MFS domain-containing protein

Overview
NameMFS domain-containing protein
Smed IDSMED30017046
Length (bp)1032
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MFS domain-containing protein (SMED30017046) t-SNE clustered cells

Violin plots show distribution of expression levels for MFS domain-containing protein (SMED30017046) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MFS domain-containing protein (SMED30017046) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MFS domain-containing protein (SMED30017046) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017046

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30017046SMESG000062462.1 dd_Smed_v4_14825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017046SMESG000062462.1 dd_Smed_v4_14825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30017046SMESG000062462.1 dd_Smed_v4_14825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30017046SMESG000062462.1 dd_Smed_v4_14825_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: Y59A8B.21 (pep chromosome:WBcel235:V:17986260:17994546:1 gene:WBGene00013353.1 transcript:Y59A8B.21.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y59A8B.21)

HSP 1 Score: 133.265 bits (334), Expect = 5.814e-35
Identity = 93/327 (28.44%), Postives = 160/327 (48.93%), Query Frame = 1
Query:   25 GIAYSVAISAAINWLPNQRGLVIGIVVSGFGLGSMAFNQIQTLFINPNNLSPNITIETERYFDDRDMLDRVPKCFLLIGGMYGIMQLLGCLLLFTPISQIHHGKWVHSIRLETSK-----------ENDEGAQSFSGNVEISPLKALKSQDFWILWLTFVLTGVVTVYATSLYKTFGQLFIKSDYYLSVVGSVGSIFNSFGRIMWGEIVDKYSYKTAVRXXXXXXXXXXXXFYFCLLITNQIVAQIIHLLWICSILVNICGIFAIMPAAIAKLFGIKNVSTIFGMLFTANSIASIIGALTTSILISKIGYLGIFEMGAGMTFFAFIL 972
            GIAY  A+S AINW P++ G++ GIV +GFGL S  F  IQT+ +NP NL        + YF   ++L RVP  F  +  +YGIMQ +  +++  P       +   SI  E  +           +NDE        ++++  + LKS  F+ L+ +            +LYKT+G+ FI+ D ++++  S+ S+ N+  RI WG + D+ S++ A+       T L   F   + +T ++  ++  L W+    + +    A+   A  K FG ++ +  +G L  + + + I+ A  +   +  IGY  +F + +   F AFI 
Sbjct:  136 GIAYVTAVSTAINWAPDKIGVISGIVAAGFGLSSSIFAPIQTMIVNPLNLPAT----KDGYFLQPELLHRVPALFTKLAVIYGIMQAMALIVVCDP--PFRKSRSTESILEEDDEDMDEDYERPVFDNDEDT-----TIQMTSSEMLKSPTFYCLFASLFCCSFYANMFYNLYKTYGESFIEDDMFMAMAFSIASVANAIARIGWGYLTDRTSFQIALS----TATCLASVFLLTMPMTREL-GKMAFLFWLVGTFICMGATHALFITATVKCFGNRHKANNYGYLILSTTTSGILLAAISQFYLKAIGYTYLFIITSIFPFCAFIF 446          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693414:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 121.709 bits (304), Expect = 6.914e-31
Identity = 95/317 (29.97%), Postives = 160/317 (50.47%), Query Frame = 1
Query:   28 IAYSVAISAAINWLPNQRGLVIGIVVSGFGLGSMAFNQIQTLFINPNNLSPNITIETERYFDDRDMLDRVPKCFLLIGGMYGIMQLLGCLLLFTPISQIHHGKWVHSIRLETSKENDEGAQSFSGNVEISPLKALKSQDFWILWLTFVLTGVVTVYATSLYKTFGQLFIKSDYYLSVVGSVGSIFNSFGRIMWGEIVDKYSYKTAVRXXXXXXXXXXXXFYFCLLITNQIVAQIIHLLWICSILVNICGIFAIMPAAIAKLFGIKNVSTIFGMLFTANSIASIIGALTTSILISKIGYLGIFEMGAGMTFFAFILTF 978
            IAYS  +  A  W P+  GL  GI++ G+G G+   + +QT FINP +   N     + +F   D+L+RVP  F+++   + + Q +G + +  P   IH         +ET  EN  G  S     +      L++  F +L+L+     V     + LYK +GQ FI SD++LS++GS+ SIFN+  R+ WG I D  SY+ ++ ++ ++  +L     F + +   +   ++ L  +C +   I G F+I P    K F   N S ++G L  A S+A +I  L ++  +S+IG+  +F +       +  LTF
Sbjct:  130 IAYSSILPTAQRWFPDNVGLAGGIIIGGYGCGAFILSPLQTTFINPLDYRVN----DQGFFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFIGQPEGDIH---------VET--ENLIGTNSEIRVEQARVWPQLRTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFIDSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMSIVCSLGAVLA----FSMPLVKMVSNDVLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTHALSEIGFEYLFIVCGCFMLTSLFLTF 427          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693542:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 121.709 bits (304), Expect = 6.914e-31
Identity = 95/317 (29.97%), Postives = 160/317 (50.47%), Query Frame = 1
Query:   28 IAYSVAISAAINWLPNQRGLVIGIVVSGFGLGSMAFNQIQTLFINPNNLSPNITIETERYFDDRDMLDRVPKCFLLIGGMYGIMQLLGCLLLFTPISQIHHGKWVHSIRLETSKENDEGAQSFSGNVEISPLKALKSQDFWILWLTFVLTGVVTVYATSLYKTFGQLFIKSDYYLSVVGSVGSIFNSFGRIMWGEIVDKYSYKTAVRXXXXXXXXXXXXFYFCLLITNQIVAQIIHLLWICSILVNICGIFAIMPAAIAKLFGIKNVSTIFGMLFTANSIASIIGALTTSILISKIGYLGIFEMGAGMTFFAFILTF 978
            IAYS  +  A  W P+  GL  GI++ G+G G+   + +QT FINP +   N     + +F   D+L+RVP  F+++   + + Q +G + +  P   IH         +ET  EN  G  S     +      L++  F +L+L+     V     + LYK +GQ FI SD++LS++GS+ SIFN+  R+ WG I D  SY+ ++ ++ ++  +L     F + +   +   ++ L  +C +   I G F+I P    K F   N S ++G L  A S+A +I  L ++  +S+IG+  +F +       +  LTF
Sbjct:  130 IAYSSILPTAQRWFPDNVGLAGGIIIGGYGCGAFILSPLQTTFINPLDYRVN----DQGFFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFIGQPEGDIH---------VET--ENLIGTNSEIRVEQARVWPQLRTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFIDSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMSIVCSLGAVLA----FSMPLVKMVSNDVLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTHALSEIGFEYLFIVCGCFMLTSLFLTF 427          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693414:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 121.709 bits (304), Expect = 8.382e-31
Identity = 95/317 (29.97%), Postives = 160/317 (50.47%), Query Frame = 1
Query:   28 IAYSVAISAAINWLPNQRGLVIGIVVSGFGLGSMAFNQIQTLFINPNNLSPNITIETERYFDDRDMLDRVPKCFLLIGGMYGIMQLLGCLLLFTPISQIHHGKWVHSIRLETSKENDEGAQSFSGNVEISPLKALKSQDFWILWLTFVLTGVVTVYATSLYKTFGQLFIKSDYYLSVVGSVGSIFNSFGRIMWGEIVDKYSYKTAVRXXXXXXXXXXXXFYFCLLITNQIVAQIIHLLWICSILVNICGIFAIMPAAIAKLFGIKNVSTIFGMLFTANSIASIIGALTTSILISKIGYLGIFEMGAGMTFFAFILTF 978
            IAYS  +  A  W P+  GL  GI++ G+G G+   + +QT FINP +   N     + +F   D+L+RVP  F+++   + + Q +G + +  P   IH         +ET  EN  G  S     +      L++  F +L+L+     V     + LYK +GQ FI SD++LS++GS+ SIFN+  R+ WG I D  SY+ ++ ++ ++  +L     F + +   +   ++ L  +C +   I G F+I P    K F   N S ++G L  A S+A +I  L ++  +S+IG+  +F +       +  LTF
Sbjct:  144 IAYSSILPTAQRWFPDNVGLAGGIIIGGYGCGAFILSPLQTTFINPLDYRVN----DQGFFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFIGQPEGDIH---------VET--ENLIGTNSEIRVEQARVWPQLRTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFIDSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMSIVCSLGAVLA----FSMPLVKMVSNDVLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTHALSEIGFEYLFIVCGCFMLTSLFLTF 441          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A0H3YF06 (Slc16a-5 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc16a-5 PE=2 SV=1)

HSP 1 Score: 360.533 bits (924), Expect = 6.831e-119
Identity = 186/343 (54.23%), Postives = 242/343 (70.55%), Query Frame = 1
Query:   22 IGIAYSVAISAAINWLPNQRGLVIGIVVSGFGLGSMAFNQIQTLFINPNNLSPNITIE-TERYFDDRDMLDRVPKCFLLIGGMYGIMQLLGCLLLFTPISQIHHGKWVHSIRLETSKENDEGAQSF----------------SGNVEISPLKALKSQDFWILWLTFVLTGVVTVYATSLYKTFGQLFIKSDYYLSVVGSVGSIFNSFGRIMWGEIVDKYSYKTAVRXXXXXXXXXXXXFYFCLLITNQIVAQIIHLLWICSILVNICGIFAIMPAAIAKLFGIKNVSTIFGMLFTANSIASIIGALTTSILISKIGYLGIFEMGAGMTFFAFILTFFHSNESL 999
            +GIAYSV ++A+I W PN +GLVIG+VV+GFGLGS+AFNQIQTL+INP N+SPN T E T+RYF D  +L++VP CFL  G +Y  +QL+GC++LF+P       + + SI   T   N E + +F                  N + +  KA+K +DFWILW  F+  G + VYATSLYKTFGQLFI SDYYL++VGSV SIFN+ GRI WG+++D++SYK A+R +   +TILMGTFY C L+ N I A+++ L+W+C I  NICGIFA+MPA  AKLFG+K V TI+G+LF+AN+ A I GALTTSI +SKI Y GIF +GAG+T  A ILTF H    L
Sbjct:  125 VGIAYSVVLAASIKWFPNNKGLVIGVVVAGFGLGSLAFNQIQTLYINPQNISPNFTKEDTDRYFTDEKVLEKVPYCFLYTGIIYASIQLIGCIILFSP----SQTEMMISILSNTGSSNSELSTNFISETYDDENNIQSLLPKDNHDSNIFKAIKQRDFWILWFIFMFCGTINVYATSLYKTFGQLFITSDYYLALVGSVASIFNAMGRIFWGQVMDRFSYKVAIRSIIINSTILMGTFYLCHLVPNSIGARVMFLIWVCGIFANICGIFAVMPAITAKLFGLKKVVTIYGILFSANAFAGIFGALTTSIFLSKINYFGIFGIGAGLTTIALILTFLHKRIDL 463          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1S3HHM8 (uncharacterized protein LOC106155360 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106155360 PE=4 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 1.405e-69
Identity = 128/339 (37.76%), Postives = 200/339 (59.00%), Query Frame = 1
Query:   22 IGIAYSVAISAAINWLPNQRGLVIGIVVSGFGLGSMAFNQIQTLFINPNNLSPNITIETERYFDDRDMLDRVPKCFLLIGGMYGIMQLLGCLLLFTPISQIHHGKWVHSIRLETSKENDEGA--------------QSFSGNV--EISPLKALKSQDFWILWLTFVLTGVVTVYATSLYKTFGQLFIKSDYYLSVVGSVGSIFNSFGRIMWGEIVDKYSYKTAVRXXXXXXXXXXXXFYFCLLITNQIVA----QIIHLLWICSILVNICGIFAIMPAAIAKLFGIKNVSTIFGMLFTANSIASIIGALTTSILISKIGYLGIFEMGAGMTFFAFILTF 978
            +G+AY+  ++ ++ W P+ +GLV G+VV+GFG G+  FNQ+QT +INP+NL  N    + RYF ++ +L+RVP CFL++GG Y  MQ +G L+LF P          HS R   S + DE A              +  + N+  +  P + ++S+ F+ILW  F+L G   ++++SLYK +GQ FIK D +L++VG+  ++FN+ GRI WG I DK+S+KTA+  + T           C L+   I+A    +++  +W+C I     G F++ P A AK FG K+V+  +G+LFT+  IA  +GA  T  L+  IG+  +F + AG +F + ILTF
Sbjct:    6 VGMAYAPCLANSMKWFPDHKGLVNGLVVAGFGGGAFIFNQVQTAYINPHNLPVN----SARYFTEKKLLERVPSCFLVLGGSYVAMQFVGILILFAPPE-------AHSRR--ASIQEDESALLPEDRSDSDVDYKKKMAPNIARDYYPKQMIRSKYFYILWFIFLLNGQAVIFSSSLYKAYGQTFIKDDQFLAIVGAFAAVFNAGGRIFWGVIADKFSFKTAMLCLCTSM---------CALMMTFIIAPLGGKVMFFIWVCLIFGTFSGNFSLFPTATAKAFGAKHVAVNYGLLFTSQVIAPPLGAFLTQQLLHLIGWFFMFCIVAGCSFISLILTF 322          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1I8HYG0 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 2.603e-69
Identity = 126/342 (36.84%), Postives = 201/342 (58.77%), Query Frame = 1
Query:   25 GIAYSVAISAAINWLPNQRGLVIGIVVSGFGLGSMAFNQIQTLFINPNNLSPNITIE-TERYFDDRDMLDRVPKCFLLIGGMYGIMQLLGCLLLFTPISQ----------------------IHHGKWVHSIRLETSKENDEGAQSFSGNVEISPLKALKSQDFWILWLTFVLTGVVTVYATSLYKTFGQLFIKSDYYLSVVGSVGSIFNSFGRIMWGEIVDKYSYKTAVRXXXXXXXXXXXXFYFCLLITNQIV--AQIIHLLWICSILVNICGIFAIMPAAIAKLFGIKNVSTIFGMLFTANSIASIIGALTTSILISKIGYLGIFEMGAGMTFFAFILT 975
            GIAY+VAI+A+++W P++RGLV GIVV+GFG GS+ F+Q QTL+INP+N+  N+T    ERYFD   ++DRVP CF+ +G +Y +MQ +G  LL  P +                       +  G     + +ETS+  + G +S S     +P + ++   FW+LW TF++     VY  + YK+FG     +D+YL++VGS+ + FN+  R+MWG + D+ +Y+  +          + +F   +L++   +  A   +LLW+C++     G FA+ PAA AKL+G  N++  +G+LFTAN+ + IIGAL T++L   IG+LG+F +GA  +    + T
Sbjct:  121 GIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALLRRPTAAELEERQELVGEAGDDTAAQETALDEGSPSKPVAMETSEHGNRGGESDS-----TPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSFGLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALM---------FVLSFGMAVLMSTFTLSGAPWYYLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALLTTVLKDAIGWLGLFLLGAAFSTLGAVFT 448          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1I8HL50 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 3.329e-69
Identity = 125/342 (36.55%), Postives = 201/342 (58.77%), Query Frame = 1
Query:   25 GIAYSVAISAAINWLPNQRGLVIGIVVSGFGLGSMAFNQIQTLFINPNNLSPNITIE-TERYFDDRDMLDRVPKCFLLIGGMYGIMQLLGCLLLFTPISQ----------------------IHHGKWVHSIRLETSKENDEGAQSFSGNVEISPLKALKSQDFWILWLTFVLTGVVTVYATSLYKTFGQLFIKSDYYLSVVGSVGSIFNSFGRIMWGEIVDKYSYKTAVRXXXXXXXXXXXXFYFCLLITNQIV--AQIIHLLWICSILVNICGIFAIMPAAIAKLFGIKNVSTIFGMLFTANSIASIIGALTTSILISKIGYLGIFEMGAGMTFFAFILT 975
            GIAY+VAI+A+++W P++RGLV GIVV+GFG GS+ F+Q QTL+INP+N+  N+T    ERYFD   ++DRVP CF+ +G +Y +MQ +G  LL  P +                       +  G     + +ETS+  + G     G ++ +P + ++   FW+LW TF++     VY  + YK+FG     +D+YL++VGS+ + FN+  R+MWG + D+ +Y+  +          + +F   +L++   +  A   +LLW+C++     G FA+ PAA AKL+G  N++  +G+LFTAN+ + IIGAL T++L   IG+LG+F +GA  +    + T
Sbjct:  121 GIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALLRRPTAAELEERQELVGEAGDDTAAQETALDEGSPSKPVAMETSEHGNRG-----GELDSTPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSFGLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALM---------FVLSFGMAVLMSTFTLSGAPWYYLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALLTTVLKDAIGWLGLFLLGAAFSTLGAVFT 448          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A267H5U2 (MFS domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000477g2 PE=4 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 3.818e-69
Identity = 125/342 (36.55%), Postives = 201/342 (58.77%), Query Frame = 1
Query:   25 GIAYSVAISAAINWLPNQRGLVIGIVVSGFGLGSMAFNQIQTLFINPNNLSPNITIE-TERYFDDRDMLDRVPKCFLLIGGMYGIMQLLGCLLLFTPISQ----------------------IHHGKWVHSIRLETSKENDEGAQSFSGNVEISPLKALKSQDFWILWLTFVLTGVVTVYATSLYKTFGQLFIKSDYYLSVVGSVGSIFNSFGRIMWGEIVDKYSYKTAVRXXXXXXXXXXXXFYFCLLITNQIV--AQIIHLLWICSILVNICGIFAIMPAAIAKLFGIKNVSTIFGMLFTANSIASIIGALTTSILISKIGYLGIFEMGAGMTFFAFILT 975
            GIAY+VAI+A+++W P++RGLV GIVV+GFG GS+ F+Q QTL+INP+N+  N+T    ERYFD   ++DRVP CF+ +G +Y +MQ +G  LL  P +                       +  G     + +ETS+  + G     G ++ +P + ++   FW+LW TF++     VY  + YK+FG     +D+YL++VGS+ + FN+  R+MWG + D+ +Y+  +          + +F   +L++   +  A   +LLW+C++     G FA+ PAA AKL+G  N++  +G+LFTAN+ + IIGAL T++L   IG+LG+F +GA  +    + T
Sbjct:  123 GIAYAVAIAASMSWFPSRRGLVGGIVVAGFGGGSLVFDQFQTLYINPDNVRANVTAGGNERYFDQPAIIDRVPSCFVFLGLIYALMQAVGVALLRRPTAAELEERQELVGEAGDDTAAQETALDEGSPSKPVAMETSEHGNRG-----GELDSTPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSFGLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALM---------FVLSFGMAVLMSTFTLSGAPWYYLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALLTTVLKDAIGWLGLFLLGAAFSTLGAVFT 450          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000062462.1 (SMESG000062462.1)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 324/326 (99.39%), Postives = 326/326 (100.00%), Query Frame = 1
Query:   22 IGIAYSVAISAAINWLPNQRGLVIGIVVSGFGLGSMAFNQIQTLFINPNNLSPNITIETERYFDDRDMLDRVPKCFLLIGGMYGIMQLLGCLLLFTPISQIHHGKWVHSIRLETSKENDEGAQSFSGNVEISPLKALKSQDFWILWLTFVLTGVVTVYATSLYKTFGQLFIKSDYYLSVVGSVGSIFNSFGRIMWGEIVDKYSYKTAVRXXXXXXXXXXXXFYFCLLITNQIVAQIIHLLWICSILVNICGIFAIMPAAIAKLFGIKNVSTIFGMLFTANSIASIIGALTTSILISKIGYLGIFEMGAGMTFFAFILTFFHSNESL 999
            IGIAYSVAISAAINWLPNQRGLVIGIVVSGFGLGSMAFNQIQTLFINPNNLSPNITIET+RYFDDRDMLDRVPKCFLLIGGMYGIMQLLGCLLLFTPISQIHHGKWVHSIRLETSKENDEGAQSFSGNVEISPLKALKSQDFWILWLTFVLTGVVTVYATSLYKTFGQLFIKSDYYLSVVGSVGSIFNSFGRIMWGEIVDKYSYKTA+RLMTTMTTILMGTFYFCLLITNQIVAQIIHLLWICSILVNICGIFAIMPAAIAKLFGIKNVSTIFGMLFTANSIASIIGALTTSILISKIGYLGIFEMGAGMTFFAFILTFFHSNESL
Sbjct:   54 IGIAYSVAISAAINWLPNQRGLVIGIVVSGFGLGSMAFNQIQTLFINPNNLSPNITIETDRYFDDRDMLDRVPKCFLLIGGMYGIMQLLGCLLLFTPISQIHHGKWVHSIRLETSKENDEGAQSFSGNVEISPLKALKSQDFWILWLTFVLTGVVTVYATSLYKTFGQLFIKSDYYLSVVGSVGSIFNSFGRIMWGEIVDKYSYKTAMRLMTTMTTILMGTFYFCLLITNQIVAQIIHLLWICSILVNICGIFAIMPAAIAKLFGIKNVSTIFGMLFTANSIASIIGALTTSILISKIGYLGIFEMGAGMTFFAFILTFFHSNESL 379          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000062468.1 (SMESG000062468.1)

HSP 1 Score: 369.007 bits (946), Expect = 2.109e-126
Identity = 187/338 (55.33%), Postives = 250/338 (73.96%), Query Frame = 1
Query:   22 IGIAYSVAISAAINWLPNQRGLVIGIVVSGFGLGSMAFNQIQTLFINPNNLSPNITIETERYFDDRDMLDRVPKCFLLIGGMYGIMQLLGCLLLFTPISQIHHGKWVHSIRLETSKE---------NDEGAQSFSGNV---EISPLKALKSQDFWILWLTFVLTGVVTVYATSLYKTFGQLFIKSDYYLSVVGSVGSIFNSFGRIMWGEIVDKYSYKTAVRXXXXXXXXXXXXFYFCLLITNQIVAQIIHLLWICSILVNICGIFAIMPAAIAKLFGIKNVSTIFGMLFTANSIASIIGALTTSILISKIGYLGIFEMGAGMTFFAFILTFFHSNESL 999
            IGIAYSVAI+ A+ W P +RGLVIGIVV GFGLGS+ FNQ+QT FINP+N SPNITI T++YF D+ ML+RVP CFLLIGG+Y  +Q +GC+L FTP      G+ V +  LE             N E  +    N    ++  + ALK +DFWILWLT +  G+V V++T+LYKTFGQLFI  D++L+ VGS+ S FN+ GRI WG+I+DKYSYK A+R +T +TT+ +GTF  C L+ ++  ++I+  +W+C++L NICG+F+I+PAA +K FG+KNV+TI+GMLF+AN+IASI GAL+TSIL+SK+GYLGIFE+GAGM   AF+LTF H+   L
Sbjct:   80 IGIAYSVAIATAMKWYPARRGLVIGIVVGGFGLGSLVFNQVQTFFINPHNESPNITIGTDKYFGDKKMLERVPICFLLIGGIYASLQFIGCMLQFTPSIFEITGEIVVTEELEKESSLNVCIEEVVNSEIIECEYNNQIQNDVKSIDALKKRDFWILWLTLMFAGIVNVFSTTLYKTFGQLFINDDFFLATVGSIASFFNASGRIFWGQIMDKYSYKVAMRCITIITTVFIGTFICCKLVMHENGSKIMLTVWVCTLLANICGVFSILPAACSKAFGVKNVATIYGMLFSANAIASIFGALSTSILLSKVGYLGIFEIGAGMAIIAFLLTFAHAKSDL 417          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000062465.1 (SMESG000062465.1)

HSP 1 Score: 358.221 bits (918), Expect = 3.272e-122
Identity = 186/343 (54.23%), Postives = 244/343 (71.14%), Query Frame = 1
Query:   22 IGIAYSVAISAAINWLPNQRGLVIGIVVSGFGLGSMAFNQIQTLFINPNNLSPNITI-ETERYFDDRDMLDRVPKCFLLIGGMYGIMQLLGCLLLFTPISQIHHGKWVHSIRLETSKENDEGAQSF-------SGNVE-ISP--------LKALKSQDFWILWLTFVLTGVVTVYATSLYKTFGQLFIKSDYYLSVVGSVGSIFNSFGRIMWGEIVDKYSYKTAVRXXXXXXXXXXXXFYFCLLITNQIVAQIIHLLWICSILVNICGIFAIMPAAIAKLFGIKNVSTIFGMLFTANSIASIIGALTTSILISKIGYLGIFEMGAGMTFFAFILTFFHSNESL 999
            +GIAYSV ++A+I W PN +GLVIG+VV+GFGLGS+AFNQIQTL+INP N+SPN T  +T+RYF D  +L++VP CFL  G +Y  +QL+GC++LF+P       + + SI   T   N E + +F         N++ + P         KA+K +DFWILW  F+  G + VYATSLYKTFGQLFI SDYYL++VGSV SIFN+ GRI WG+++D++SYK A+R +   +TILMGTFY C L+ N I A+++ L+W+C I  NICGIFA+MPA  AKLFG+K V TI+G+LF+AN+ A I GALTTSI +SKI Y GIF +GAG+T  A ILTF H    L
Sbjct:   69 VGIAYSVVLAASIKWFPNNKGLVIGVVVAGFGLGSLAFNQIQTLYINPQNISPNFTKGDTDRYFTDEKVLEKVPYCFLYTGIIYASIQLIGCIILFSP----SQTEMMISILSNTGSSNSELSTNFISETYDDENNIQSLLPKDTHDSNIFKAIKQRDFWILWFIFMFCGTINVYATSLYKTFGQLFITSDYYLALVGSVASIFNAMGRIFWGQVMDRFSYKVAIRSIIINSTILMGTFYLCHLVPNSIGARVMFLIWVCGIFANICGIFAVMPAITAKLFGLKKVVTIYGILFSANAFAGIFGALTTSIFLSKINYFGIFGIGAGLTTIALILTFLHKRIDL 407          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000060694.1 (SMESG000060694.1)

HSP 1 Score: 260.766 bits (665), Expect = 2.736e-83
Identity = 134/312 (42.95%), Postives = 202/312 (64.74%), Query Frame = 1
Query:   25 GIAYSVAISAAINWLPNQRGLVIGIVVSGFGLGSMAFNQIQTLFINPNNLSPNITIETERYFDDRDMLDRVPKCFLLIGGMYGIMQLLGCLLLFTPISQIHHGKWVHSIRLETSKE----NDEG-----AQSFSGNVEISPLKALKSQDFWILWLTFVLTGVVTVYATSLYKTFGQLFIKSDYYLSVVGSVGSIFNSFGRIMWGEIVDKYSYKTAVRXXXXXXXXXXXXFYFCLLITNQIVAQIIHLLWICSILVNICGIFAIMPAAIAKLFGIKNVSTIFGMLFTANSIASIIGALTTSILISKIGYLGIF 933
            GI YSVA++ AI W P +RG+V GIV  GFGLGS+ FN IQT +INP N++PN T   E+YF D  +LD+VP CF+LIGGMY I+QL+G ++L  P     H +      + T  E    +D+       +SFS   + +  +A+K+  FWIL  TF   G+  V  +S YK+FGQ FI  D Y S+VG+V +IFNS GRI+WG +VD +SY+  +  +T + ++ +G+F+FC  I  ++ A+I++ LW+C +   + G F + PA  ++ FG KN++ I+G++  + SI++IIGAL +S+L+ +I Y G+F
Sbjct:  129 GITYSVAVATAIKWFPKRRGMVSGIVTGGFGLGSLIFNLIQTAYINPKNVAPNSTDLYEKYFVDDSVLDKVPFCFVLIGGMYAIIQLIGVVMLTDPTPDKEHKEMCSDNEILTDIEFKIQSDDAEMLKETKSFSKEFDFNVKEAVKNCRFWILSFTFFFNGMFIVIHSSYYKSFGQTFISDDRYFSIVGAVAAIFNSVGRIIWGTLVDFFSYRKVMTSLTVLKSLFIGSFFFCQFIEAEVGAKIMYFLWVCFLFFCLSGSFGLFPAITSQCFGNKNLAIIYGLIVISYSISAIIGALISSLLLPRIQYGGVF 440          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000060698.1 (SMESG000060698.1)

HSP 1 Score: 251.521 bits (641), Expect = 5.976e-80
Identity = 140/348 (40.23%), Postives = 209/348 (60.06%), Query Frame = 1
Query:   22 IGIAYSVAISAAINWLPNQRGLVIGIVVSGFGLGSMAFNQIQTLFINPNNLSPNITIETERYFDDRDMLDRVPKCFLLIGGMYGIMQLLGCLLLFTP--------ISQIHHGKWVHSIRLETSK----ENDEGAQSFSGNVEISPLKALKSQDFWILWLTFVLTGVVTVYATSLYKTFGQLFIKSDYYLSVVGSVGSIFNSFGRIMWGEIVDKYSYKTAVRXXXXXXXXXXXXFYFCLLITNQIVAQIIHLLWICSILVNICGIFAIMPAAIAKLFGIKNVSTIFGMLFTANSIASIIGALTTSILISKIGYLGIFEMGAGMTFFAFILTFFHSNESL*ML*TNKIRN 1029
            IGI YSVA++AA+ W P +RG++ GIV  GFGLGS  FN IQT +INP N+SPN T   E+YF D  +L+ VP CF+LIG MY ++QLLG +LL  P        I Q+++      I +E +      N E         + S   ALK+   WIL+LTF   G+  V  +S YK FGQ FIK+D + S+VG+V +IFNS GRI WG I D  SY+  +  +T   ++ +G+F FC  +T++  ++ ++ +W+C +   + G F I PA  +K FG KN++ I+G +FT  S++ I+GA+ +++++ KI Y G+F +  G +  +  LT F  +  L     N+I+N
Sbjct:  111 IGITYSVAMAAAMKWFPLKRGMIAGIVTGGFGLGSFIFNLIQTAYINPTNISPNTTDSFEKYFLDSSVLNNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMNN-----EINIEITNISFIANGEQRSGDHETNDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSMLSLTLTQFFRDSLL-----NQIKN 448          
The following BLAST results are available for this feature:
BLAST of MFS domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Y59A8B.215.814e-3528.44pep chromosome:WBcel235:V:17986260:17994546:1 gene... [more]
F10G7.56.914e-3129.97pep chromosome:WBcel235:II:4693414:4696408:1 gene:... [more]
F10G7.56.914e-3129.97pep chromosome:WBcel235:II:4693542:4696408:1 gene:... [more]
F10G7.58.382e-3129.97pep chromosome:WBcel235:II:4693414:4696408:1 gene:... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF066.831e-11954.23Slc16a-5 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A1S3HHM81.405e-6937.76uncharacterized protein LOC106155360 isoform X2 OS... [more]
A0A1I8HYG02.603e-6936.84MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8HL503.329e-6936.55MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A267H5U23.818e-6936.55MFS domain-containing protein (Fragment) OS=Macros... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062462.10.000e+099.39SMESG000062462.1[more]
SMESG000062468.12.109e-12655.33SMESG000062468.1[more]
SMESG000062465.13.272e-12254.23SMESG000062465.1[more]
SMESG000060694.12.736e-8342.95SMESG000060694.1[more]
SMESG000060698.15.976e-8040.23SMESG000060698.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017046 ID=SMED30017046|Name=MFS domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1032bp
AGAAATATCAGAAAATAAAGAATTGGTATTGCTTATTCGGTTGCAATATC
AGCCGCTATTAACTGGCTTCCCAATCAAAGAGGTTTAGTAATTGGAATCG
TCGTTTCAGGATTTGGGCTTGGATCTATGGCTTTCAATCAAATACAAACT
CTATTTATTAATCCAAACAACCTCTCACCAAATATTACAATCGAAACTGA
AAGATATTTTGATGATCGAGACATGCTGGATAGAGTTCCAAAATGCTTTT
TACTAATTGGTGGAATGTATGGAATAATGCAATTACTTGGATGCCTTTTA
TTGTTTACTCCAATTTCACAGATTCATCATGGAAAATGGGTTCATTCTAT
TAGATTAGAAACATCTAAAGAAAATGATGAAGGAGCGCAATCATTTTCGG
GGAATGTCGAAATATCACCATTGAAAGCTCTTAAAAGTCAAGATTTTTGG
ATCTTATGGCTTACATTTGTACTTACTGGTGTTGTTACTGTTTACGCTAC
ATCATTATATAAAACATTTGGCCAATTATTTATCAAAAGTGATTATTATT
TATCAGTTGTCGGGTCAGTAGGCTCTATTTTCAATTCATTCGGTAGAATA
ATGTGGGGCGAAATTGTAGACAAATACTCTTATAAAACTGCAGTGCGACT
TATGACTACAATGACCACTATTTTAATGGGGACGTTTTATTTCTGTCTTT
TAATTACTAATCAAATTGTTGCCCAAATTATACATCTACTGTGGATTTGC
TCAATTTTAGTAAATATTTGCGGAATCTTTGCTATAATGCCGGCTGCCAT
AGCAAAGTTATTTGGCATAAAAAATGTATCTACCATTTTCGGAATGTTGT
TTACGGCTAATTCTATTGCCAGCATCATTGGAGCACTAACCACGAGCATT
CTGATTTCAAAAATTGGATATTTAGGCATTTTTGAAATGGGAGCTGGAAT
GACATTTTTTGCTTTTATTCTGACGTTTTTTCATTCTAATGAAAGCCTTT
AGATGTTGTAAACAAATAAAATTAGAAATTAG
back to top

protein sequence of SMED30017046-orf-1

>SMED30017046-orf-1 ID=SMED30017046-orf-1|Name=SMED30017046-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=292bp
MAFNQIQTLFINPNNLSPNITIETERYFDDRDMLDRVPKCFLLIGGMYGI
MQLLGCLLLFTPISQIHHGKWVHSIRLETSKENDEGAQSFSGNVEISPLK
ALKSQDFWILWLTFVLTGVVTVYATSLYKTFGQLFIKSDYYLSVVGSVGS
IFNSFGRIMWGEIVDKYSYKTAVRLMTTMTTILMGTFYFCLLITNQIVAQ
IIHLLWICSILVNICGIFAIMPAAIAKLFGIKNVSTIFGMLFTANSIASI
IGALTTSILISKIGYLGIFEMGAGMTFFAFILTFFHSNESL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 98..291
e-value: 4.8E-16
score: 60.5
NoneNo IPR availablePANTHERPTHR11360:SF3OXALATE/FORMATE ANTIPORTERcoord: 1..285
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 1..285
NoneNo IPR availableCDDcd17353MFS_OFA_likecoord: 37..285
e-value: 2.1265E-31
score: 118.482
NoneNo IPR availableTMHMMTMhelixcoord: 236..258
NoneNo IPR availableTMHMMTMhelixcoord: 41..63
NoneNo IPR availableTMHMMTMhelixcoord: 204..226
NoneNo IPR availableTMHMMTMhelixcoord: 141..160
NoneNo IPR availableTMHMMTMhelixcoord: 263..285
NoneNo IPR availableTMHMMTMhelixcoord: 175..197
NoneNo IPR availableTMHMMTMhelixcoord: 107..128
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 40..286