQRLSLSAALRHPFF 481          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: clk2a (CDC-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-030131-298])

HSP 1 Score: 483.797 bits (1244), Expect = 2.066e-162
Identity = 223/335 (66.57%), Postives = 269/335 (80.30%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            DD+EGHLI   GD++  RY IV TLGEGTFG+V++C+D+ +    VALKIIKNVEKY+EAA LEINVL+ I EKDPE+  L ++M +WFD++GHMCISFEL   S FDFLKEN+Y PY +  VRH++YQ+C AVKFLH+  LTHTDLKPENILFVNSD  +  N ++KRD+R VKN+ +R++DFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI  I+FE Y G+TLFQTHDN+EHLAMMERILG  P RM RK+ K  +FY G+LDWD  S  GRYVRENC+PL RY   E +E  ++FDL+  MLEYEP+ R++L AAL HPFF
Sbjct:  170 DDEEGHLICRSGDVLQERYEIVSTLGEGTFGRVMQCIDHRRGGAHVALKIIKNVEKYKEAARLEINVLERINEKDPENNNLCVQMFDWFDYHGHMCISFELLALSTFDFLKENNYLPYSINQVRHMAYQVCLAVKFLHENKLTHTDLKPENILFVNSDYTVTYNVEKKRDERTVKNTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGSILFEYYLGFTLFQTHDNREHLAMMERILGPVPSRMIRKTRKQKYFYRGRLDWDENSSAGRYVRENCKPLRRYLLSEAEEHHQLFDLIEAMLEYEPSKRLTLAAALRHPFF 504          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: clk2a (CDC-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-030131-298])

HSP 1 Score: 483.797 bits (1244), Expect = 2.178e-162
Identity = 223/335 (66.57%), Postives = 269/335 (80.30%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            DD+EGHLI   GD++  RY IV TLGEGTFG+V++C+D+ +    VALKIIKNVEKY+EAA LEINVL+ I EKDPE+  L ++M +WFD++GHMCISFEL   S FDFLKEN+Y PY +  VRH++YQ+C AVKFLH+  LTHTDLKPENILFVNSD  +  N ++KRD+R VKN+ +R++DFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI  I+FE Y G+TLFQTHDN+EHLAMMERILG  P RM RK+ K  +FY G+LDWD  S  GRYVRENC+PL RY   E +E  ++FDL+  MLEYEP+ R++L AAL HPFF
Sbjct:  169 DDEEGHLICRSGDVLQERYEIVSTLGEGTFGRVMQCIDHRRGGAHVALKIIKNVEKYKEAARLEINVLERINEKDPENNNLCVQMFDWFDYHGHMCISFELLALSTFDFLKENNYLPYSINQVRHMAYQVCLAVKFLHENKLTHTDLKPENILFVNSDYTVTYNVEKKRDERTVKNTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGSILFEYYLGFTLFQTHDNREHLAMMERILGPVPSRMIRKTRKQKYFYRGRLDWDENSSAGRYVRENCKPLRRYLLSEAEEHHQLFDLIEAMLEYEPSKRLTLAAALRHPFF 503          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: clk4a (CDC-like kinase 4a [Source:ZFIN;Acc:ZDB-GENE-030131-576])

HSP 1 Score: 434.876 bits (1117), Expect = 8.276e-144
Identity = 194/335 (57.91%), Postives = 261/335 (77.91%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTS-FFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            DD+EGHL+Y  GDM+  RY IV TLGEG FGKVVEC+D+++   R+ALKIIKN+E+YR+AAL E+ VL+ I   D + +Y  ++M +WFDH+GH+CI+FEL G S +DFLKEN++ P+ + H+RH++YQ+  AV+FLH   LTHTDLKPENILFVNS+  +  NSK KRD+R VKN +++++DFG+AT++HEHH+++VSTRHYRAPEVIL+LGWS SCDVWS+ CI+ E Y G TLFQTHD+KEHLAMMER+LG  P  M +K++ S F  + KLDWD +S  GRYVR+ C+PL +Y    + +  ++FDL+ +MLEY+   RI+L  A+ HPFF
Sbjct:  154 DDEEGHLVYHSGDMLRARYEIVCTLGEGAFGKVVECIDHEKVGARIALKIIKNIERYRDAALSEVEVLEQINSLDCDRRYACVRMYDWFDHHGHICIAFELLGLSTYDFLKENNFQPFYINHIRHMAYQIIRAVRFLHKNKLTHTDLKPENILFVNSEYNIRYNSKMKRDERTVKNPDVKVVDFGNATYEHEHHTSVVSTRHYRAPEVILDLGWSHSCDVWSVGCILIEYYLGSTLFQTHDSKEHLAMMERVLGPIPTHMLQKTRKSRFVRNDKLDWDIHSSSGRYVRKQCKPLRQYLVSSSSDHEQLFDLIERMLEYDVTKRITLDEAIKHPFF 488          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: clk4b (CDC-like kinase 4b [Source:ZFIN;Acc:ZDB-GENE-050227-19])

HSP 1 Score: 424.861 bits (1091), Expect = 2.595e-140
Identity = 190/335 (56.72%), Postives = 262/335 (78.21%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKT-SFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            DD+EGHL+Y +GDM+  RY IV TLGEG FGKVVEC+D+ + + RVALKIIKN+E+YREAAL E++VL+ I   D E ++  ++ML+WFDH+GH+CI FEL G S +DFLKEN + P+ +  +RH++ Q+  AV+FLH   LTHTDLKPENILFV+S+  +  NS+ KRD+R +K  +++++DFG+AT+DHEHH+++VSTRHYRAPEVILELGW+++CDVWS+ CI+ E Y G TLFQTHD+KEHLAMME++LG  P  + +K+K   + +H KLDWD +S  GRYVR++C+PL +Y + +  E   +FDL+ KM+EY+ + RI+L  A+ HPFF
Sbjct:  137 DDEEGHLVYHNGDMLRARYEIVGTLGEGAFGKVVECLDHTKGNVRVALKIIKNIERYREAALSEVDVLERINSLDDEKRFACVRMLDWFDHHGHICIVFELLGLSTYDFLKENGFMPFSLTQIRHMADQIFRAVRFLHKNKLTHTDLKPENILFVDSNYDIKYNSRMKRDERTLKRLDVKVVDFGNATYDHEHHTSVVSTRHYRAPEVILELGWNQACDVWSLGCILVEFYLGLTLFQTHDSKEHLAMMEKVLGPIPTHLLQKTKKRRYVHHDKLDWDEHSSAGRYVRKHCKPLKQYMSSKTPEHELLFDLLQKMMEYDSSKRITLEQAIGHPFF 471          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ezr (ezrin [Source:Xenbase;Acc:XB-GENE-484766])

HSP 1 Score: 437.958 bits (1125), Expect = 5.617e-145
Identity = 204/346 (58.96%), Postives = 267/346 (77.17%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRLHT 2335
            +DKEGHL+   G+ I  RY IV  LG+GTFGKVVEC+D  + + RVALKII+NV KYREAA LEINVL+ I+E+D ++K + + M +WFD +GH+CI+FEL G+S F+F KEN++ PYP+ H+RH+++QLC A+KFLH+  LTHTDLKPENILFVNS+  +  N  +K +++ VKN  IR++DFGSATFDHE+H+TIV+TRHYR PEVILELGWS+ CDVWS+ CI+FE YTG+TLFQTHDN+EHL MME+ILG  P RM  K+ K  +F++G L WD  S DGRYV +NC  L+ Y + ++ E +++FDL+S+MLE+ PA RI+L  AL H FF  L P Q   T
Sbjct:  139 NDKEGHLVCRTGERIQERYEIVGDLGKGTFGKVVECLDLARGNSRVALKIIRNVRKYREAAQLEINVLEKIKERDQDNKNMCVLMRDWFDFHGHVCIAFELLGKSTFEFQKENNFLPYPLAHIRHMAFQLCQALKFLHENQLTHTDLKPENILFVNSEYDICYNESKKCEEKCVKNPSIRIVDFGSATFDHEYHTTIVATRHYRPPEVILELGWSQPCDVWSLGCILFEYYTGFTLFQTHDNREHLVMMEKILGPLPRRMVYKTRKQKYFHNGSLIWDENSSDGRYVSKNCHQLMSYKSSDSAEHVQLFDLLSRMLEFRPALRITLQEALEHQFFTCLKPQQMTRT 484          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: ezr (ezrin [Source:Xenbase;Acc:XB-GENE-484766])

HSP 1 Score: 436.032 bits (1120), Expect = 3.361e-144
Identity = 202/342 (59.06%), Postives = 266/342 (77.78%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQ 2323
            +DKEGHL+   G+ I  RY IV  LG+GTFGKVVEC+D  + + RVALKII+NV KYREAA LEINVL+ I+E+D ++K + + M +WFD +GH+CI+FEL G+S F+F KEN++ PYP+ H+RH+++QLC A+KFLH+  LTHTDLKPENILFVNS+  +  N  +K +++ VKN  IR++DFGSATFDHE+H+TIV+TRHYR PEVILELGWS+ CDVWS+ CI+FE YTG+TLFQTHDN+EHL MME+ILG  P RM  K+ K  +F++G L WD  S DGRYV +NC  L+ Y + ++ E +++FDL+S+MLE+ PA RI+L  AL H FF  L P +
Sbjct:  144 NDKEGHLVCRTGERIQERYEIVGDLGKGTFGKVVECLDLARGNSRVALKIIRNVRKYREAAQLEINVLEKIKERDQDNKNMCVLMRDWFDFHGHVCIAFELLGKSTFEFQKENNFLPYPLAHIRHMAFQLCQALKFLHENQLTHTDLKPENILFVNSEYDICYNESKKCEEKCVKNPSIRIVDFGSATFDHEYHTTIVATRHYRPPEVILELGWSQPCDVWSLGCILFEYYTGFTLFQTHDNREHLVMMEKILGPLPRRMVYKTRKQKYFHNGSLIWDENSSDGRYVSKNCHQLMSYKSSDSAEHVQLFDLLSRMLEFRPALRITLQEALEHQFFTCLKPEE 485          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dkk3 (dickkopf WNT signaling pathway inhibitor 3 [Source:Xenbase;Acc:XB-GENE-877183])

HSP 1 Score: 426.017 bits (1094), Expect = 4.348e-142
Identity = 194/334 (58.08%), Postives = 261/334 (78.14%), Query Frame = 2
Query: 1304 DKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            D+EGHLI   GD++  RY IV  LGEG FGKV+EC+D+ +  +RVA+KIIKNVE+YREAA  EI VL+ +  KDP + +  ++ML WFDH+GH+CI FEL G S +DF+KENS+ P+P++H+R+++YQ+C ++ FLH   LTHTDLKPENILFV+SD ++  N  +K+D+R +KNS+I+++DFGSAT++ E+HS +VSTRHYRAPEVILELGWS+ CDVWSI CI+ E Y G T+FQTHD+KEHLAMMERILG  P  M +K+ K  +FY  +LDWD +S  GRYV++ C+PL  Y   +N++  ++FDL+ +MLEY+PA RI+L  AL HPFF
Sbjct:   40 DEEGHLICESGDVLRERYEIVHALGEGAFGKVLECIDHLRGGERVAVKIIKNVERYREAAQSEIQVLEHLNRKDPINTFRCVQMLEWFDHHGHICIVFELLGLSTYDFIKENSFLPFPLDHIRNMAYQICKSINFLHQNQLTHTDLKPENILFVHSDYVVHFNHAKKQDERYLKNSDIKIVDFGSATYNDEYHSALVSTRHYRAPEVILELGWSQPCDVWSIGCILIEYYLGLTVFQTHDSKEHLAMMERILGPLPLHMIKKTRKHKYFYLDRLDWDEHSSAGRYVKKRCKPLKEYMVSDNKDHHQLFDLIQRMLEYDPAKRITLEEALKHPFF 373          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dkk3 (dickkopf WNT signaling pathway inhibitor 3 [Source:Xenbase;Acc:XB-GENE-877183])

HSP 1 Score: 429.098 bits (1102), Expect = 1.049e-141
Identity = 201/363 (55.37%), Postives = 275/363 (75.76%), Query Frame = 2
Query: 1220 SNRTS-VEEPLKVSSKSMQISDSEVPPCDDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            S+RTS ++   K  S+S+++         D+EGHLI   GD++  RY IV  LGEG FGKV+EC+D+ +  +RVA+KIIKNVE+YREAA  EI VL+ +  KDP + +  ++ML WFDH+GH+CI FEL G S +DF+KENS+ P+P++H+R+++YQ+C ++ FLH   LTHTDLKPENILFV+SD ++  N  +K+D+R +KNS+I+++DFGSAT++ E+HS +VSTRHYRAPEVILELGWS+ CDVWSI CI+ E Y G T+FQTHD+KEHLAMMERILG  P  M +K+ K  +FY  +LDWD +S  GRYV++ C+PL  Y   +N++  ++FDL+ +MLEY+PA RI+L  AL HPFF
Sbjct:  123 SSRTSHLKSHRKKRSRSVEV---------DEEGHLICESGDVLRERYEIVHALGEGAFGKVLECIDHLRGGERVAVKIIKNVERYREAAQSEIQVLEHLNRKDPINTFRCVQMLEWFDHHGHICIVFELLGLSTYDFIKENSFLPFPLDHIRNMAYQICKSINFLHQNQLTHTDLKPENILFVHSDYVVHFNHAKKQDERYLKNSDIKIVDFGSATYNDEYHSALVSTRHYRAPEVILELGWSQPCDVWSIGCILIEYYLGLTVFQTHDSKEHLAMMERILGPLPLHMIKKTRKHKYFYLDRLDWDEHSSAGRYVKKRCKPLKEYMVSDNKDHHQLFDLIQRMLEYDPAKRITLEEALKHPFF 476          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: dkk3 (dickkopf WNT signaling pathway inhibitor 3 [Source:Xenbase;Acc:XB-GENE-877183])

HSP 1 Score: 420.239 bits (1079), Expect = 9.493e-140
Identity = 194/334 (58.08%), Postives = 260/334 (77.84%), Query Frame = 2
Query: 1304 DKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            D+EGHLI   GD++  RY IV  LGEG FGKV+EC+D+ +  +RVA+KIIKNVE+YREAA  EI VL+ +  KDP + +  ++ML WFDH+GH+CI FEL G S +DF+KENS+ P+P++H+R+++YQ+C ++ FLH   LTHTDLKPENILFV+SD ++  N   K+D+R +KNS+I+++DFGSAT++ E+HS +VSTRHYRAPEVILELGWS+ CDVWSI CI+ E Y G T+FQTHD+KEHLAMMERILG  P  M +K+ K  +FY  +LDWD +S  GRYV++ C+PL  Y   +N++  ++FDL+ +MLEY+PA RI+L  AL HPFF
Sbjct:   40 DEEGHLICESGDVLRERYEIVHALGEGAFGKVLECIDHLRGGERVAVKIIKNVERYREAAQSEIQVLEHLNRKDPINTFRCVQMLEWFDHHGHICIVFELLGLSTYDFIKENSFLPFPLDHIRNMAYQICKSINFLHQNQLTHTDLKPENILFVHSDYVVHFN--HKQDERYLKNSDIKIVDFGSATYNDEYHSALVSTRHYRAPEVILELGWSQPCDVWSIGCILIEYYLGLTVFQTHDSKEHLAMMERILGPLPLHMIKKTRKHKYFYLDRLDWDEHSSAGRYVKKRCKPLKEYMVSDNKDHHQLFDLIQRMLEYDPAKRITLEEALKHPFF 371          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Clk2 (CDC-like kinase 2 [Source:MGI Symbol;Acc:MGI:1098669])

HSP 1 Score: 495.738 bits (1275), Expect = 1.825e-167
Identity = 239/356 (67.13%), Postives = 285/356 (80.06%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRL---PPHQRLHTLSSRRIS 2356
            DD EGHLIY  GD +  RY IV TLGEGTFG+VV+CVD+ +   +VALKIIKNVEKY+EAA LEINVL+ I EKDP++K L ++M +WFD++GHMCISFEL G S FDFLK+N+Y PYP+  VRH+++QLC AVKFLHD  LTHTDLKPENILFVNSD  L  N ++KRD+R VK++ +R++DFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI CIIFE Y G+TLFQTHDN+EHLAMMERILG  P RM RK+ K  +FY G+LDWD  +  GRYVRENC+PL RY T E ++  ++FDL+  MLEYEPA R++LG AL HPFF  L   PP+ +L   SSR IS
Sbjct:  143 DDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGTQVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPVPSRMIRKTRKQKYFYRGRLDWDENTSAGRYVRENCKPLRRYLTSEAEDHHQLFDLIENMLEYEPAKRLTLGEALQHPFFACLRTEPPNTKLWD-SSRDIS 497          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Clk2 (CDC-like kinase 2 [Source:MGI Symbol;Acc:MGI:1098669])

HSP 1 Score: 495.738 bits (1275), Expect = 1.889e-167
Identity = 239/356 (67.13%), Postives = 285/356 (80.06%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRL---PPHQRLHTLSSRRIS 2356
            DD EGHLIY  GD +  RY IV TLGEGTFG+VV+CVD+ +   +VALKIIKNVEKY+EAA LEINVL+ I EKDP++K L ++M +WFD++GHMCISFEL G S FDFLK+N+Y PYP+  VRH+++QLC AVKFLHD  LTHTDLKPENILFVNSD  L  N ++KRD+R VK++ +R++DFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI CIIFE Y G+TLFQTHDN+EHLAMMERILG  P RM RK+ K  +FY G+LDWD  +  GRYVRENC+PL RY T E ++  ++FDL+  MLEYEPA R++LG AL HPFF  L   PP+ +L   SSR IS
Sbjct:  144 DDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGTQVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPVPSRMIRKTRKQKYFYRGRLDWDENTSAGRYVRENCKPLRRYLTSEAEDHHQLFDLIENMLEYEPAKRLTLGEALQHPFFACLRTEPPNTKLWD-SSRDIS 498          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Clk2 (CDC-like kinase 2 [Source:MGI Symbol;Acc:MGI:1098669])

HSP 1 Score: 495.738 bits (1275), Expect = 1.954e-167
Identity = 239/356 (67.13%), Postives = 285/356 (80.06%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRL---PPHQRLHTLSSRRIS 2356
            DD EGHLIY  GD +  RY IV TLGEGTFG+VV+CVD+ +   +VALKIIKNVEKY+EAA LEINVL+ I EKDP++K L ++M +WFD++GHMCISFEL G S FDFLK+N+Y PYP+  VRH+++QLC AVKFLHD  LTHTDLKPENILFVNSD  L  N ++KRD+R VK++ +R++DFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI CIIFE Y G+TLFQTHDN+EHLAMMERILG  P RM RK+ K  +FY G+LDWD  +  GRYVRENC+PL RY T E ++  ++FDL+  MLEYEPA R++LG AL HPFF  L   PP+ +L   SSR IS
Sbjct:  145 DDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGTQVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPVPSRMIRKTRKQKYFYRGRLDWDENTSAGRYVRENCKPLRRYLTSEAEDHHQLFDLIENMLEYEPAKRLTLGEALQHPFFACLRTEPPNTKLWD-SSRDIS 499          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Clk3 (CDC-like kinase 3 [Source:MGI Symbol;Acc:MGI:1098670])

HSP 1 Score: 450.284 bits (1157), Expect = 7.267e-148
Identity = 209/343 (60.93%), Postives = 266/343 (77.55%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRM-ARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQR 2326
            DDKEGHL+   GD +  RY IV  LGEGTFGKVVEC+D+ +   +VALKII+NV KYREAA LEINVLK I+EKD E+K+L + M +WF+ +GHMCI+FEL G++ F+FLKEN++ PYP+ HVRH++YQLC A++FLH+  LTHTDLKPENILFVNS+   + N  +  +++ VKN+ IR+ DFGSATFDHEHH+TIV+TRHYR PEVILELGW++ CDVWSI CI+FE Y G+TLFQTH+N+EHL MME+ILG  P  M  R  K  +FY G L WD  S DGRYV+ENC+PL  Y   ++ E +++FDL+ +MLE++PA RI+L  AL HPFF  L P +R
Sbjct:  286 DDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHMAYQLCHALRFLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKNTSIRVADFGSATFDHEHHTTIVATRHYRPPEVILELGWAQPCDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGPIPSHMIHRTRKQKYFYKGGLVWDENSSDGRYVKENCKPLKSYMLQDSLEHVQLFDLMRRMLEFDPAQRITLAEALLHPFFAGLTPEER 628          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Clk4 (CDC like kinase 4 [Source:MGI Symbol;Acc:MGI:1098551])

HSP 1 Score: 429.483 bits (1103), Expect = 6.274e-142
Identity = 201/337 (59.64%), Postives = 257/337 (76.26%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRY--CTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            DD+EGHLI   GD++  RY IV TLGEG FGKVVEC+D+      VA+KI+KNV +YREAA  EI VL+ +   DP S +  ++ML WFDH+GH+CI FEL G S +DF+KENS+ P+ ++H+R ++YQ+C ++ FLH   LTHTDLKPENILFV SD ++  NSK KRD+R +KN++I+++DFGSAT+D EHHST+VSTRHYRAPEVIL LGWS+ CDVWSI CI+ E Y G+T+FQTHD+KEHLAMMERILG  P  M +K+ K  +F+H +LDWD +S  GRYVR  C+PL  +  C DE  E  ++FDLV +MLEY+PA RI+L  AL HPFF
Sbjct:  141 DDEEGHLICQSGDVLRARYEIVDTLGEGAFGKVVECIDHGMDGLHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVFRCVQMLEWFDHHGHVCIVFELLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINFLHHNKLTHTDLKPENILFVKSDYVVKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPAHMIQKTRKRKYFHHNQLDWDEHSSAGRYVRRRCKPLKEFMLCHDEEHE--KLFDLVRRMLEYDPARRITLDEALQHPFF 475          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P49760|CLK2_HUMAN (Dual specificity protein kinase CLK2 OS=Homo sapiens OX=9606 GN=CLK2 PE=1 SV=1)

HSP 1 Score: 499.975 bits (1286), Expect = 2.767e-168
Identity = 241/356 (67.70%), Postives = 285/356 (80.06%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRL---PPHQRLHTLSSRRIS 2356
            DD EGHLIY  GD +  RY IV TLGEGTFG+VV+CVD+ +   RVALKIIKNVEKY+EAA LEINVL+ I EKDP++K L ++M +WFD++GHMCISFEL G S FDFLK+N+Y PYP+  VRH+++QLC AVKFLHD  LTHTDLKPENILFVNSD  L  N ++KRD+R VK++ +R++DFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI CIIFE Y G+TLFQTHDN+EHLAMMERILG  P RM RK+ K  +FY G+LDWD  +  GRYVRENC+PL RY T E +E  ++FDL+  MLEYEPA R++LG AL HPFF RL   PP++     SSR IS
Sbjct:  145 DDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGARVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPIPSRMIRKTRKQKYFYRGRLDWDENTSAGRYVRENCKPLRRYLTSEAEEHHQLFDLIESMLEYEPAKRLTLGEALQHPFFARLRAEPPNKLWD--SSRDIS 498          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|O35491|CLK2_MOUSE (Dual specificity protein kinase CLK2 OS=Mus musculus OX=10090 GN=Clk2 PE=1 SV=2)

HSP 1 Score: 495.738 bits (1275), Expect = 1.321e-166
Identity = 239/356 (67.13%), Postives = 285/356 (80.06%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRL---PPHQRLHTLSSRRIS 2356
            DD EGHLIY  GD +  RY IV TLGEGTFG+VV+CVD+ +   +VALKIIKNVEKY+EAA LEINVL+ I EKDP++K L ++M +WFD++GHMCISFEL G S FDFLK+N+Y PYP+  VRH+++QLC AVKFLHD  LTHTDLKPENILFVNSD  L  N ++KRD+R VK++ +R++DFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI CIIFE Y G+TLFQTHDN+EHLAMMERILG  P RM RK+ K  +FY G+LDWD  +  GRYVRENC+PL RY T E ++  ++FDL+  MLEYEPA R++LG AL HPFF  L   PP+ +L   SSR IS
Sbjct:  144 DDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRGGTQVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPVPSRMIRKTRKQKYFYRGRLDWDENTSAGRYVRENCKPLRRYLTSEAEDHHQLFDLIENMLEYEPAKRLTLGEALQHPFFACLRTEPPNTKLWD-SSRDIS 498          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|P49762|DOA_DROME (Serine/threonine-protein kinase Doa OS=Drosophila melanogaster OX=7227 GN=Doa PE=1 SV=2)

HSP 1 Score: 492.271 bits (1266), Expect = 1.113e-160
Identity = 231/356 (64.89%), Postives = 284/356 (79.78%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMAR------KSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRLHTLSSRR 2350
            DD +GHLIY  GD++  RY+I+ TLGEGTFG+VV+  D ++    +ALKIIKNVEKYREAA LEIN L+ I +KDP   +L +KM++WFD++GHMCI FE+ G SVFDFL+EN+Y PYP++ VRH++YQLC++VKFLHD  LTHTDLKPENILFV+SD     N K  R+ R VKN+++RLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI CI+FELY G TLFQTHDN+EHLAMMERILG  PYRMAR      K+KT +FYHGKLDWD  S  GRYVR++C+PL      ++++  E+F L+ KMLEYEP+ RI+LG AL HPFF RLPPH R+  +S+++
Sbjct:  461 DDADGHLIYHTGDILHHRYKIMATLGEGTFGRVVKVKDMERDYC-MALKIIKNVEKYREAAKLEINALEKIAQKDPHCDHLCVKMIDWFDYHGHMCIVFEMLGLSVFDFLRENNYEPYPLDQVRHMAYQLCYSVKFLHDNRLTHTDLKPENILFVDSDYTSHYNHKINREVRRVKNTDVRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCILFELYLGITLFQTHDNREHLAMMERILGQIPYRMARNHTLYSKTKTKYFYHGKLDWDEKSSAGRYVRDHCKPLFLCQLSDSEDHCELFSLIKKMLEYEPSSRITLGEALHHPFFDRLPPHHRVGEVSNKQ 815          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3SX21|CLK3_BOVIN (Dual specificity protein kinase CLK3 OS=Bos taurus OX=9913 GN=CLK3 PE=2 SV=1)

HSP 1 Score: 447.588 bits (1150), Expect = 4.373e-148
Identity = 211/347 (60.81%), Postives = 267/347 (76.95%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRM-ARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQR-LHT 2335
            DDKEGHL+   GD +  RY IV  LGEGTFGKVVEC+D+ +   +VALKII+NV KYREAA LEINVLK I+EKD E+K+L + M +WF+ +GHMCI+FEL G++ F+FLKEN++ PYP+ HVRH++YQLC A++FLH+  LTHTDLKPENILFVNS+   + N  +  +++ VKN+ IR+ DFGSATFDHEHH+TIV+TRHYR PEVILELGW++ CDVWSI CI+FE Y G+TLFQTH+N+EHL MME+ILG  P  M  R  K  +FY G L WD  S DGRYV+ENC+PL  Y   +  E +++FDL+ +MLE++PA RI+L  AL HPFF  L P +R  HT
Sbjct:  138 DDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHMAYQLCHALRFLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKNTSIRVADFGSATFDHEHHTTIVATRHYRPPEVILELGWAQPCDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGPIPSHMIHRTRKQKYFYKGGLVWDENSSDGRYVKENCKPLKSYMLQDTLEHVQLFDLMRRMLEFDPAQRITLAEALLHPFFAGLTPEERSFHT 484          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q63117|CLK3_RAT (Dual specificity protein kinase CLK3 OS=Rattus norvegicus OX=10116 GN=Clk3 PE=1 SV=2)

HSP 1 Score: 447.588 bits (1150), Expect = 5.847e-148
Identity = 209/343 (60.93%), Postives = 266/343 (77.55%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRM-ARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQR 2326
            DDKEGHL+   GD +  RY IV  LGEGTFGKVVEC+D+ +   +VALKII+NV KYREAA LEINVLK I+EKD E+K+L + M +WF+ +GHMCI+FEL G++ F+FLKEN++ PYP+ HVRH++YQLC A++FLH+  LTHTDLKPENILFVNS+   + N  +  +++ VKN+ IR+ DFGSATFDHEHH+TIV+TRHYR PEVILELGW++ CDVWSI CI+FE Y G+TLFQTH+N+EHL MME+ILG  P  M  R  K  +FY G L WD  S DGRYV+ENC+PL  Y   ++ E +++FDL+ +MLE++PA RI+L  AL HPFF  L P +R
Sbjct:  138 DDKEGHLVCRIGDWLQERYEIVGNLGEGTFGKVVECLDHARGKSQVALKIIRNVGKYREAARLEINVLKKIKEKDKENKFLCVLMSDWFNFHGHMCIAFELLGKNTFEFLKENNFQPYPLPHVRHMAYQLCHALRFLHENQLTHTDLKPENILFVNSEFETLYNEHKSCEEKSVKNTSIRVADFGSATFDHEHHTTIVATRHYRPPEVILELGWAQPCDVWSIGCILFEYYRGFTLFQTHENREHLVMMEKILGPIPSHMIHRTRKQKYFYKGGLVWDENSSDGRYVKENCKPLKSYMLQDSLEHVQLFDLMRRMLEFDPAQRITLAEALLHPFFAGLTPEER 480          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A5K3EUP7 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 279/405 (68.89%), Postives = 332/405 (81.98%), Query Frame = 2
Query: 1148 NRVAEARQRAKKLIELRKKSMG----------DLSNRTSVEEPLKVSSKSMQISDSEVPPCDDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRLH 2332
            +RVAEARQRAKK IE RK SM           D SN+   E P + SSK+         P DD +GHLIY   D ++ RY I+KTLGEGTFGKVVEC+D+  +  R+ALKIIKNV+KYREAA+LEINVL  ++E+DP  +YL +++L+WFD+YGH+C++F++ G SVFDFLKEN+Y  YP+EHVRHISYQLC AV+F+HD  LTHTDLKPENILF  SD I V N K++R DR+VK S++RLIDFGSATFD++HHSTIVSTRHYRAPEVILELGWS+ CDVWSI CIIFELYTGYTLFQTHDN+EHLAMMER LGH PYRM RKS+T FFYHG+LDWDFYS +GRYVRENCRPLLRYC +E+Q+T++MFDL+SKMLEY+PADRI L AALSHPFFLR+P HQRL+
Sbjct:  762 SRVAEARQRAKKFIEQRKLSMQQQQQQPQQNCDGSNQRLSEPPEEASSKAA--------PTDDVDGHLIYVPHDFVLDRYEIIKTLGEGTFGKVVECIDH-HTDTRIALKIIKNVDKYREAAMLEINVLNFLRERDPNDEYLCVRLLDWFDYYGHICLAFDILGLSVFDFLKENNYVGYPIEHVRHISYQLCHAVRFMHDNQLTHTDLKPENILFNRSDYISVHNRKKRRYDRIVKCSDVRLIDFGSATFDYDHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFELYTGYTLFQTHDNREHLAMMERTLGHIPYRMTRKSRTGFFYHGRLDWDFYSQEGRYVRENCRPLLRYCKEESQDTLDMFDLISKMLEYDPADRICLAAALSHPFFLRIPSHQRLN 1157          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0X3PXS1 (Dual specificity protein kinase CLK2 OS=Schistocephalus solidus OX=70667 GN=CLK2 PE=4 SV=1)

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 273/394 (69.29%), Postives = 328/394 (83.25%), Query Frame = 2
Query: 1148 NRVAEARQRAKKLIELRKKSMGDLSNRTSVEEPLKVSSKSMQISDSEVPPCDDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRL 2329
            NR+AEARQRAKK IE RK       N   VE  L+   + +  + S   P DD +GHLIY   D I  RY I++TLGEGTFGKVVEC D+ Q+ + +ALKIIKNV+KYREAA+LEINVL  ++E+DPE +YL +++L+WFD+YGH+C++F++ G SVFDFLKEN+Y  YP+EHVRHISYQLC AV+F+HD  LTHTDLKPENILF  SD I V N K++R DR+VK+S++RLIDFGSATFD++HHSTIVSTRHYRAPEVILELGWS+ CDVWSI CIIFELYTGYTLFQTHDN+EHLAMMER LGH PYRM RKS+T FFYHG+LDWDFYS +GRYVRENCRPLLRYC +E+Q+T++MFDL+SKMLEY+PADRI L AA++HPFFLR+P HQRL
Sbjct:  474 NRLAEARQRAKKFIEQRKLCGQPPQNLIPVEAGLQEPEEPLDEASSRNLPVDDVDGHLIYAIHDWIFDRYEILRTLGEGTFGKVVECKDH-QTGENIALKIIKNVDKYREAAMLEINVLNFLRERDPEDEYLCVRLLDWFDYYGHICLAFDILGLSVFDFLKENNYVGYPIEHVRHISYQLCHAVRFMHDNQLTHTDLKPENILFKRSDYISVHNRKKRRYDRIVKSSDVRLIDFGSATFDYDHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFELYTGYTLFQTHDNREHLAMMERTLGHIPYRMTRKSRTGFFYHGRLDWDFYSQEGRYVRENCRPLLRYCKEESQDTLDMFDLISKMLEYDPADRIPLSAAMTHPFFLRIPVHQRL 866          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A564Z224 (Protein kinase domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS11334 PE=4 SV=1)

HSP 1 Score: 594.349 bits (1531), Expect = 0.000e+0
Identity = 276/397 (69.52%), Postives = 332/397 (83.63%), Query Frame = 2
Query: 1148 NRVAEARQRAKKLIELRKKSMGDLSNRTSVE-EPLKVSSKSMQIS-DSEVPPCDDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRLH 2332
            +RVAEARQRAKK IE RK SM     +   + E    SS+  +    S VPP DD +GHLIY   D I+ RY I+KTLGEGTFGKVVEC+D+   S R+ALKIIKNV+KYREAA+LEINVL  ++E+DP  +YL +++L+WFD++GH+C++F++ G SVFDFLKEN+Y  YP+EHVRHISYQLC AV+F+HD  LTHTDLKPENILF  SD I V N K++R DR+VK S++RLIDFGSATFD++HHSTIVSTRHYRAPEVILELGWS+ CDVWSI CIIFELYTGYTLFQTHDN+EHLAMMER LGH PYRM RKS+T FFYHG+LDWDFYSP+GRYVRENCRPLLRYC +E+Q+T++MFDL+SKMLEY+PADRI L AA++HPFFLR+P +QRL+
Sbjct:  424 SRVAEARQRAKKFIEQRKLSMQQQQQQNQQDVESYDGSSQPFEDDMGSRVPPMDDVDGHLIYSPHDYILDRYEILKTLGEGTFGKVVECIDHHTDS-RIALKIIKNVDKYREAAMLEINVLNFLRERDPNDEYLCVRLLDWFDYFGHICLAFDILGLSVFDFLKENNYVGYPIEHVRHISYQLCHAVRFMHDNQLTHTDLKPENILFNRSDYISVHNRKKRRYDRIVKCSDVRLIDFGSATFDYDHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFELYTGYTLFQTHDNREHLAMMERTLGHIPYRMTRKSRTGFFYHGRLDWDFYSPEGRYVRENCRPLLRYCKEESQDTLDMFDLISKMLEYDPADRICLAAAMTHPFFLRIPSNQRLN 819          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0V0J4B7 (Protein kinase domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR97748 PE=4 SV=1)

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 260/377 (68.97%), Postives = 318/377 (84.35%), Query Frame = 2
Query: 1199 KKSMGDLSNRTSVEEPLKVSSKSMQISDSEVPPCDDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRL 2329
            +K+ G L+N   ++E    SS+++        P DD +GHLIY   D I  RY I++TLGEGTFGKVVEC D+ Q+ + +ALKIIKNV+KYREAA+LEINVL  ++E+DPE +YL +++L+WFD+YGH+C++F++ G SVFDFLKEN+Y  YP+EHVRHISYQLC AV+F+HD  LTHTDLKPENILF  SD I V N K++R DR+VK+S++RLIDFGSATFD++HHSTIVSTRHYRAPEVILELGWS+ CDVWSI CIIFELYTGYTLFQTHDN+EHLAMMER LGH PYRM RKS+T FFYHG+LDWDFYS +GRYVRENCRPLLRYC +E+Q+T++MFDL+SKMLEY+PADRI L AA++HPFFLR+P HQRL
Sbjct: 1277 RKAPGPLANAVPLDE---ASSRNL--------PVDDVDGHLIYAIHDWIFDRYEILRTLGEGTFGKVVECKDH-QTGENIALKIIKNVDKYREAAMLEINVLNFLRERDPEDEYLCVRLLDWFDYYGHICLAFDILGLSVFDFLKENNYVGYPIEHVRHISYQLCHAVRFMHDNQLTHTDLKPENILFKRSDYISVHNRKKRRYDRIVKSSDVRLIDFGSATFDYDHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFELYTGYTLFQTHDNREHLAMMERTLGHIPYRMTRKSRTGFFYHGRLDWDFYSQEGRYVRENCRPLLRYCKEESQDTLDMFDLISKMLEYDPADRIPLSAAMTHPFFLRIPVHQRL 1641          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0X3Q7P9 (Protein kinase domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR97748 PE=4 SV=1)

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 260/377 (68.97%), Postives = 318/377 (84.35%), Query Frame = 2
Query: 1199 KKSMGDLSNRTSVEEPLKVSSKSMQISDSEVPPCDDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRL 2329
            +K+ G L+N   ++E    SS+++        P DD +GHLIY   D I  RY I++TLGEGTFGKVVEC D+ Q+ + +ALKIIKNV+KYREAA+LEINVL  ++E+DPE +YL +++L+WFD+YGH+C++F++ G SVFDFLKEN+Y  YP+EHVRHISYQLC AV+F+HD  LTHTDLKPENILF  SD I V N K++R DR+VK+S++RLIDFGSATFD++HHSTIVSTRHYRAPEVILELGWS+ CDVWSI CIIFELYTGYTLFQTHDN+EHLAMMER LGH PYRM RKS+T FFYHG+LDWDFYS +GRYVRENCRPLLRYC +E+Q+T++MFDL+SKMLEY+PADRI L AA++HPFFLR+P HQRL
Sbjct: 1272 RKAPGPLANAVPLDE---ASSRNL--------PVDDVDGHLIYAIHDWIFDRYEILRTLGEGTFGKVVECKDH-QTGENIALKIIKNVDKYREAAMLEINVLNFLRERDPEDEYLCVRLLDWFDYYGHICLAFDILGLSVFDFLKENNYVGYPIEHVRHISYQLCHAVRFMHDNQLTHTDLKPENILFKRSDYISVHNRKKRRYDRIVKSSDVRLIDFGSATFDYDHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCIIFELYTGYTLFQTHDNREHLAMMERTLGHIPYRMTRKSRTGFFYHGRLDWDFYSQEGRYVRENCRPLLRYCKEESQDTLDMFDLISKMLEYDPADRIPLSAAMTHPFFLRIPVHQRL 1636          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: clk2a (dual specificity protein kinase CLK2 [Source:NCBI gene;Acc:103024244])

HSP 1 Score: 486.108 bits (1250), Expect = 1.660e-163
Identity = 224/335 (66.87%), Postives = 272/335 (81.19%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            DD+EGHLI   GD++  RY IV TLGEGTFG+V+EC+D+ +    VALKIIKNVEKY+EAA LEINVL+ I E+DPE+K L ++M +WFD++GHMC+SFEL   S FDFLKEN+Y PY +  VRH++YQ+C AVKFLHD  LTHTDLKPENILFVNSD  +  N ++KRD+R+VKN+ +R++DFGSATFDHEHHSTIVSTRHYRAPEVILELGW++ CDVWSI CI+FE Y G+TLFQTHDN+EHLAMMERILG  P RM RK+ K  +FY G+LDWD  S  GRYVRENC+PL RY   E +E  ++FDL+  MLEYEP+ RI+L A+L HPFF
Sbjct:  165 DDEEGHLICRSGDVLQERYEIVGTLGEGTFGRVMECIDHRRGGSHVALKIIKNVEKYKEAARLEINVLEKINERDPENKNLCVQMFDWFDYHGHMCLSFELLALSTFDFLKENNYLPYSISQVRHMAYQICLAVKFLHDNKLTHTDLKPENILFVNSDFTITYNVEKKRDERMVKNTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWNQPCDVWSIGCILFEYYLGFTLFQTHDNREHLAMMERILGPVPSRMIRKTRKQKYFYRGRLDWDENSSAGRYVRENCKPLRRYILSEAEEHHQLFDLIEAMLEYEPSKRITLAASLRHPFF 499          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: clk2a (dual specificity protein kinase CLK2 [Source:NCBI gene;Acc:103024244])

HSP 1 Score: 486.108 bits (1250), Expect = 1.660e-163
Identity = 224/335 (66.87%), Postives = 272/335 (81.19%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            DD+EGHLI   GD++  RY IV TLGEGTFG+V+EC+D+ +    VALKIIKNVEKY+EAA LEINVL+ I E+DPE+K L ++M +WFD++GHMC+SFEL   S FDFLKEN+Y PY +  VRH++YQ+C AVKFLHD  LTHTDLKPENILFVNSD  +  N ++KRD+R+VKN+ +R++DFGSATFDHEHHSTIVSTRHYRAPEVILELGW++ CDVWSI CI+FE Y G+TLFQTHDN+EHLAMMERILG  P RM RK+ K  +FY G+LDWD  S  GRYVRENC+PL RY   E +E  ++FDL+  MLEYEP+ RI+L A+L HPFF
Sbjct:  165 DDEEGHLICRSGDVLQERYEIVGTLGEGTFGRVMECIDHRRGGSHVALKIIKNVEKYKEAARLEINVLEKINERDPENKNLCVQMFDWFDYHGHMCLSFELLALSTFDFLKENNYLPYSISQVRHMAYQICLAVKFLHDNKLTHTDLKPENILFVNSDFTITYNVEKKRDERMVKNTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWNQPCDVWSIGCILFEYYLGFTLFQTHDNREHLAMMERILGPVPSRMIRKTRKQKYFYRGRLDWDENSSAGRYVRENCKPLRRYILSEAEEHHQLFDLIEAMLEYEPSKRITLAASLRHPFF 499          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: clk4a (dual specificity protein kinase CLK4-like [Source:NCBI gene;Acc:103029292])

HSP 1 Score: 442.58 bits (1137), Expect = 6.073e-147
Identity = 199/335 (59.40%), Postives = 264/335 (78.81%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            DD+EGHLIY  GD++  RY IV TLGEG FGKVVEC+D    + RVALKIIKN+++YREAA+ E+ VL+ +   D + +Y  ++ML+WFDH+GH+CI+FEL G S FDFLKEN++ P+P++ +RH++YQ+  AVKFLH   LTHTDLKPENILF++S+  L  NSK KRD+R V+N++++++DFG+AT++HEHH+T+VSTRHYRAPEVILELGWS SCDVWSI CI+ E Y G TLFQTHD+KEHLAMMER+LG  P  M +K+ K  + +H +LDWD +S  GRYVR++C+PL +Y   ++ +  E+FDL+ KMLEY+   RISL  A+ HPFF
Sbjct:  149 DDEEGHLIYHSGDILRARYEIVCTLGEGAFGKVVECIDRSNRNARVALKIIKNIDRYREAAMSEVEVLEQMNSLDCDRRYSCVRMLDWFDHHGHVCIAFELLGLSTFDFLKENNFQPFPVDQIRHMAYQIIRAVKFLHKNKLTHTDLKPENILFIDSEYDLEYNSKMKRDERTVRNADVKVVDFGNATYEHEHHTTVVSTRHYRAPEVILELGWSHSCDVWSIGCILIEYYLGSTLFQTHDSKEHLAMMERVLGPIPACMLQKTRKQRYVHHDRLDWDVHSSSGRYVRKHCKPLRQYMKSKSLDHEELFDLIEKMLEYDVTKRISLDEAIRHPFF 483          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000007667.2 (dual specificity protein kinase CLK4 [Source:NCBI gene;Acc:103034991])

HSP 1 Score: 430.639 bits (1106), Expect = 2.164e-142
Identity = 194/335 (57.91%), Postives = 262/335 (78.21%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTS-FFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            DD+EGHLIY +GDM+  RY IV T+GEG FGKVVEC+D+ +   RVALKIIKN+E+YREAAL E+ VLK +   D E+++  ++ML+WFDH+GH+CI FEL G S +DFLKEN + P+ ++ +R ++YQLC AV FLH   LTHTDLKPENILFVNS+     N+K KRD++ +KN  ++++DFG+AT+DHE+H+++VSTRHYRAPEVILELGW++SCDVWS+ CI+ E Y G TLFQTHD+KEHLAMMER+LG  P  M +K+K   + +H KLDWD ++  GRYVR++C+PL +Y + +  +  ++FDL+ KM+EY+ + RI+L  AL HPFF
Sbjct:  143 DDEEGHLIYHNGDMLRARYEIVGTVGEGAFGKVVECIDHSKDGLRVALKIIKNLERYREAALSEVEVLKQMNSLDSENRFACVQMLDWFDHHGHICIVFELLGLSTYDFLKENDFMPFTVDQIRFMAYQLCRAVHFLHRNKLTHTDLKPENILFVNSEYDTEYNAKLKRDEKTLKNLHVKVVDFGNATYDHEYHTSVVSTRHYRAPEVILELGWNQSCDVWSLGCILIEYYLGITLFQTHDSKEHLAMMERVLGPIPVNMLQKTKKQRYVHHEKLDWDEHTSSGRYVRKHCKPLKQYMSSKTSDHEQLFDLLHKMMEYDVSKRITLEEALRHPFF 477          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: clk2b (CDC-like kinase 2b [Source:ZFIN;Acc:ZDB-GENE-060929-1126])

HSP 1 Score: 421.779 bits (1083), Expect = 1.515e-141
Identity = 196/291 (67.35%), Postives = 238/291 (81.79%), Query Frame = 2
Query: 1433 RVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            R+ALKIIKNVEKY+EAA LEINVL+ I+EKDPE+K+L ++M +WFD++GHMCISFEL   S FDF+KEN+Y PY +  VRH+++Q+C AVKFLHD  LTHTDLKPENILFV+SD I   N+++KR++R VK++ +R++DFGSATFDHEHHSTIVSTRHYRAPEVILELGWS+ CDVWSI CI+FE Y GYTLFQTHDN+EHLAMMERI G  P RM RK+ K  +FY G+LDWD  S  GRYVRENC+PL RY   E +E  ++FDL+  MLEYEP  R+ L + L HPFF
Sbjct:    7 RIALKIIKNVEKYKEAARLEINVLEKIREKDPENKHLCVQMFDWFDYHGHMCISFELLALSTFDFMKENNYLPYSLSQVRHMAFQICIAVKFLHDNKLTHTDLKPENILFVSSDFITNYNTEKKREERSVKDTSVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCILFEYYLGYTLFQTHDNREHLAMMERIQGPIPSRMIRKTRKQKYFYRGRLDWDENSSAGRYVRENCKPLRRYVLSEAEEHHQLFDLLEGMLEYEPERRLLLSSCLRHPFF 297          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: clk2a (CDC-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-030131-298])

HSP 1 Score: 486.493 bits (1251), Expect = 1.584e-164
Identity = 222/343 (64.72%), Postives = 278/343 (81.05%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQR 2326
            DD++GHLIY  GD +  RY I+ TLGEGTFGKVV C+D+D+   ++ALKIIKNV+KYREAA LEINVL+ I EKDP +KYL ++M +WFD++GHMCI+FEL G S FDFLKEN+Y PYP+  VR ++YQLC+A+KFLHD  LTHTDLKPENILFV+S+  +  N ++KRD+R V+N++IR++DFGSATFD+EHHSTIVSTRHYRAPEV+LELGWS+ CDVWSI CI+FE Y G+TLFQTHDN+EHLAMMER LG  P RM R++ K  +F+HG LDWD  S  G+YVRENC+PL RY   ++ +  ++FDL+ KML+YEP+ RI+LG AL HPFF  L   QR
Sbjct:  151 DDEDGHLIYRIGDWLQARYEIISTLGEGTFGKVVHCIDHDRGKAKIALKIIKNVDKYREAARLEINVLEKINEKDPRNKYLCVQMYDWFDYHGHMCIAFELLGLSTFDFLKENNYLPYPLHQVRLMAYQLCYAIKFLHDNKLTHTDLKPENILFVDSEYDIKYNPQKKRDERTVRNADIRVVDFGSATFDYEHHSTIVSTRHYRAPEVLLELGWSQPCDVWSIGCIVFEFYLGFTLFQTHDNREHLAMMERTLGLIPSRMVRRTRKQKYFHHGHLDWDESSSAGKYVRENCKPLRRYVVCDDAQHHQLFDLIEKMLQYEPSKRITLGEALKHPFFDLLAQDQR 493          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: dyrk2 (dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2804])

HSP 1 Score: 180.259 bits (456), Expect = 1.201e-48
Identity = 108/354 (30.51%), Postives = 182/354 (51.41%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFY-----HGKLDWDFYSPDGRYVRENCR----------------PLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPF 2299
            DD++G  ++   D +  RY ++K +G+G+FG+VV+  D+ ++   VALK+++N +++   A  EI +L+ ++++D E+    I +L  F   GH+C++FEL   ++++ +K+N +  + +  VR  ++ +   +  LH   + H DLKPENIL              K+  R    S I++IDFGS+ F+H+   T + +R YRAPEV+L   +    D+WS+ CI+ EL TG  L    D  + LA    +LG  P R+  + K S  +     H +      +PDG  V    R                  LR C D       + D +   LE+EP++R++   AL HP+
Sbjct:  144 DDEQGSYVHVAHDHVAYRYEVLKVIGKGSFGQVVKAFDH-KTQTHVALKMVRNEKRFHRQAAEEIRILEHLRKQDRENSMNIIHLLESFTFRGHVCMTFELLSMNLYELIKKNKFQGFSLALVRKFAHSILQCLDTLHRNRIIHCDLKPENILL-------------KQPGR----SGIKVIDFGSSCFEHQRVYTYIQSRFYRAPEVVLGARYGPPIDMWSLGCILAELLTGSPLLPGEDEGDQLACAMELLGMPPQRLLAQGKRSRNFVSSRGHPRYCGVTEAPDGAVVLNAGRSRRGKPRGPPGSRELPAALRGCDDP-----LLLDFLRGCLEWEPSERLTPAQALRHPW 474          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007952.1 (pep scaffold:Pmarinus_7.0:GL476685:157428:173166:-1 gene:ENSPMAG00000007188.1 transcript:ENSPMAT00000007952.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.77 bits (408), Expect = 1.724e-44
Identity = 108/343 (31.49%), Postives = 171/343 (49.85%), Query Frame = 2
Query: 1316 HLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCR-------PLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFL--RLPP 2317
            HL+Y        RY +++ LG+G+FGKV++C+D+ +S + VA+K++            EI +LK +Q     SK   I+M+  F   G  C+ FEL   ++   LK      + +E VR  +  L  +++ L D ++ H DLKP NI   + ++                  E++L DFG + FDHE H T + TRHYRAPEVIL+LG+S   D+WS+ C + EL++G  LF  H N++ L  +  + G  P  M  +S+    +    D   +S + R  R   R       PL    TDE+       D +   L+++P  R++   A+ H +    R+PP
Sbjct:    6 HLLY--------RYEVLEVLGQGSFGKVLKCLDH-KSKEFVAIKVLNRARFNESVHRREIEILKRLQTARESSK--IIRMMEHFSFRGRECVVFELLNGNLRSQLKLTHRQGFGLEMVRLFAISLLKSLEQLRDANVIHGDLKPGNIGICSYEA-----------------GEVKLFDFGCSCFDHEEHFTKIQTRHYRAPEVILDLGYSFPADMWSLGCTLAELHSGQKLFPGHTNEDQLHSIMEVFGLPPQDMIEESRVQLGFFACKD---FSSNVRLNRGLVRVPGSRALPLALRTTDEH-----FTDFIRSCLQWDPEWRLTPHGAMDHEWVRAPRMPP 312          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007958.1 (pep scaffold:Pmarinus_7.0:GL476685:157443:173166:-1 gene:ENSPMAG00000007188.1 transcript:ENSPMAT00000007958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.384 bits (407), Expect = 2.340e-44
Identity = 109/338 (32.25%), Postives = 170/338 (50.30%), Query Frame = 2
Query: 1316 HLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKT--SFFYHGK-LDWDFYSPDG--RYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLP 2314
            HL+Y        RY +++ LG+G+FGKV++C+D+ +S + VA+K++            EI +LK +Q     SK   I+M+  F   G  C+ FEL   ++   LK      + +E VR  +  L  +++ L D ++ H DLKP NI   + ++                  E++L DFG + FDHE H T + TRHYRAPEVIL+LG+S   D+WS+ C + EL++G  LF  H N++ L  +  + G  P  M  +S+    FF   K   WD  +  G  R       PL    TDE+       D +   L+++P  R++   A+ H  ++R P
Sbjct:    6 HLLY--------RYEVLEVLGQGSFGKVLKCLDH-KSKEFVAIKVLNRARFNESVHRREIEILKRLQTARESSK--IIRMMEHFSFRGRECVVFELLNGNLRSQLKLTHRQGFGLEMVRLFAISLLKSLEQLRDANVIHGDLKPGNIGICSYEA-----------------GEVKLFDFGCSCFDHEEHFTKIQTRHYRAPEVILDLGYSFPADMWSLGCTLAELHSGQKLFPGHTNEDQLHSIMEVFGLPPQDMIEESRVQLGFFAITKPTHWDINNHRGLVRVPGSRALPLALRTTDEH-----FTDFIRSCLQWDPEWRLTPHGAMDHE-WVRAP 309          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007962.1 (pep scaffold:Pmarinus_7.0:GL476685:157455:173154:-1 gene:ENSPMAG00000007188.1 transcript:ENSPMAT00000007962.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 159.458 bits (402), Expect = 9.041e-44
Identity = 104/340 (30.59%), Postives = 164/340 (48.24%), Query Frame = 2
Query: 1316 HLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCR------------PLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPF 2299
            HL+Y        RY +++ LG+G+FGKV++C+D+ +S + VA+K++            EI +LK +Q     SK   I+M+  F   G  C+ FEL   ++   LK      + +E VR  +  L  +++ L D ++ H DLKP NI   + ++                  E++L DFG + FDHE H T + TRHYRAPEVIL+LG+S   D+WS+ C + EL++G  LF  H N++ L  +  + G  P  M  +S+            F+   GR     C             PL    TDE+       D +   L+++P  R++   A+ H +
Sbjct:    2 HLLY--------RYEVLEVLGQGSFGKVLKCLDH-KSKEFVAIKVLNRARFNESVHRREIEILKRLQTARESSK--IIRMMEHFSFRGRECVVFELLNGNLRSQLKLTHRQGFGLEMVRLFAISLLKSLEQLRDANVIHGDLKPGNIGICSYEA-----------------GEVKLFDFGCSCFDHEEHFTKIQTRHYRAPEVILDLGYSFPADMWSLGCTLAELHSGQKLFPGHTNEDQLHSIMEVFGLPPQDMIEESRVQL--------GFFVKSGRRFSVQCSNVRLKVPGSRALPLALRTTDEH-----FTDFIRSCLQWDPEWRLTPHGAMDHEW 300          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: KNS1 (Protein kinase involved in negative regulation of PolIII transcription; effector kinase of the TOR signaling pathway and phosphorylates Rpc53p to regulate ribosome and tRNA biosynthesis; member of the LAMMER family of protein kinases, which are serine/threonine kinases also capable of phosphorylating tyrosine residues; capable of autophosphorylation [Source:SGD;Acc:S000003942])

HSP 1 Score: 249.98 bits (637), Expect = 3.221e-72
Identity = 123/288 (42.71%), Postives = 185/288 (64.24%), Query Frame = 2
Query: 1304 DKEGHLIYGHGDMIM--GRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSI--------LVPNSKRKRDD-----RVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGH-FPYRMARKSKTSFFYHGK 2119
            DK+GH +Y   D+    GR+ +   LG+GTFGKV++C+DN      VA+K+I+ V++YREAA  E+ +L+ I   DP+ ++  + +   FD+  H+C+  +L G+S++DF+  N  + +P  H++ I+ QL  +V FLHD+ + HTDLKPENIL  +   I        +   SKR+R+      +++KN EI++IDFGSA F +E+H  ++STRHYRAPE++L LGWS  CD+WSIAC++ EL  G +L+  H+N EH+AMM+RI G  FP  +  K     FY  K
Sbjct:  294 DKDGHYVYQENDIFGSGGRFVVKDLLGQGTFGKVLKCIDNKYEPNYVAVKVIRAVDRYREAAKTELRILQTILNNDPQGQFQCLLLRECFDYKNHICLVTDLYGRSIYDFMCSNGIARFPGSHIQAIARQLIRSVCFLHDLGIIHTDLKPENILICDETHIAQKLPLKTVQSLSKRRREASKGKRKILKNPEIKIIDFGSAIFHYEYHPPVISTRHYRAPEIVLGLGWSFPCDIWSIACVLVELVIGESLYPIHENLEHMAMMQRINGTPFPTDIIDK----MFYKSK 577          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: YAK1 (Serine-threonine protein kinase; component of a glucose-sensing system that inhibits growth in response to glucose availability; upon nutrient deprivation Yak1p phosphorylates Pop2p to regulate mRNA deadenylation, the co-repressor Crf1p to inhibit transcription of ribosomal genes, and the stress-responsive transcription factors Hsf1p and Msn2p; nuclear localization negatively regulated by the Ras/PKA signaling pathway in the presence of glucose [Source:SGD;Acc:S000003677])

HSP 1 Score: 150.214 bits (378), Expect = 8.023e-38
Identity = 82/258 (31.78%), Postives = 142/258 (55.04%), Query Frame = 2
Query: 1352 RYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEK-DPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKL 2122
            +Y ++  LG+GTFG+VV+C  N  + + +A+K++K+  +Y   ++ E  +L+++ +K DP +K+ F++M + F H  H+C+ FEL   ++++ LK+N +    ++ +R  + Q+  ++  L +  L H DLKPENIL    D                   E+++IDFGS+  +     T + +R YRAPE+IL + +S S D+WS+ CI+ EL+ G  +F        L  +   LG+ P  M    K S  +  KL
Sbjct:  368 KYLVLDILGQGTFGQVVKC-QNLLTKEILAVKVVKSRTEYLTQSITEAKILELLNQKIDPTNKHHFLRMYDSFVHKNHLCLVFELLSNNLYELLKQNKFHGLSIQLIRTFTTQILDSLCVLKESKLIHCDLKPENILLCAPDK-----------------PELKIIDFGSSCEEARTVYTYIQSRFYRAPEIILGIPYSTSIDMWSLGCIVAELFLGIPIFPGASEYNQLTRIIDTLGYPPSWMIDMGKNSGKFMKKL 607          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: KSS1 (Mitogen-activated protein kinase (MAPK); involved in signal transduction pathways that control filamentous growth and pheromone response; regulates septum assembly, and may directly phosphorylate Bni4p; the KSS1 gene is nonfunctional in S288C strains and functional in W303 strains [Source:SGD;Acc:S000003272])

HSP 1 Score: 97.0561 bits (240), Expect = 4.477e-22
Identity = 92/349 (26.36%), Postives = 154/349 (44.13%), Query Frame = 2
Query: 1343 IMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEK-------YREAALLEI-----NVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFL--KENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSA---TFDHEHHSTI-------VSTRHYRAPEVILELG-WSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILG--HFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETI--EMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            I  +Y++V  +GEG +G V   + +  S  +VA+K I+   K        RE  LL       N++ ++ +  P S           D    + +  EL    +   +  + + +S    +HV++ +YQ+  A+K +H   + H D+KP N+L +NS                  N ++++ DFG A       +   T+       V+TR YRAPE++L    ++ + D+WS  CI+ E+ +G  LF   D    L ++  +LG   F      KSK +  Y   L                RP L + T  ++  +  +M DL+ KML++ P  RIS   AL HP+ 
Sbjct:    9 IPSQYKLVDLIGEGAYGTVCSAI-HKPSGIKVAIKKIQPFSKKLFVTRTIREIKLLRYFHEHENIISILDKVRPVS----------IDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQILRALKSIHSAQVIHRDIKPSNLL-LNS------------------NCDLKVCDFGLARCLASSSDSRETLVGFMTEYVATRWYRAPEIMLTFQEYTTAMDIWSCGCILAEMVSGKPLFPGRDYHHQLWLILEVLGTPSFEDFNQIKSKRAKEYIANLP--------------MRPPLPWETVWSKTDLNPDMIDLLDKMLQFNPDKRISAAEALRHPYL 313          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: FUS3 (Mitogen-activated serine/threonine protein kinase involved in mating; phosphoactivated by Ste7p; substrates include Ste12p, Far1p, Bni1p, Sst2p; inhibits invasive growth during mating by phosphorylating Tec1p, promoting its; inhibits recruitment of Ste5p, Cdc42p-mediated asymmetry and mating morphogenesis [Source:SGD;Acc:S000000112])

HSP 1 Score: 92.8189 bits (229), Expect = 1.098e-20
Identity = 91/333 (27.33%), Postives = 152/333 (45.65%), Query Frame = 2
Query: 1343 IMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEK--YREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSA-----TFDHEHHSTIVSTRHYRAPEVILELG-WSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETI-----EMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            I   +++   LGEG +G VV    +  + + VA+K I+  +K  +    L EI +LK  + ++  + +  I+  + F+++  + I  EL    +   +     S    +H+++  YQ   AVK LH  ++ H DLKP N+L +NS+           D +V      R+ID  +A     T      +  V+TR YRAPEV+L    +S + DVWS  CI+ EL+    +F   D +  L ++  I+G  P+                D D    +    RE  + L  Y     ++       +  DL+ +ML ++PA RI+   AL HP+ 
Sbjct:    9 ISSDFQLKSLLGEGAYG-VVCSATHKPTGEIVAIKKIEPFDKPLFALRTLREIKILKHFKHENIITIF-NIQRPDSFENFNEVYIIQELMQTDLHRVISTQMLSD---DHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLL-INSNC----------DLKVCDFGLARIIDESAADNSEPTGQQSGMTEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFLRRPIFPGRDYRHQLLLIFGIIGT-PHS---------------DNDLRCIESPRAREYIKSLPMYPAAPLEKMFPRVNPKGIDLLQRMLVFDPAKRITAKEALEHPYL 309          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: MCK1 (Dual-specificity ser/thr and tyrosine protein kinase; roles in chromosome segregation, meiotic entry, genome stability, phosphorylation-dependent protein degradation (Rcn1p and Cdc6p), inhibition of protein kinase A, transcriptional regulation, inhibition of RNA pol III, calcium stress and inhibition of Clb2p-Cdc28p after nuclear division; MCK1 has a paralog, YGK3, that arose from the whole genome duplication [Source:SGD;Acc:S000005251])

HSP 1 Score: 92.4337 bits (228), Expect = 1.554e-20
Identity = 79/334 (23.65%), Postives = 143/334 (42.81%), Query Frame = 2
Query: 1340 MIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSP----YPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSA-TFDHEHHS-TIVSTRHYRAPEVILELG-WSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETI------EMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            M++  YR    +G G FG VV+          +    IK V  + E    E+ +L++    +      F   L+  D+  +  ++ E   +++   ++ N Y       P++H+R  +YQ+   + +LH + + H D+KP N+L      +L                  ++ DFGSA   +H   S + + +R YRAPE+I+    ++   D+W + C++ E+  G  +FQ  +    L  + ++LG          +  FF +   D   +S          +PL    + +  E        +  DL+ K+L YEP  R+S    L+H FF
Sbjct:   33 MLVKEYR---KIGRGAFGTVVQAYLTQDKKNWLGPFAIKKVPAHTEYKSRELQILRIADHPNIVKLQYFFTHLSPQDNKVYQHLAMECLPETLQ--IEINRYVTNKLEMPLKHIRLYTYQIARGMLYLHGLGVCHRDIKPSNVLVDPETGVL------------------KICDFGSAKKLEHNQPSISYICSRFYRAPELIIGCTQYTTQIDIWGLGCVMGEMLIGKAIFQGQEPLLQLREIAKLLG------PPDKRFIFFSNPAYDGPLFS----------KPLFSGSSQQRFEKYFGHSGPDGIDLLMKILVYEPQQRLSPRRILAHQFF 327          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO33758 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR83])

HSP 1 Score: 436.802 bits (1122), Expect = 1.025e-145
Identity = 208/335 (62.09%), Postives = 259/335 (77.31%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            DD++GHLIY  GD +  RY +   LGEGTFGKV+EC D  ++   VA+K+IKN+EKYREAA LEI VL+ I +K+   K L IKML+WF+H+GHMC+ FE  G SVFDF+K+N+Y PYP++ VRHISYQL  AVKFLH++ LTHTDLKPEN+LFVNSD  +  N   K+D R VK+S +RLIDFGSATF+HEHHST VSTRHYRAPEVILELGWS  CD+WSI CI+FELYTG+TLFQTH+N+EHLAMMERI+G  P   A+KS KT +FY GKL+WD  S  G+YVRENC+PL +Y   +++     F+L+  +LEY+P  RI+   A+ HPFF
Sbjct:  107 DDEDGHLIYHKGDQLHSRYEVHCLLGEGTFGKVLECYDK-KTGDVVAVKVIKNIEKYREAAKLEIKVLEKINQKNRYGKSLCIKMLDWFNHHGHMCLVFEKMGLSVFDFMKDNNYEPYPLDQVRHISYQLIVAVKFLHEMKLTHTDLKPENMLFVNSDCDVFYNKDTKQDQRYVKSSHMRLIDFGSATFEHEHHSTTVSTRHYRAPEVILELGWSYPCDIWSIGCIMFELYTGFTLFQTHENREHLAMMERIIGPIPSDFAKKSRKTKYFYKGKLEWDEKSSSGKYVRENCKPLKKYMLSDSEGHQLFFNLLDYLLEYDPEKRITAKEAMQHPFF 440          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO36294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ45])

HSP 1 Score: 179.104 bits (453), Expect = 4.983e-50
Identity = 89/254 (35.04%), Postives = 155/254 (61.02%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILG 2062
            DD  G  +    D +  RY +++ LG+G+FG+VV+ +D+ ++ + VA+KII+N +++ + AL+E+ +L  +++KD ++ +  I M+  F    H+CI+FEL G ++++ +K+N++  + +  +R  ++ L   +K +H   + H DLKPENIL             R+R       + I++IDFGS+ ++H+   T + +R YR+PEVIL L +S + D+WS  CI+ ELYTGY LF   +  E LA +  +LG
Sbjct:   42 DDDNGSYLKALHDHLAYRYEVLEVLGKGSFGQVVKALDH-KTGQHVAVKIIRNKKRFHQQALVEVKILDNLRKKDKDNTHNLIHMIEHFYFRNHLCITFELMGMNLYELIKKNNFQGFSLALIRRFAFALLHCLKVIHKEKIIHCDLKPENILL------------RQRG-----QTSIKVIDFGSSCYEHQRVYTYIQSRFYRSPEVILGLPYSMAIDMWSFGCILAELYTGYPLFPGENEVEQLACIMEVLG 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO46144 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQP1])

HSP 1 Score: 183.341 bits (464), Expect = 1.832e-49
Identity = 110/358 (30.73%), Postives = 186/358 (51.96%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYS-----PDGRYVRENCRP----------------LLRYCTDENQETIEMF-DLVSKMLEYEPADRISLGAALSHPFFLR 2308
            DD++G  I+   D I  RY ++K +G+G+FG+VV+ +D+ +++  VALK+++N +++   A  EI +L+ ++++D ++ +  I ML  F    H+C++FEL   ++++ +K+N +  + +  VR  ++ +   +  LH   + H DLKPENIL              K+  R    S I++IDFGS+ ++H+   T + +R YRAPEVIL   +    D+WS  CI+ EL TGY LF   D  + LA    +LG+ P ++   SK +  +     +  Y      PDG       R                  L+ C D       MF D + + LE++P+ R++   AL HP+  R
Sbjct:  149 DDEQGSYIHVPKDHIAYRYEVLKIIGKGSFGQVVKALDH-KTNTHVALKMVRNEKRFHRQAQEEIRILEHLKKQDKDNTHNIIHMLEHFTFRNHVCMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLKPENILL-------------KQQGR----SGIKVIDFGSSCYEHQRIYTYIQSRFYRAPEVILGARYGMPIDMWSFGCILAELLTGYPLFPGEDEGDQLACNMELLGYIPEKLRETSKRAKNFINSKGYPRYCTITTLPDGSVAVSGGRSRRGKTRGAPNSKTFVQALKGCDD------AMFIDFLKRCLEWDPSARMTPSQALRHPWLRR 482          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO49238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV4])

HSP 1 Score: 158.303 bits (399), Expect = 1.502e-42
Identity = 111/347 (31.99%), Postives = 181/347 (52.16%), Query Frame = 2
Query: 1361 IVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSAT-FDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYR--MARKSKTSFFYH-------GKLDWDFYSPDGRYVRENCRP-------LLRYCTDENQ--------------ETIEMFDLVS---KMLEYEPADRISLGAALSHPF 2299
            +++ LG GTFG+VV+C     +++ VA+KI+K+   Y     +EI++L  +  ++ E+ Y F++ +  F H  H C+ FE+  Q+++D+LK++ ++P P++H+R I  Q+  A+  L  + L H DLKPENI+ V+ D         K+  RV      ++IDFGSAT       ST + +R+YRAPEVIL L + ES D+WS+ C+I EL+ G+ L+      + +  + +  G  PY   +   +KTS F+        G L+W   + +  + RE   P       +     D  Q              E I+ ++ VS   +ML  +   RI+   ALSH F
Sbjct:    1 VLEFLGRGTFGQVVKCWKKG-TNELVAIKILKDHPSYARQGQIEISILAKLSAENSEA-YNFVRAIECFQHKNHTCLVFEMLQQNLYDYLKQSKFNPLPLKHIRPIVQQVLVALSKLRTLGLIHADLKPENIMLVDPD---------KQPFRV------KVIDFGSATHVSKVVCSTYLQSRYYRAPEVILGLPFCESIDMWSLGCVIAELFLGWPLYPGSSEFDQIRYIIQTQG-LPYDHLLNNATKTSRFFKKAINTHTGVLEWKLKNAN-EHERETKIPSKEARKYIFNSLDDIAQVNLSSSLTGNERIAEKIDRYEFVSLLKRMLTIDQEKRITPEEALSHQF 328          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO45187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTC8])

HSP 1 Score: 157.918 bits (398), Expect = 1.182e-41
Identity = 105/383 (27.42%), Postives = 185/383 (48.30%), Query Frame = 2
Query: 1241 EPLKVSSKSMQISDSEVPPCDDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFL--HDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRY--------VRENCRPLLRYCTD-------------------ENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            +P++   +  Q +D      DD+    I   G+    RY I   +G+G+FG+V +  D+ Q  + +A+KIIKN + +   A +E+ +L+++ + DP+ KY  +++   F    H+C+ FEL   +++D L+  ++    +   R  + Q+C A+ FL   ++ + H DLKPENIL  N                  K S I+++DFGS+    +     + +R YR+PEV+L + ++ + D+WS+ CI+ E++TG  LF   +  + +  +  +LG  P  +   +  +  +  +L      PDG Y        V+E   P  R   D                     Q+ ++  DL+ +ML+Y+   RI   AAL H FF
Sbjct:   45 DPVRPKKRPPQYNDGY----DDENYDYIVKAGEKWFDRYEIESLIGKGSFGQVCKAYDH-QEKEHIAVKIIKNKKPFLNQAQIEVKLLELMNKNDPDGKYYIVRLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLCSPELSIIHCDLKPENILLCNP-----------------KRSAIKIVDFGSSCQIGQRIYQYIQSRFYRSPEVLLGIPYNLAIDMWSLGCILVEMHTGEPLFSGANEFDQMMKIVEVLGMPPKDILDNAPKARKFFDRL------PDGSYQCLKVKDGVKEYLSPGSRKLHDILGCETGGPGGRRLGEAGHTLQDYLKFKDLILRMLDYDRKTRIVPYAALHHCFF 399          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: clk2a (dual specificity protein kinase CLK2 [Source:NCBI gene;Acc:101162379])

HSP 1 Score: 477.248 bits (1227), Expect = 5.476e-160
Identity = 221/335 (65.97%), Postives = 270/335 (80.60%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            DD+EGHLI   GD++  RY IV TLGEGTFG+V++C+D+ +    VALKIIKNVEKY+EAA LEINVL+ I EKDP++K+L ++M +WFD++GHMC+SFEL   S FDFLKEN+Y PY +  VRH++YQ+C AVKFLHD  LTHTDLKPENILFVNSD  +  N ++KR++R VKN+ +R++DFGSATFDHEHHSTIVSTRHYRAPEVILELGWS  CDVWSI CI+FE Y G+TLFQTHDN+EHLAMMERILG  P RM RK+ K  +FY G+LDWD  S  G+YVRENC+PL RY   E +E  ++FDL+  MLEYEPA R++L  +L HPFF
Sbjct:  167 DDEEGHLICRSGDVLQERYEIVGTLGEGTFGRVMKCIDHRRGGVSVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKFLCVQMYDWFDYHGHMCLSFELLALSTFDFLKENNYLPYSIGQVRHMAYQICLAVKFLHDSKLTHTDLKPENILFVNSDFTMSYNVEKKREERTVKNTSVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSHPCDVWSIGCILFEYYLGFTLFQTHDNREHLAMMERILGPVPSRMIRKTRKQKYFYRGRLDWDESSSAGKYVRENCKPLRRYLLSEAEEHHQLFDLIESMLEYEPARRLTLADSLKHPFF 501          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: clk2b (dual specificity protein kinase CLK2 [Source:NCBI gene;Acc:101158555])

HSP 1 Score: 427.172 bits (1097), Expect = 1.069e-142
Identity = 201/338 (59.47%), Postives = 255/338 (75.44%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRL 2311
            D K GHLIY  GD++  RY I+ TLGEGTFGKVV+C+D+ +  +++ALKIIKN EKYR  A LEINVL+ I EKDP  KY  ++ML WF++ GH+CISF+L   S FDFLK N++ PYP++ +R ++ Q+C AV FLHD  LTHTDLKPENILFVNS+  LV N+++K +++ + ++ +RLIDFG+ATFD+EHHS ++STRHYRAPEVILELGWS  CDVWSI CI+FE Y G+TLFQTHDNKEHLAMMER  G  P RM + S K  +F  G LDW+  S  GR+V+  C+PL +Y     +E    FDL+ +MLEYEP+ RISL +AL HPFFL L
Sbjct:   35 DAKNGHLIYRSGDVLEDRYEIINTLGEGTFGKVVQCLDHGRGGRQIALKIIKNQEKYRNTAKLEINVLEKISEKDPLHKYHCVQMLEWFNYNGHICISFQLLSLSTFDFLKSNNFLPYPLQQIRLMAGQICRAVSFLHDNKLTHTDLKPENILFVNSNYSLVYNAEKKCNEKRINDTTVRLIDFGTATFDYEHHSVVISTRHYRAPEVILELGWSHPCDVWSIGCILFEYYEGFTLFQTHDNKEHLAMMERTHGPLPQRMIQSSRKQKYFCSGHLDWNESSKAGRFVKSKCKPLRQYLLSHGREHHHFFDLMERMLEYEPSKRISLHSALEHPFFLPL 372          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: clk4a (dual specificity protein kinase CLK2 [Source:NCBI gene;Acc:101161565])

HSP 1 Score: 432.565 bits (1111), Expect = 3.481e-142
Identity = 192/335 (57.31%), Postives = 260/335 (77.61%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYH-GKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            DD EGHLIY  GDM+  RY IV TLGEG FGKVVEC+D+  + + +ALKIIKN+++YREAAL E+ VLK +   D + +Y  ++ML+WFD++GH+CI+FEL G S +DFLKEN++ P+P+EH+RH+++Q+   VKFLH   LTHTDLKPENILFV+S+  +  N +++RD+R +KN ++R++DFG+ATFDHEHH+++VSTRHYRAPEVIL+LGW  SCDVWSI CI+ E Y G TLFQTHD+KEHLAMMER+LG  P ++  K++   + H  +LDWD  S  GRYVR++C+PL  Y   + ++  ++FDL+ KM+EY+P  RI+L  AL HPFF
Sbjct:  201 DDGEGHLIYHSGDMLRARYEIVYTLGEGAFGKVVECIDHANNGELIALKIIKNIDRYREAALSEVEVLKQLNSVDADKRYSCVRMLDWFDYHGHICIAFELLGLSTYDFLKENNFQPFPLEHIRHMAFQIIRGVKFLHKNKLTHTDLKPENILFVDSNYSMEYNREKRRDERTLKNPDVRIVDFGNATFDHEHHTSVVSTRHYRAPEVILDLGWDHSCDVWSIGCILIEYYLGTTLFQTHDSKEHLAMMERVLGPIPAKLLEKTRKRRYVHRSRLDWDGQSSSGRYVRKHCKPLKHYMWSKGEDHRQLFDLIEKMMEYDPTKRITLEQALHHPFF 535          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000019341.2 (dual specificity protein kinase CLK2 [Source:NCBI gene;Acc:101170453])

HSP 1 Score: 332.028 bits (850), Expect = 2.718e-105
Identity = 164/335 (48.96%), Postives = 229/335 (68.36%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKS-KTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFF 2302
            DD+ G L Y  G +   RY +V  LGEG FG+V++C+D  +  + VA+KI++N E   E A LEI VL+ I   D ++K+  ++ML+WF H  H+CI FEL G S F+FL++N + P+ +E +RH+++++  AV FLH   LTHTDLKPENILFV+SD  L  + K  R  R  ++ E++++DFG+ATFDH+HH ++VSTRHYRAPEVIL+LGW++SCDVWS+ C++FE Y G TLF +HD  EHLAMM+ +LG  P  + +++ K  F    +L WD  S  G  VRE CRP L+    E+ E  ++ DL+S MLEY+   RI+L  AL HPFF
Sbjct:   91 DDEGGQLDYHSGFVFKERYEVVSILGEGAFGRVMKCLDK-RKDEFVAVKILRNFENSYETARLEIAVLEEINSLDDDNKFACVRMLDWFKHKRHVCIVFELLGLSTFEFLRQNDFLPFSVEQIRHMAFRIFRAVSFLHRNKLTHTDLKPENILFVSSDFDLEDDPKTMRVCRKPRSLEVKVVDFGTATFDHQHHQSLVSTRHYRAPEVILDLGWNQSCDVWSLGCVLFEFYFGQTLFPSHDCMEHLAMMQEVLGPIPPHLLKQTGKKHFVQDDRLKWDQQSSSGDCVREPCRP-LKSIEAESDEEQQLLDLLSCMLEYDTCRRITLEEALWHPFF 423          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: dyrk4 (dual specificity tyrosine-phosphorylation-regulated kinase 4 [Source:NCBI gene;Acc:101159741])

HSP 1 Score: 178.718 bits (452), Expect = 4.470e-47
Identity = 111/379 (29.29%), Postives = 207/379 (54.62%), Query Frame = 2
Query: 1265 SMQISDSEVPP----CDDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARK-SKTSFFYHGKLD-WDFYSPDGRYVRENCRPLLRYCTDENQETIEMF-DLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRLHTLSSRRISVRSDTESS 2380
            S +I  S+  P     DD+ G  I    D I  R+ +++ +G+G+FG+V++C+D+ ++++ VA+K+I+N +++   AL+E+ +L+VI++KD ++ +  I M  +F    H+CISFEL G ++++ +K+N++  + +  +R  ++ L   ++ LH   + H DLKPENIL           S+R   +       I+++DFGS+ ++ +   T + +R YR+PEVIL   +S + D+WS+ CI+ EL+TGY LF      E +A +  +LG  P    +  S+   F+  K +  +  +  G+  R N + L    +   + T  +F + +   L ++P  R++    L H + L      R+ + +   +   SDT +S
Sbjct:  166 SQKIEGSQGAPHNSGYDDEHGSYIRVLHDHIAYRFEVLEVIGKGSFGQVLKCLDH-KTNELVAIKMIRNKKRFHHQALVELKILEVIKKKDKDNLHNVIHMKEYFYFRNHLCISFELLGVNLYELIKKNNFQGFSLALIRRFAHALLRCLQMLHKEKIIHCDLKPENILL----------SQRGPGN-------IKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCILAELHTGYPLFPGESEVEQIACIMEVLGMPPNDFVQSASRRKLFFDSKGNPRNITNSKGKKRRPNSKEL----SAALKTTDPLFLEFIKGCLTWDPTKRMTPDEGLQHQWILE-GNFNRVRSRAKTTVKKTSDTSTS 521          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000041213.1 (SMESG000041213.1)

HSP 1 Score: 1483.77 bits (3840), Expect = 0.000e+0
Identity = 749/753 (99.47%), Postives = 751/753 (99.73%), Query Frame = 2
Query:  125 MSNRPPHHPQALNGPSKIITFKPKPPMIGSIKIESQAGKLKLYSGNNPSRESSYSPPADRKGVLTTSISLPYVDCDECEEPSNVCDVLQCSQPHNSSIDSTDEFAYDSVXXXXXXXXXXXXXXXXXXILLLIAKEKSVTNVNSIGSRXXXXXXXXXXXXXSIFKPPVTNKKQEKSFKSVSVQTEKLLSNPICSLCKQKCLELSNQLENLKVTIPTQVKPLPKIYQVAIETLFIPDFSTLMKPLFQTLGSVSSQSDIKLRATYNMNSIKRRRTLMPDGDVVRFINTTPTSVTLPIIITCGENYYTHVKFSMGMVINQNESRKEFVKETADEIDKVKNRSTKGNRVAEARQRAKKLIELRKKSMGDLSNRTSVEEPLKVSSKSMQISDSEVPPCDDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRLHTLSSRRISVRSDTESSR 2383
            MSNRPPHHPQALNGPSKIITFKPKPPMIGSIK ESQ GKLKLYSGNNPSRESSYSPPADRKGVLTTSISLPYVDCDECEEPSNVCDVLQCSQPHNSSIDSTDEFAYDSVDDAFEADTESETEEEGDDILLLIAKEKSVTNVNSIGSRLKKMLLENKLLKLSIFKPP+TNKKQEKSFKSVSVQTEKLLSNPICSLC+QKCLELSNQLENLKVTIPTQVKPLPKIYQVAIETLFIPDFSTLMKPLFQTLGSVSSQSDIKLRATYNMNSIKRRRTLMPDGDVVRFINTTPTSVTLPIIITCGENYYTHVKFSMGMVINQNESRKEFVKETADEIDKVKNRSTKGNRVAEARQRAKKLIELRKKSMGDLSNRTSVEEPLKVSSKSMQISDSEVPPCDDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRLHTLSSRRISVRSDTESSR
Sbjct:    1 MSNRPPHHPQALNGPSKIITFKPKPPMIGSIKSESQTGKLKLYSGNNPSRESSYSPPADRKGVLTTSISLPYVDCDECEEPSNVCDVLQCSQPHNSSIDSTDEFAYDSVDDAFEADTESETEEEGDDILLLIAKEKSVTNVNSIGSRLKKMLLENKLLKLSIFKPPLTNKKQEKSFKSVSVQTEKLLSNPICSLCRQKCLELSNQLENLKVTIPTQVKPLPKIYQVAIETLFIPDFSTLMKPLFQTLGSVSSQSDIKLRATYNMNSIKRRRTLMPDGDVVRFINTTPTSVTLPIIITCGENYYTHVKFSMGMVINQNESRKEFVKETADEIDKVKNRSTKGNRVAEARQRAKKLIELRKKSMGDLSNRTSVEEPLKVSSKSMQISDSEVPPCDDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRLHTLSSRRISVRSDTESSR 753          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000033729.1 (SMESG000033729.1)

HSP 1 Score: 488.419 bits (1256), Expect = 3.596e-162
Identity = 226/346 (65.32%), Postives = 277/346 (80.06%), Query Frame = 2
Query: 1301 DDKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFF-YHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRLHT 2335
            DD+ GHL+Y  GD +  RY I  TLGEGTFGKVVEC+D  +   +VA+KIIKN+EKYREAA+LEINVLK +QEKDP+ KYL IKM +WF++ GH+CISF+L G SVF+FLKEN Y PYPME VRHI+YQ+CFAV FLH+  LTHTDLKPENILFVNSD  ++ +SK+K+ + VVK+SEIRLIDFGSATFDHE HST+VSTRHYRAPEVILELGWS+ CDVWSI CI+FEL++G TLFQTHDN+EHLAMM+RILGH PY+M R +   +F   GKL W+    D ++VRENC+ L  YC   N+  +E+FDL+S+MLEY+P  R+ L  AL+H FF RLP +QR  +
Sbjct:  323 DDESGHLMYKIGDNLHNRYEINNTLGEGTFGKVVECLDLKRKYDKVAVKIIKNIEKYREAAMLEINVLKFLQEKDPDGKYLCIKMYDWFNYNGHICISFQLLGLSVFNFLKENEYVPYPMEQVRHIAYQMCFAVNFLHENGLTHTDLKPENILFVNSDYNVISSSKKKQHN-VVKSSEIRLIDFGSATFDHEKHSTVVSTRHYRAPEVILELGWSQPCDVWSIGCIVFELFSGSTLFQTHDNREHLAMMDRILGHIPYKMTRSTPKDYFDIDGKLIWNPIEKDAKFVRENCKRLFSYCKPNNEVAVELFDLLSRMLEYDPKARVKLSDALNHSFFCRLPSNQRFQS 667          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000071751.1 (SMESG000071751.1)

HSP 1 Score: 383.645 bits (984), Expect = 1.701e-124
Identity = 182/334 (54.49%), Postives = 242/334 (72.46%), Query Frame = 2
Query: 1304 DKEGHLIYGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTSFFYH--GKLDWDFYSPDGRYVRENCRPLLRYCTDENQ-ETIEMFDLVSKMLEYEPADRISLGAALSHP 2296
            D +G+L+     ++  RY+I+K LGEGTFG+V +C D    +  VA+K+IK VEKYREAALLEI VL++I++ DP+ + L I  L+ F+++GHMCI F L G SVFDFLK N Y  YPM  VR+++YQ+  AV FLH + LTHTDLKPENILFVN    +  +   K++ ++++++ I++ID GSATF+ EHH+TIV+TRHYR  EVILELGWS  CDVWSI CI+FELYTG T+F THDN EHLAMMERILGH P RM RKSK   ++   G+L WD  S +G+YVR   +PL RY T  +  + +++FDL+ +MLEY P  RI++  +L HP
Sbjct:  134 DNDGYLVMKEDQLLKKRYKILKLLGEGTFGRVAQCKDLKNHNNEVAVKVIKAVEKYREAALLEIKVLELIKKTDPQGRKLVIFALDSFNYHGHMCIVFPLLGPSVFDFLKANHYVGYPMRQVRYMTYQISKAVDFLHSLKLTHTDLKPENILFVNGAYDMQYDESTKKNVKILRDASIQIIDLGSATFEDEHHTTIVATRHYRPLEVILELGWSYPCDVWSIGCILFELYTGITMFMTHDNIEHLAMMERILGHLPVRMTRKSKKRKYFDDCGRLKWDGESKEGKYVRGEVKPLRRYITRHDDIKELDLFDLIQEMLEYNPKKRITMSESLRHP 467          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000065189.1 (SMESG000065189.1)

HSP 1 Score: 222.631 bits (566), Expect = 8.466e-64
Identity = 106/252 (42.06%), Postives = 164/252 (65.08%), Query Frame = 2
Query: 1340 MIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSDSILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSK 2095
            MI  R+     LGEGTFGKV+ C+D   + +R+ALK+ K +EKY++ A  EI +L  I+++DP+ +   + +  WF+   H+ + F   G+ ++++LK   +    +  VRHIS+Q+  AV FLH + + HTD+KPEN+LFV+S+   + +   +   +   +++I LID G+  + +E    I+ TR+YR PEV LE+GW++S D+WSI C++FELY+G +LFQ HD+ EHL MME IL  FP +M  KSK
Sbjct:  232 MIKDRFFFTGLLGEGTFGKVISCLDQRLNDERIALKVSKRLEKYKKLAKHEIEILVRIRKRDPKGENYVVILKAWFELDCHIIMIFPQYGEDLYNYLKSIDHHGMKLGDVRHISWQMWRAVDFLHGLTIIHTDIKPENLLFVSSEYKYIESKNSESKIKYPSSTDIVLIDLGNGVYGNERKPRIIVTRYYRPPEVYLEIGWNKSVDIWSIGCVMFELYSGRSLFQCHDDLEHLWMMEYILKEFPEQMINKSK 483          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000078436.1 (SMESG000078436.1)

HSP 1 Score: 188.734 bits (478), Expect = 2.425e-51
Identity = 106/331 (32.02%), Postives = 186/331 (56.19%), Query Frame = 2
Query: 1352 RYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYREAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFDFLKENSYSPYPMEHVRHISYQLCFAVKFLH-DIHLTHTDLKPENILFVNSDSILVPNSKRKRDDR---VVKNSEIRLIDFGSA-TFDHEHHSTIVSTRHYRAPEVILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPYRMARKSKTS-FFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMFDLVSKMLEYEPADRISLGAALSHPFFLRLPPHQR 2326
            RY  VK LGEGTFG V+EC+D ++  + VA+K+ KN+    E  L E+++LK I +           ++ WF     +C+ F   G +++ F+K+  + P PME ++ I+YQL  A+ FLH +  L HTDLKPENI+  +   I    +K++R D+   +    +I++IDFG+A T     ++ ++ TR+YRA EV+L + W+   D WS+ CI++EL TG  LF T+++  HLA++++I+GH P  M R  K +  F +G  +    + +  Y+ E+   +  +    + ++     ++S +++  P  R  +   +    F ++P + +
Sbjct:  177 RYIFVKDLGEGTFGYVLECLDCEKRRQPVAIKVSKNLLATTEKLLNEVSILKKINDIYNSPNNPCATLIEWFKLEKRLCLVFHRYGDNIYHFMKKRQFKPLPMEFIKQIAYQLLSAILFLHENCDLIHTDLKPENIVLCSPIYI----TKQERGDKANMLPSKYDIKIIDFGNALTNKGFKYTKVIGTRYYRAVEVMLGVPWNYKIDYWSLGCILYELVTGKILFMTNNDSHHLALIDKIIGHLPEEMTRTCKKAHLFLNGHFNKA--AINDYYLIESAEYIENHFKHSSFQSHSFTAMISSLIQINPESRPEMKEFIHSHMFAKVPEYLK 501          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLK24.383e-16967.70CDC like kinase 2 [Source:HGNC Symbol;Acc:HGNC:206... [more]
CLK24.383e-16967.70CDC like kinase 2 [Source:HGNC Symbol;Acc:HGNC:206... [more]
CLK25.568e-16967.70CDC like kinase 2 [Source:HGNC Symbol;Acc:HGNC:206... [more]
CLK25.568e-16967.70CDC like kinase 2 [Source:HGNC Symbol;Acc:HGNC:206... [more]
CLK25.762e-16967.70CDC like kinase 2 [Source:HGNC Symbol;Acc:HGNC:206... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
madd-37.778e-14461.54Probable dual specificity protein kinase madd-3 [... [more]
madd-35.705e-14261.47Probable dual specificity protein kinase madd-3 [... [more]
madd-32.518e-14160.70Probable dual specificity protein kinase madd-3 [... [more]
madd-31.622e-13960.64Probable dual specificity protein kinase madd-3 [... [more]
madd-31.480e-10761.81Probable dual specificity protein kinase madd-3 [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Doa2.575e-16866.00gene:FBgn0265998 transcript:FBtr0299748[more]
Doa2.575e-16866.00gene:FBgn0265998 transcript:FBtr0299752[more]
Doa5.114e-16866.00gene:FBgn0265998 transcript:FBtr0299745[more]
Doa5.114e-16866.00gene:FBgn0265998 transcript:FBtr0299742[more]
Doa5.114e-16866.00gene:FBgn0265998 transcript:FBtr0299750[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clk2b8.684e-16366.27CDC-like kinase 2b [Source:ZFIN;Acc:ZDB-GENE-06092... [more]
clk2a2.066e-16266.57CDC-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
clk2a2.178e-16266.57CDC-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
clk4a8.276e-14457.91CDC-like kinase 4a [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
clk4b2.595e-14056.72CDC-like kinase 4b [Source:ZFIN;Acc:ZDB-GENE-05022... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ezr5.617e-14558.96ezrin [Source:Xenbase;Acc:XB-GENE-484766][more]
ezr3.361e-14459.06ezrin [Source:Xenbase;Acc:XB-GENE-484766][more]
dkk34.348e-14258.08dickkopf WNT signaling pathway inhibitor 3 [Source... [more]
dkk31.049e-14155.37dickkopf WNT signaling pathway inhibitor 3 [Source... [more]
dkk39.493e-14058.08dickkopf WNT signaling pathway inhibitor 3 [Source... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Clk21.825e-16767.13CDC-like kinase 2 [Source:MGI Symbol;Acc:MGI:10986... [more]
Clk21.889e-16767.13CDC-like kinase 2 [Source:MGI Symbol;Acc:MGI:10986... [more]
Clk21.954e-16767.13CDC-like kinase 2 [Source:MGI Symbol;Acc:MGI:10986... [more]
Clk37.267e-14860.93CDC-like kinase 3 [Source:MGI Symbol;Acc:MGI:10986... [more]
Clk46.274e-14259.64CDC like kinase 4 [Source:MGI Symbol;Acc:MGI:10985... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P49760|CLK2_HUMAN2.767e-16867.70Dual specificity protein kinase CLK2 OS=Homo sapie... [more]
sp|O35491|CLK2_MOUSE1.321e-16667.13Dual specificity protein kinase CLK2 OS=Mus muscul... [more]
sp|P49762|DOA_DROME1.113e-16064.89Serine/threonine-protein kinase Doa OS=Drosophila ... [more]
sp|Q3SX21|CLK3_BOVIN4.373e-14860.81Dual specificity protein kinase CLK3 OS=Bos taurus... [more]
sp|Q63117|CLK3_RAT5.847e-14860.93Dual specificity protein kinase CLK3 OS=Rattus nor... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EUP70.000e+068.89Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3PXS10.000e+069.29Dual specificity protein kinase CLK2 OS=Schistocep... [more]
A0A564Z2240.000e+069.52Protein kinase domain-containing protein OS=Hymeno... [more]
A0A0V0J4B70.000e+068.97Protein kinase domain-containing protein (Fragment... [more]
A0A0X3Q7P90.000e+068.97Protein kinase domain-containing protein (Fragment... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clk2a1.660e-16366.87dual specificity protein kinase CLK2 [Source:NCBI ... [more]
clk2a1.660e-16366.87dual specificity protein kinase CLK2 [Source:NCBI ... [more]
clk4a6.073e-14759.40dual specificity protein kinase CLK4-like [Source:... [more]
ENSAMXT00000007667.22.164e-14257.91dual specificity protein kinase CLK4 [Source:NCBI ... [more]
clk2b1.515e-14167.35CDC-like kinase 2b [Source:ZFIN;Acc:ZDB-GENE-06092... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clk2a1.584e-16464.72CDC-like kinase 2a [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
dyrk21.201e-4830.51dual-specificity tyrosine-(Y)-phosphorylation regu... [more]
ENSPMAT00000007952.11.724e-4431.49pep scaffold:Pmarinus_7.0:GL476685:157428:173166:-... [more]
ENSPMAT00000007958.12.340e-4432.25pep scaffold:Pmarinus_7.0:GL476685:157443:173166:-... [more]
ENSPMAT00000007962.19.041e-4430.59pep scaffold:Pmarinus_7.0:GL476685:157455:173154:-... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KNS13.221e-7242.71Protein kinase involved in negative regulation of ... [more]
YAK18.023e-3831.78Serine-threonine protein kinase; component of a gl... [more]
KSS14.477e-2226.36Mitogen-activated protein kinase (MAPK); involved ... [more]
FUS31.098e-2027.33Mitogen-activated serine/threonine protein kinase ... [more]
MCK11.554e-2023.65Dual-specificity ser/thr and tyrosine protein kina... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO337581.025e-14562.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362944.983e-5035.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461441.832e-4930.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492381.502e-4231.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451871.182e-4127.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clk2a5.476e-16065.97dual specificity protein kinase CLK2 [Source:NCBI ... [more]
clk2b1.069e-14259.47dual specificity protein kinase CLK2 [Source:NCBI ... [more]
clk4a3.481e-14257.31dual specificity protein kinase CLK2 [Source:NCBI ... [more]
ENSORLT00000019341.22.718e-10548.96dual specificity protein kinase CLK2 [Source:NCBI ... [more]
dyrk44.470e-4729.29dual specificity tyrosine-phosphorylation-regulate... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041213.10.000e+099.47SMESG000041213.1[more]
SMESG000033729.13.596e-16265.32SMESG000033729.1[more]
SMESG000071751.11.701e-12454.49SMESG000071751.1[more]
SMESG000065189.18.466e-6442.06SMESG000065189.1[more]
SMESG000078436.12.425e-5132.02SMESG000078436.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017052 ID=SMED30017052|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2517bp
CGTGTTTTATCCTACGATTAAATTTTATTTTTCTCGTTGAATTCCTTCGT
GGAAATTTTCGCAATTTTGTCCCATTTGCTCGATTGCTATTTTACAATTT
CGCTATATTTATTCTCACAACAAAATGAGCAATCGACCTCCACATCATCC
TCAAGCTCTCAATGGACCATCAAAAATTATAACTTTCAAACCGAAACCTC
CAATGATAGGAAGCATTAAAATTGAATCGCAAGCCGGTAAGTTAAAGTTA
TACTCTGGAAACAATCCGTCTCGAGAGTCGAGTTATTCGCCACCAGCCGA
CAGGAAAGGTGTTCTAACGACAAGTATATCTTTGCCTTATGTAGACTGTG
ATGAATGTGAAGAACCAAGCAACGTCTGTGATGTATTACAATGTTCTCAA
CCCCATAACTCTTCTATTGACTCTACTGATGAATTTGCATATGATTCGGT
GGATGATGCGTTTGAGGCCGATACAGAAAGTGAAACAGAGGAAGAAGGTG
ATGACATTCTTCTGTTGATTGCAAAGGAAAAATCCGTAACTAACGTCAAT
TCCATTGGCAGCAGACTTAAAAAAATGCTTTTAGAAAATAAATTGTTAAA
ACTCAGTATTTTCAAGCCTCCAGTAACGAATAAAAAACAAGAGAAATCAT
TTAAATCTGTTTCAGTGCAAACGGAAAAATTATTAAGCAATCCAATTTGT
TCATTGTGCAAACAGAAATGTTTGGAATTGTCCAATCAATTGGAAAACCT
TAAAGTAACTATCCCGACTCAAGTGAAACCTTTACCAAAAATTTATCAGG
TGGCAATCGAAACATTATTTATTCCTGACTTTTCCACTTTAATGAAACCG
CTTTTTCAAACTCTAGGCTCAGTTTCTAGTCAGTCTGATATTAAATTAAG
AGCCACTTATAATATGAATTCAATAAAGCGTCGAAGAACTCTGATGCCTG
ATGGGGACGTTGTTAGGTTCATTAACACTACGCCAACTAGTGTTACTCTA
CCTATCATCATTACCTGTGGAGAAAATTACTATACTCATGTCAAATTCTC
AATGGGTATGGTAATAAATCAAAATGAAAGTCGCAAAGAATTTGTCAAAG
AAACTGCTGATGAAATAGATAAAGTCAAAAATCGCTCAACTAAAGGAAAT
CGGGTTGCTGAGGCTCGACAGCGAGCTAAAAAACTTATAGAATTACGAAA
GAAAAGTATGGGAGACCTGTCAAACAGAACGTCAGTAGAGGAGCCGCTTA
AAGTTTCTTCAAAATCAATGCAAATTTCAGATTCCGAAGTTCCTCCTTGT
GATGACAAGGAAGGGCATTTGATTTATGGACATGGAGACATGATTATGGG
AAGATACAGAATAGTGAAAACACTCGGCGAAGGAACGTTTGGAAAAGTGG
TTGAATGCGTCGACAATGATCAAAGTTCAAAAAGAGTTGCTTTGAAAATT
ATTAAAAATGTTGAAAAATATCGAGAAGCGGCTTTACTGGAGATAAACGT
TTTGAAGGTTATCCAAGAAAAAGATCCCGAATCTAAATATCTTTTCATAA
AAATGCTTAACTGGTTTGATCATTATGGGCATATGTGCATTAGTTTTGAA
TTGTGTGGACAAAGTGTCTTCGATTTTTTGAAAGAGAACAGCTATTCTCC
ATATCCCATGGAACATGTTCGTCATATCAGTTATCAATTGTGTTTCGCGG
TAAAATTCTTGCACGATATCCATTTGACCCACACAGATCTTAAACCAGAA
AATATTTTATTTGTTAATTCTGATAGTATTTTAGTTCCGAATTCTAAAAG
AAAACGTGATGATCGGGTAGTAAAAAATTCAGAAATCAGACTTATTGATT
TTGGATCAGCAACCTTTGATCATGAGCACCATTCTACAATTGTCTCCACA
AGACATTATAGGGCCCCTGAAGTGATATTAGAACTTGGTTGGTCTGAATC
GTGTGATGTTTGGTCAATAGCGTGCATTATCTTTGAATTGTATACGGGAT
ATACTCTTTTTCAGACCCATGACAACAAAGAGCATTTAGCAATGATGGAA
CGAATATTGGGTCATTTTCCTTATAGAATGGCAAGAAAGTCGAAAACTAG
TTTTTTCTATCACGGTAAACTAGACTGGGATTTCTACAGCCCAGATGGGA
GATACGTTAGGGAAAACTGTCGACCCTTATTGAGATATTGCACAGATGAA
AACCAAGAAACAATTGAAATGTTTGATCTCGTCAGTAAAATGCTGGAATA
TGAACCAGCAGATCGAATATCACTAGGAGCAGCTCTCAGTCACCCATTTT
TTCTTCGTTTACCTCCTCATCAGAGGCTCCATACATTATCCAGTAGACGA
ATATCAGTTCGAAGTGACACAGAATCCAGTAGATAATAGTAGATTGTTTC
TAGAGCTTATTTGTAAAAAAATATTTATTGTTATGCCATTTATCTTTCAT
GATGTTGCACATGGGGTTGTGTCATTGATGTTTTATGCTAGGAATAAAGA
AATAATAATGGAAAACT
back to top

protein sequence of SMED30017052-orf-1

>SMED30017052-orf-1 ID=SMED30017052-orf-1|Name=SMED30017052-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=754bp
MSNRPPHHPQALNGPSKIITFKPKPPMIGSIKIESQAGKLKLYSGNNPSR
ESSYSPPADRKGVLTTSISLPYVDCDECEEPSNVCDVLQCSQPHNSSIDS
TDEFAYDSVDDAFEADTESETEEEGDDILLLIAKEKSVTNVNSIGSRLKK
MLLENKLLKLSIFKPPVTNKKQEKSFKSVSVQTEKLLSNPICSLCKQKCL
ELSNQLENLKVTIPTQVKPLPKIYQVAIETLFIPDFSTLMKPLFQTLGSV
SSQSDIKLRATYNMNSIKRRRTLMPDGDVVRFINTTPTSVTLPIIITCGE
NYYTHVKFSMGMVINQNESRKEFVKETADEIDKVKNRSTKGNRVAEARQR
AKKLIELRKKSMGDLSNRTSVEEPLKVSSKSMQISDSEVPPCDDKEGHLI
YGHGDMIMGRYRIVKTLGEGTFGKVVECVDNDQSSKRVALKIIKNVEKYR
EAALLEINVLKVIQEKDPESKYLFIKMLNWFDHYGHMCISFELCGQSVFD
FLKENSYSPYPMEHVRHISYQLCFAVKFLHDIHLTHTDLKPENILFVNSD
SILVPNSKRKRDDRVVKNSEIRLIDFGSATFDHEHHSTIVSTRHYRAPEV
ILELGWSESCDVWSIACIIFELYTGYTLFQTHDNKEHLAMMERILGHFPY
RMARKSKTSFFYHGKLDWDFYSPDGRYVRENCRPLLRYCTDENQETIEMF
DLVSKMLEYEPADRISLGAALSHPFFLRLPPHQRLHTLSSRRISVRSDTE
SSR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 411..726
e-value: 6.4E-74
score: 261.6
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 411..726
e-value: 2.3E-49
score: 168.1
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 411..726
score: 38.534
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 377..492
e-value: 3.8E-37
score: 128.4
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 493..734
e-value: 4.7E-75
score: 254.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 368..388
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 368..386
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..60
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 30..60
NoneNo IPR availablePANTHERPTHR45646:SF6DUAL SPECIFICITY PROTEIN KINASE CLK2coord: 378..731
NoneNo IPR availablePANTHERPTHR45646FAMILY NOT NAMEDcoord: 378..731
NoneNo IPR availableCDDcd14134PKc_CLKcoord: 398..726
e-value: 0.0
score: 589.15
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 534..546
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 417..441
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 399..741