SMED30017045

Overview
NameSMED30017045
Smed IDSMED30017045
Length (bp)2010
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30017045 (SMED30017045) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30017045 (SMED30017045) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Alignments
SMED30017045 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.004960:13614..16381 +9714
Homology
BLAST of SMED30017045 vs. TrEMBL
Match: Q868D5 (Uncharacterized protein Dryg OS=Dugesia ryukyuensis OX=79738 GN=Dryg PE=2 SV=1)

HSP 1 Score: 696.812 bits (1797), Expect = 0.000e+0
Identity = 369/644 (57.30%), Postives = 487/644 (75.62%), Query Frame = 2
Query:   44 QIQGS--YDFYSHYCSGSYYTDPSKVYFCQYVKGPSDMEKVPFPTGGECTACKEFLKRITWNSHSEEAVDNLLKYTTNHFCEDVKRTTSSECKTKLNEYRPKIKEFLVKMMKDSSFCEVLLKCSEKKGVLFMSYFSQYKPDWMDFYSMPFFEYFFNLKSYSHDXXXXXXXXXXXXXQETGFPSYTYLEHFYENPKNDSTMHPYRFFEYFFSNDXXXXXXXXXXXXXXXXXNSHYESDFYPY-TFFQEFFSDEYYNYYSKDQKPTDKFCKRCENIPAERFLKWANSIDIKMLTDAGYIAMCSNMKSTEKEKCREMILHVGRVILHKLESVLSVKSICHQIYRCPMNIEMKTEDFTFYEKP--HPKKPTKQCEVCSLITNVYSNAMDKDIFEKYVVEIFQMKYCNKLFPKKENECKKFLKNELPNILNKIRVSLHKNYLCNLTCNANPNSLWXXXXXXXXXXXNDKKCPVCKIIMTLLKSLIRSSDLKTEVYRRSEESYCDIIFKSKSKCRTFLRSNYTSIIKNMSRIIESNFLCKPYC-KKNDILMFPSYYYYEVEETSCDMCEDLVDALEEFNPSSITIDNDLNRLCQLFTGKKETYCKTLLDQYKTQIKTLIVNNRPKDEICRTINQCFTNPKFYGIFSYHHL 1957
            QIQG   +++Y HYC G+YYT P+K YFC Y+K  ++ E VPFPT  EC  CKE LKRITWNSHSE+AV+NLL YTT HFCE+VKR+T  EC++KLNEY+PK+KEFLVK+MK+  FCEVLLKC+EKK VLF +YF++Y  DW DFYSMPFFEYFFN ++YS DFYPYHFFNYFY+YQ+   P+Y Y ++FYE P  ++ M P+ +F+YF+ N    + +FP +FF  +F N+ Y S  + +  F+  FF+DEY+ ++ +DQKP++KFC RCENIP  +FLKWA S+DIKMLTDAGY  MCS + +TE E+CRE+I H+G VILH+LE+VLSVK++C++IYRCPMN+E   E  +FY       ++ +K+CEVC   ++V+S+ +D+D+FE+ VV+ F+  YCNKLFPKKE+ CKKFLKNELPNILNK+RVS+H++YLCN TCN   +  W + F+E F +  DKKCP CK +  +LKSLIRSS  K  V R  +++ C  +F +  +C  F+   Y  I+KNM+  IE N LC+PYC KK++I++ P   Y++  ++SC++CEDL+D LEE NPS  TI++DL RLC+  TG +  YC +LL QYKTQIKTLI+NNRPKDEICRTINQCFTNPKFYGIF  + L
Sbjct:   15 QIQGHDYHNYYEHYCDGNYYTSPTKFYFCHYLKTTTESETVPFPTISECKTCKELLKRITWNSHSEKAVENLLDYTTKHFCENVKRSTKVECQSKLNEYKPKMKEFLVKIMKNGKFCEVLLKCAEKKDVLFTTYFTEYTTDWTDFYSMPFFEYFFNRENYSEDFYPYHFFNYFYHYQDNEHPTY-YHQYFYETPHTENHMFPHEYFQYFYKN--KTTNYFPHQFFHEYFFNNQYTSPTFNHNNFYDYFFTDEYHGFFERDQKPSEKFCNRCENIPESKFLKWAKSVDIKMLTDAGYKVMCSELNTTESERCREIISHIGTVILHELENVLSVKNVCYKIYRCPMNLETTNEMHSFYYDTFDFTRQTSKRCEVCKAFSDVFSSGIDRDLFEEMVVDQFEKVYCNKLFPKKEHMCKKFLKNELPNILNKLRVSIHRDYLCNSTCNGKLSKDWIVSFTEHFFTNEDKKCPACKYVSKILKSLIRSSGFKAAVIRSFQQTQCKTLFLATKECVNFIFREYNGIVKNMTTTIEENRLCRPYCNKKDNIVILPWTQYFDKSQSSCELCEDLIDDLEELNPSLTTIESDLERLCKSRTGTENQYCTSLLAQYKTQIKTLIINNRPKDEICRTINQCFTNPKFYGIFESYFL 655          
BLAST of SMED30017045 vs. TrEMBL
Match: A0A1W6I196 (Putative surfactant B-associated protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 1.253e-100
Identity = 153/153 (100.00%), Postives = 153/153 (100.00%), Query Frame = 2
Query:  902 MLTDAGYIAMCSNMKSTEKEKCREMILHVGRVILHKLESVLSVKSICHQIYRCPMNIEMKTEDFTFYEKPHPKKPTKQCEVCSLITNVYSNAMDKDIFEKYVVEIFQMKYCNKLFPKKENECKKFLKNELPNILNKIRVSLHKNYLCNLTCNA 1360
            MLTDAGYIAMCSNMKSTEKEKCREMILHVGRVILHKLESVLSVKSICHQIYRCPMNIEMKTEDFTFYEKPHPKKPTKQCEVCSLITNVYSNAMDKDIFEKYVVEIFQMKYCNKLFPKKENECKKFLKNELPNILNKIRVSLHKNYLCNLTCNA
Sbjct:    1 MLTDAGYIAMCSNMKSTEKEKCREMILHVGRVILHKLESVLSVKSICHQIYRCPMNIEMKTEDFTFYEKPHPKKPTKQCEVCSLITNVYSNAMDKDIFEKYVVEIFQMKYCNKLFPKKENECKKFLKNELPNILNKIRVSLHKNYLCNLTCNA 153          
BLAST of SMED30017045 vs. TrEMBL
Match: A0A2G8K9Z3 (Uncharacterized protein OS=Stichopus japonicus OX=307972 GN=BSL78_18317 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.077e-10
Identity = 74/345 (21.45%), Postives = 139/345 (40.29%), Query Frame = 2
Query:  929 MCSNMKSTEKEKCREMILHVGRVILHKLESVLSVKSICHQIYRCPMNIEMKTEDFTFYEKPHPKKPTKQ---------CEVCSLITNVYSNAMDKDIFEKYVVEIFQMKYCNKLFPKKENECKKFLKNELPNILNKIRVSLHKNYLCNLT--CNANPNSLWXXXXXXXXXXXNDKKCPVCKIIMTLLKSLIRSSDLKTEVYRRSEESYCDIIFKSKS-KCRTFLRSNYTSIIKNMSRIIESNFLCK--PYCKKNDILMFPSYYYYEVEETSCDMCEDLVDALEEF---NPSSITIDNDLNRLCQLFTGKKETYCKTLLDQYKTQIKTLIVNNRPKDEICRTINQC 1912
            +C+++  +   +C++ +   G ++++ L   L   S+C QI  C    E+ +  F   +   P  P  +         CEVC L+ +     +     E+ +    + K+C+ L     N+C  F+    P +L  +   +  + +C+    C A                    KC +C+ +M  L+++I       E+   + E  C ++  S S +C+ F+     +II  + + +    +C+    CK +    F        +   C +CE ++  LE       +   I+  L ++C L  G     C+  +DQY   I  LIV N     ICRT+  C
Sbjct: 1178 LCNDLGPSIGPQCQQYVSEYGPLVINFLLQYLDPASVCSQIGFCSGMNEVIS--FVELQSALPVSPMNEEPLEEEGAGCEVCKLVVSQIEVYLKDGATEEEITAALE-KFCSILPSSLANQCTAFMDQYGPVVLKLLADEMDPDQVCSFLKLCAAE--------------FQQSPKCTLCEYVMQKLETMISKQSTVAEI-EAALEKVCSLLPGSISDQCQQFVDQYTPTIINLIVQNVSPQLICRTLGLCKASSESEFQ-------QSPKCTLCEYVIQKLETMISKQSTVAEIEAALEKVCSLLPGSISDQCQQFVDQYTPTIINLIVQNVSPQLICRTLGLC 1497          
BLAST of SMED30017045 vs. TrEMBL
Match: A0A1W3JG78 (uncharacterized protein LOC100176110 isoform X8 OS=Ciona intestinalis OX=7719 GN=LOC100176110 PE=4 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.248e-9
Identity = 65/309 (21.04%), Postives = 133/309 (43.04%), Query Frame = 2
Query: 1001 LHKLESVLSVKSICHQIYRCPMNIEMKTEDFTFY-EKPHPKKPTKQCEVCSLITNVYSNAMDKDIFEKYVVEIFQMKYCNKLFPKKENECKKFLKNELPNILNKIRVSLHKNYLCNLTCNANPNSLWXXXXXXXXXXXNDKKCPVCKIIMTLLKSLIRSSDLKTEVYRRSEESYCDIIFKS-KSKCRTFLRSNYTSIIKNMSRIIESNFLCKPYCKKNDILMFPSYYYYEVEETSCDMCEDLVDALEEF---NPSSITIDNDLNRLCQLFTGKKETYCKTLLDQYKTQIKTLIVNNRPKDEICRTINQC 1912
            LH L SV     IC  +Y C    +   +  +   + P        C VC L+ +     ++ +  E  VV   + K C+ +      EC+ F+ +    +++ I   +    +C++    +P + ++              C VC +I T L  L+ S+  + E+    E+  C I+  + K++C + +      II+ +++ ++ + +C       ++ +  SY     + T+C++CE +   L+     N +   I   + ++C +     +T CKTL+DQY  +I  L+       ++C T+  C
Sbjct:  536 LH-LISVTDAGLICSTLYMCEEADKPAVQPVSVAKQAPVGAGDPISCAVCKLVVHELDQMLEGNKTEAAVVAALE-KVCSLMSGDIRQECQNFVDHYGRTLVDLIINEVESGAICSMLLLCSPQANYNKVS-------GSPTCEVCTLIATALDQLLTSNSTEQEIIAAVEK-VCSILPATYKTECDSLIDQYGVVIIQLLAQELDPSKICA------ELGLCVSYKSQVSDSTTCELCELVAGELDSLLTENSTESEIIAAVEKVCTILPSNLQTECKTLIDQYGKEIINLLAQQIKPAQLCATLKLC 828          

HSP 2 Score: 66.6254 bits (161), Expect = 1.661e-7
Identity = 71/343 (20.70%), Postives = 143/343 (41.69%), Query Frame = 2
Query:  908 TDAGYIA----MCSNMKSTEKEKCREMILHVGRVILHKLESVLSVKSICHQIYRCPMNIEMKTEDFTFYEKPHPKKPTKQCEVCSLITNVYSNAMDKDIFEKYVVEIFQMKYCNKLFPKKENECKKFLKNELPNILNKIRVSLHKNYLCNLTCNANPNSLWXXXXXXXXXXXNDKKCPVCKIIMTLLKSLIRSSDLKTEVYRRSEESYCDIIFKS-KSKCRTFLRSNYTSIIKNMSRIIESNFLCKPYCKKNDILMFPSYYYYEVEETSCDMCEDLVDALEEF---NPSSITIDNDLNRLCQLFTGKKETYCKTLLDQYKTQIKTLIVNNRPKDEICRTINQC 1912
            T+A  +A    +CS M    +++C+  + H GR ++  + + +   +IC  +  C             Y K     PT  CEVC+LI       +  +  E+ ++   + K C+ L    + EC   +      I+  +   L  + +C         +   +  S      +   C +C+++   L SL+  +  ++E+    E+  C I+  + +++C+T +      II  +++ I+   LC        + +  SY       T+C++CE +   L++      +   I + +  +C++     +T CK L+DQY T +  L+       E+C  I  C
Sbjct:  600 TEAAVVAALEKVCSLMSGDIRQECQNFVDHYGRTLVDLIINEVESGAICSMLLLCSPQAN--------YNKVS-GSPT--CEVCTLIATALDQLLTSNSTEQEIIAAVE-KVCSILPATYKTECDSLIDQYGVVIIQLLAQELDPSKIC---------AELGLCVSYKSQVSDSTTCELCELVAGELDSLLTENSTESEIIAAVEK-VCTILPSNLQTECKTLIDQYGKEIINLLAQQIKPAQLCAT------LKLCTSYAVSS--STTCEVCELVASELDKLLTDKSTETEIVDAVENICKVLPANLQTECKDLIDQYGTDLINLLAQEIKPSELCAAIKLC 912          

HSP 3 Score: 63.929 bits (154), Expect = 1.251e-6
Identity = 77/384 (20.05%), Postives = 148/384 (38.54%), Query Frame = 2
Query:  809 KDQKPTDKFCKRCENIPAE-RFLKWANSIDIKMLTDAGYIAMCSNMKSTEKEKCREMILHVGRVILHKLESVLSVKSICHQIYRCPMNIEMKTEDFTFYEKPHPKKPTKQCEVCSLITNVYSNAMDKDIFEKYVVEIFQMKYCNKLFPKKENECKKFLKNELPNILNKIRVSLHKNYLCNLT--CNANPNSLWXXXXXXXXXXXNDKKCPVCKIIMTLLKSLIRSSDLKTEVYRRSEESYCDIIFKSKSKCRTFLRSNYTSIIKNMSRIIESNFLCKP--YCKKNDILMFPSYYYYEVEETSCDMCEDLVDALEE---FNPSSITIDNDLNRLCQLFTGKKETYCKTLLDQYKTQIKTLIVNNRPKDEICRTINQCFTNPKFYG 1936
            K Q      C+ CE +  E   L   NS + +++  A    +C+ + S  + +C+ +I   G+ I++ L   +    +C  +  C                 +    +  CEVC L+ +     +     E  +V+  +   C  L    + ECK  +     +++N +   +  + LC     C++  N+             +D  C +C  +MT +  L+  +  +TE+    ++    I    K +C  F+  N   II+ +   I  + +C     C  ++ +MF S          CD+C+  +  L++    N +   ++  L+ LC       +  C  L+ QY  +I  +I N    D IC  +  C       G
Sbjct:  746 KSQVSDSTTCELCELVAGELDSLLTENSTESEII--AAVEKVCTILPSNLQTECKTLIDQYGKEIINLLAQQIKPAQLCATLKLC---------------TSYAVSSSTTCEVCELVASELDKLLTDKSTETEIVDAVE-NICKVLPANLQTECKDLIDQYGTDLINLLAQEIKPSELCAAIKLCSSYKNT--------QIKVRSDVTCELCTAVMTQVDKLLSENATQTEIVAALDKVCMIIPGDLKQQCVGFINDNGPMIIQLLLEEIAPSAVCSSLKLCSNSNKVMFKSSEL-------CDVCKAAIGFLDQEVGANSTKAEVEAALDNLCVKLPASLKETCDDLVKQYTPEILDMIENIADPDYICIHLKLCTAQNHMLG 1096          
BLAST of SMED30017045 vs. TrEMBL
Match: A0A3Q0JX34 (uncharacterized protein LOC100176110 isoform X9 OS=Ciona intestinalis OX=7719 GN=LOC100176110 PE=4 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.554e-9
Identity = 60/297 (20.20%), Postives = 128/297 (43.10%), Query Frame = 2
Query: 1037 ICHQIYRCPMNIEMKTEDFTFY-EKPHPKKPTKQCEVCSLITNVYSNAMDKDIFEKYVVEIFQMKYCNKLFPKKENECKKFLKNELPNILNKIRVSLHKNYLCNLTCNANPNSLWXXXXXXXXXXXNDKKCPVCKIIMTLLKSLIRSSDLKTEVYRRSEESYCDIIFKS-KSKCRTFLRSNYTSIIKNMSRIIESNFLCKPYCKKNDILMFPSYYYYEVEETSCDMCEDLVDALEEF---NPSSITIDNDLNRLCQLFTGKKETYCKTLLDQYKTQIKTLIVNNRPKDEICRTINQC 1912
            IC  +Y C    +   +  +   + P        C VC L+ +     ++ +  E  VV   + K C+ +      EC+ F+ +    +++ I   +    +C++    +P + ++              C VC +I T L  L+ S+  + E+    E+  C I+  + K++C + +      II+ +++ ++ + +C       ++ +  SY     + T+C++CE +   L+     N +   I   + ++C +     +T CKTL+DQY  +I  L+       ++C T+  C
Sbjct:  547 ICSTLYMCEEADKPAVQPVSVAKQAPVGAGDPISCAVCKLVVHELDQMLEGNKTEAAVVAALE-KVCSLMSGDIRQECQNFVDHYGRTLVDLIINEVESGAICSMLLLCSPQANYNKVS-------GSPTCEVCTLIATALDQLLTSNSTEQEIIAAVEK-VCSILPATYKTECDSLIDQYGVVIIQLLAQELDPSKICA------ELGLCVSYKSQVSDSTTCELCELVAGELDSLLTENSTESEIIAAVEKVCTILPSNLQTECKTLIDQYGKEIINLLAQQIKPAQLCATLKLC 828          

HSP 2 Score: 67.0106 bits (162), Expect = 1.190e-7
Identity = 71/343 (20.70%), Postives = 143/343 (41.69%), Query Frame = 2
Query:  908 TDAGYIA----MCSNMKSTEKEKCREMILHVGRVILHKLESVLSVKSICHQIYRCPMNIEMKTEDFTFYEKPHPKKPTKQCEVCSLITNVYSNAMDKDIFEKYVVEIFQMKYCNKLFPKKENECKKFLKNELPNILNKIRVSLHKNYLCNLTCNANPNSLWXXXXXXXXXXXNDKKCPVCKIIMTLLKSLIRSSDLKTEVYRRSEESYCDIIFKS-KSKCRTFLRSNYTSIIKNMSRIIESNFLCKPYCKKNDILMFPSYYYYEVEETSCDMCEDLVDALEEF---NPSSITIDNDLNRLCQLFTGKKETYCKTLLDQYKTQIKTLIVNNRPKDEICRTINQC 1912
            T+A  +A    +CS M    +++C+  + H GR ++  + + +   +IC  +  C             Y K     PT  CEVC+LI       +  +  E+ ++   + K C+ L    + EC   +      I+  +   L  + +C         +   +  S      +   C +C+++   L SL+  +  ++E+    E+  C I+  + +++C+T +      II  +++ I+   LC        + +  SY       T+C++CE +   L++      +   I + +  +C++     +T CK L+DQY T +  L+       E+C  I  C
Sbjct:  600 TEAAVVAALEKVCSLMSGDIRQECQNFVDHYGRTLVDLIINEVESGAICSMLLLCSPQAN--------YNKVS-GSPT--CEVCTLIATALDQLLTSNSTEQEIIAAVE-KVCSILPATYKTECDSLIDQYGVVIIQLLAQELDPSKIC---------AELGLCVSYKSQVSDSTTCELCELVAGELDSLLTENSTESEIIAAVEK-VCTILPSNLQTECKTLIDQYGKEIINLLAQQIKPAQLCAT------LKLCTSYAVSS--STTCEVCELVASELDKLLTDKSTETEIVDAVENICKVLPANLQTECKDLIDQYGTDLINLLAQEIKPSELCAAIKLC 912          

HSP 3 Score: 64.6994 bits (156), Expect = 6.993e-7
Identity = 77/384 (20.05%), Postives = 148/384 (38.54%), Query Frame = 2
Query:  809 KDQKPTDKFCKRCENIPAE-RFLKWANSIDIKMLTDAGYIAMCSNMKSTEKEKCREMILHVGRVILHKLESVLSVKSICHQIYRCPMNIEMKTEDFTFYEKPHPKKPTKQCEVCSLITNVYSNAMDKDIFEKYVVEIFQMKYCNKLFPKKENECKKFLKNELPNILNKIRVSLHKNYLCNLT--CNANPNSLWXXXXXXXXXXXNDKKCPVCKIIMTLLKSLIRSSDLKTEVYRRSEESYCDIIFKSKSKCRTFLRSNYTSIIKNMSRIIESNFLCKP--YCKKNDILMFPSYYYYEVEETSCDMCEDLVDALEE---FNPSSITIDNDLNRLCQLFTGKKETYCKTLLDQYKTQIKTLIVNNRPKDEICRTINQCFTNPKFYG 1936
            K Q      C+ CE +  E   L   NS + +++  A    +C+ + S  + +C+ +I   G+ I++ L   +    +C  +  C                 +    +  CEVC L+ +     +     E  +V+  +   C  L    + ECK  +     +++N +   +  + LC     C++  N+             +D  C +C  +MT +  L+  +  +TE+    ++    I    K +C  F+  N   II+ +   I  + +C     C  ++ +MF S          CD+C+  +  L++    N +   ++  L+ LC       +  C  L+ QY  +I  +I N    D IC  +  C       G
Sbjct:  746 KSQVSDSTTCELCELVAGELDSLLTENSTESEII--AAVEKVCTILPSNLQTECKTLIDQYGKEIINLLAQQIKPAQLCATLKLC---------------TSYAVSSSTTCEVCELVASELDKLLTDKSTETEIVDAVE-NICKVLPANLQTECKDLIDQYGTDLINLLAQEIKPSELCAAIKLCSSYKNT--------QIKVRSDVTCELCTAVMTQVDKLLSENATQTEIVAALDKVCMIIPGDLKQQCVGFINDNGPMIIQLLLEEIAPSAVCSSLKLCSNSNKVMFKSSEL-------CDVCKAAIGFLDQEVGANSTKAEVEAALDNLCVKLPASLKETCDDLVKQYTPEILDMIENIADPDYICIHLKLCTAQNHMLG 1096          
BLAST of SMED30017045 vs. Planmine SMEST
Match: SMESG000000719.1 (SMESG000000719.1)

HSP 1 Score: 1162.52 bits (3006), Expect = 0.000e+0
Identity = 620/639 (97.03%), Postives = 621/639 (97.18%), Query Frame = 2
Query:   41 IQIQGSYDFYSHYCSGSYYTDPSKVYFCQYVKGPSDMEKVPFPTGGECTACKEFLKRITWNSHSEEAVDNLLKYTTNHFCEDVKRTTSSECKTKLNEYRPKIKEFLVKMMKDSSFCEVLLKCSEKKGVLFMSYFSQYKPDWMDFYSMPFFEYFFNLKSYSHDXXXXXXXXXXXXXQETGFPSYTYLEHFYENPKNDSTMHPYRFFEYFFSNDXXXXXXXXXXXXXXXXXNSHYESDFYPYTFFQEFFSDEYYNYYSKDQKPTDKFCKRCENIPAERFLKWANSIDIKMLTDAGYIAMCSNMKSTEKEKCREMILHVGRVILHKLESVLSVKSICHQIYRCPMNIEMKTEDFTFYEKPHPKKPTKQCEVCSLITNVYSNAMDKDIFEKYVVEIFQMKYCNKLFPKKENECKKFLKNELPNILNKIRVSLHKNYLCNLTCNANPNSLWXXXXXXXXXXXNDKKCPVCKIIMTLLKSLIRSSDLKTEVYRRSEESYCDIIFKSKSKCRTFLRSNYTSIIKNMSRIIESNFLCKPYCKKNDILMFPSYYYYEVEETSCDMCEDLVDALEEFNPSSITIDNDLNRLCQLFTGKKETYCKTLLDQYKTQIKTLIVNNRPKDEICRTINQCFTNPKFYGIFSYHHL 1957
            IQIQGSYDFYSHYCSGSYYTDPSKVYFCQYVKGPSDMEKVPFPTGGECTACKEFLKRITWNSHSEEAVDNLLKYTTNHFCEDVKRTTSSECKTKLNEYRPKIKEFLVKMMKDSSFCEVLLKCSEKKGVLFMSYFSQYKPDWMDFYSMPFFEYFFNLKSYSHDFYPYHFFNYFYNYQETGFPSYTYLEHFYENPKNDSTMHPYRFFEYFFSNDSSKSTFFPFKFFEYFFKNSHYESDFYPYTFFQEFFSDEYYNYYSKDQKPTDKFCKRCENIPAERFLKWANSIDIKMLTDAGYIAMCSNMKSTEKEKCREMILHVGRVILHKLESVLSVKSICHQIYRCPMNIEMKTEDFTFYEKPHPKKPTKQCEVCSLITNVYSNAMDKDIFEKYVVEIFQMKYCNKLFPKKENECKKFLKNELPNILNKIRVSLHKNYLCNLTCNANPNSLWSMEFSEFFSSFNDK                  +DLKTEVYRRSEESYCDIIFKSKSKCRTFLRSNYTSIIKNMSRIIESNFLCKPYCKKNDILMFPSYYYYEVEETSCDMCEDLVDALEEFNPSSITIDNDLNRLCQLFTGKKETYCKTLLDQYKTQIKTLIVNNRPKDEICRTINQCFTNPKFYGIFSYHHL
Sbjct:   14 IQIQGSYDFYSHYCSGSYYTDPSKVYFCQYVKGPSDMEKVPFPTGGECTACKEFLKRITWNSHSEEAVDNLLKYTTNHFCEDVKRTTSSECKTKLNEYRPKIKEFLVKMMKDSSFCEVLLKCSEKKGVLFMSYFSQYKPDWMDFYSMPFFEYFFNLKSYSHDFYPYHFFNYFYNYQETGFPSYTYLEHFYENPKNDSTMHPYRFFEYFFSNDSSKSTFFPFKFFEYFFKNSHYESDFYPYTFFQEFFSDEYYNYYSKDQKPTDKFCKRCENIPAERFLKWANSIDIKMLTDAGYIAMCSNMKSTEKEKCREMILHVGRVILHKLESVLSVKSICHQIYRCPMNIEMKTEDFTFYEKPHPKKPTKQCEVCSLITNVYSNAMDKDIFEKYVVEIFQMKYCNKLFPKKENECKKFLKNELPNILNKIRVSLHKNYLCNLTCNANPNSLWSMEFSEFFSSFNDK------------------NDLKTEVYRRSEESYCDIIFKSKSKCRTFLRSNYTSIIKNMSRIIESNFLCKPYCKKNDILMFPSYYYYEVEETSCDMCEDLVDALEEFNPSSITIDNDLNRLCQLFTGKKETYCKTLLDQYKTQIKTLIVNNRPKDEICRTINQCFTNPKFYGIFSYHHL 634          
BLAST of SMED30017045 vs. Planmine SMEST
Match: SMESG000000723.1 (SMESG000000723.1)

HSP 1 Score: 157.147 bits (396), Expect = 3.202e-40
Identity = 156/671 (23.25%), Postives = 281/671 (41.88%), Query Frame = 2
Query:   65 FYSHYCSGSYYTDPSKVYFCQYVKGPSDMEKVPFPTGGECTACKEFLKRITWNSHSEEAVDNLLKYTTNHFCEDVKRTTSSECKTKLNEYRPKIKEFLVKMMKDSSFCEVLLKCSEKKGVLFMSYFSQYKPDWMDFYSMPFFEYFFNLKSYSHDXXXXXXXXXXXXXQETGFPSYTYLEHFYEN--PKNDSTMHPYRFFEYFFSNDXXXXXXXXXXXXXXXXXNSHYESDFYPYTFFQEFFSDEYYNYYSKDQKPT----------DKF----CKRCENIPAERFLKWANSIDI---KMLTDAGYIAMCSNMKSTEKEKCREMILHVGRVILHKLESVLSVKSICHQIYRC--------PMNIEMKTEDFTFYEKPHPKKPTKQCEVCSLITNVYSNAMDKDIFEKYVVEIFQMKYCNKLFPKKENECKKFLKNELPNILNKIRVSLHKNYLCNLTCNANPNSL---------------------WXXXXXXXXXXXNDKKCPVCKIIMTLLKSLIRSSDLKTEVYRRSEESYCDIIFKSKSKCRTFLRSNYTSIIKNMSRIIESNFLCKPYCKKNDILMFPSYYYYEVEETSCDMCEDLVDA----LEEFNPSSITIDNDLNRLCQLFTGKKETYCKTLLDQYKTQIKTLIVNNRPKDEICRTINQCFTN 1921
            +Y  +C  +  T P K  FC+Y K   + +   FPT  EC+ C  F++ + WN+H+E A+ NL+KYT   +C  VK +   +C   +N  +  I +FL KMM    FC++ L C+        ++F  +  +  D Y   FFE+F+   +Y  +F  Y  FN   + QE     Y + + F +N  P  ++++  Y  ++YFF                     S+  ++ Y + FF+ FF       + KD+             ++F    C+ CE I       W + + +   ++L +       SN+K  E  K  E+I++  + I +K +SV S+   C  + +C        P N +M TE             T QC VC   + + S   ++  F K   + F++ +C  +F K + EC  FL  +  N+L  +   + + YLC + C     S+                      +   +      ++ +CP   ++  LL   I S   K  V  + E++ C+ I  +K++C  F+ +++ +I+  M  ++    LC    +                +  C  C  ++D     L   N     I+  +  +C L    + + C  L    + +I  L++ +  +  IC +INQC ++
Sbjct:   26 YYKQFCRQNLITGPLKTGFCEYFKSFQNFKAKSFPTFQECSTCNAFIELLIWNNHTETALSNLMKYTQETYCNLVKASKKQKCTIMINSKKSYILKFLRKMMTKELFCKIFLNCTNPSDQTLRNHFYDFLLNSKDVYPTEFFEFFYQKHNYPWNFSEYSMFNSLSSRQEKSSHIYEFFQGFIKNLKPNRNNSLISYWDYKYFFE-------------------ESNNINEIYSWKFFEHFFIS-----HGKDEGFNFYYFFNNYIKNRFGKLSCQLCEIIGPFLLNNWFDKLTVSQQQILINPKTCKDFSNIK--ECYKTIEIIINYWKGIRNK-DSV-SIDFTCWSLLKCKKRNNLMTPFNNKMTTE-------------TVQCTVCKRFSEIISETSNEKNFIKDASDAFRLIFCPSIF-KTQKECSDFLSKDFKNLLQTLSSRIQQYYLCRIACPNKMTSINNNNNNNNNNNNNNNNNNNNNNNNNNNTSLQMKSESQCP---LVSLLLMETILSVKYKMVVKAKLEKAVCNDILINKTQCDFFMNTDFNTILMTMIHLLNEQVLCPNGVQTTHF----------KTDAKCKFCMKILDEFHVNLFSKNIYKNIIEEIIKNICILLDPLQRSRCNDLNTNSQLKIIYLLIRHDVRKYICASINQCLSS 641          
The following BLAST results are available for this feature:
BLAST of SMED30017045 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017045 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017045 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017045 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017045 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017045 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017045 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017045 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q868D50.000e+057.30Uncharacterized protein Dryg OS=Dugesia ryukyuensi... [more]
A0A1W6I1961.253e-100100.00Putative surfactant B-associated protein OS=Schmid... [more]
A0A2G8K9Z31.077e-1021.45Uncharacterized protein OS=Stichopus japonicus OX=... [more]
A0A1W3JG781.248e-921.04uncharacterized protein LOC100176110 isoform X8 OS... [more]
A0A3Q0JX344.554e-920.20uncharacterized protein LOC100176110 isoform X9 OS... [more]
back to top
BLAST of SMED30017045 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017045 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017045 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017045 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017045 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30017045 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000000719.10.000e+097.03SMESG000000719.1[more]
SMESG000000723.13.202e-4023.25SMESG000000723.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017045 ID=SMED30017045|Name=SMED30017045|organism=Schmidtea mediterranea sexual|type=transcript|length=2010bp
GATGTTTCTAGCATTTTGTTCACTACTTTTGCTTTCAGCTATTCAAATAC
AAGGTTCATATGATTTCTATTCGCATTACTGTTCAGGAAGTTATTATACC
GATCCATCAAAGGTCTATTTCTGTCAATATGTAAAAGGTCCCAGTGATAT
GGAAAAGGTCCCATTTCCTACAGGTGGTGAATGTACTGCTTGTAAAGAAT
TCCTGAAACGAATAACTTGGAATTCTCACTCCGAAGAAGCAGTTGACAAT
CTTTTGAAATACACTACAAACCACTTCTGTGAAGATGTCAAACGAACAAC
AAGCTCGGAATGCAAAACTAAACTTAATGAATATAGACCAAAAATTAAAG
AATTCTTAGTTAAAATGATGAAAGATTCCAGTTTCTGTGAAGTTTTACTA
AAATGCAGCGAAAAGAAAGGAGTCCTCTTCATGTCATACTTCAGCCAATA
TAAACCCGATTGGATGGATTTCTACTCAATGCCGTTTTTCGAATATTTTT
TTAATTTAAAAAGTTATTCCCATGACTTTTATCCGTATCATTTTTTCAAT
TACTTTTACAATTATCAAGAAACCGGATTTCCATCATACACTTATCTGGA
GCATTTTTACGAAAATCCAAAAAACGACAGCACCATGCATCCATACAGAT
TTTTTGAATATTTCTTTTCTAATGATAGTTCCAAATCAACTTTTTTCCCA
TTTAAATTTTTCGAATATTTTTTCAAAAATAGCCATTATGAATCAGATTT
TTATCCGTATACATTTTTCCAAGAATTTTTCTCTGATGAATATTACAATT
ACTACTCCAAGGATCAAAAACCCACAGACAAATTCTGCAAACGATGCGAA
AATATTCCAGCAGAGCGATTTTTGAAATGGGCCAATTCCATTGACATCAA
AATGCTTACTGATGCTGGCTACATCGCCATGTGTTCTAATATGAAATCAA
CAGAAAAAGAAAAATGCCGGGAAATGATTCTACACGTTGGACGAGTGATA
TTGCATAAATTGGAAAGTGTTTTGTCTGTGAAGTCTATTTGTCACCAAAT
CTACCGCTGCCCAATGAATATCGAAATGAAGACTGAAGATTTCACGTTTT
ACGAAAAGCCTCACCCGAAAAAACCCACCAAACAATGTGAAGTTTGTTCT
TTGATTACAAATGTTTACTCGAACGCCATGGATAAAGATATATTCGAAAA
ATATGTAGTGGAAATATTCCAAATGAAATACTGTAACAAACTCTTCCCAA
AGAAAGAAAATGAATGCAAAAAATTTCTCAAAAACGAACTACCAAATATC
CTAAACAAAATCCGAGTTTCCTTACACAAAAACTACTTATGCAACTTAAC
TTGTAATGCTAATCCCAACTCTTTATGGTCAATGGAATTTTCCGAATTCT
TTTCATCATTCAACGATAAAAAGTGCCCAGTTTGCAAAATCATTATGACA
TTGTTGAAGTCTCTCATTCGCTCTAGTGACTTAAAGACTGAAGTTTATAG
AAGAAGCGAAGAAAGCTATTGTGACATAATATTCAAATCAAAATCAAAAT
GCAGAACATTTTTAAGAAGTAACTATACAAGTATCATAAAAAATATGTCT
AGAATCATTGAGAGTAATTTCCTATGTAAACCCTATTGCAAGAAAAACGA
CATACTCATGTTTCCGTCATATTATTATTATGAAGTTGAAGAAACAAGCT
GTGACATGTGTGAAGACTTAGTCGATGCTTTAGAAGAATTTAATCCATCT
TCGATCACAATCGACAATGATCTGAACAGACTGTGCCAATTATTCACGGG
GAAAAAAGAAACATACTGCAAAACTCTCCTTGATCAATACAAAACTCAAA
TTAAAACACTAATTGTCAACAATCGACCAAAAGATGAGATTTGCCGCACG
ATTAATCAGTGTTTCACTAACCCAAAATTTTACGGAATTTTCAGTTATCA
TCATCTTTAAACACACTGAATAATTTTTCTTGTGAAAATATAATATTAAT
GAATTAGAAA
back to top

protein sequence of SMED30017045-orf-1

>SMED30017045-orf-1 ID=SMED30017045-orf-1|Name=SMED30017045-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=653bp
MFLAFCSLLLLSAIQIQGSYDFYSHYCSGSYYTDPSKVYFCQYVKGPSDM
EKVPFPTGGECTACKEFLKRITWNSHSEEAVDNLLKYTTNHFCEDVKRTT
SSECKTKLNEYRPKIKEFLVKMMKDSSFCEVLLKCSEKKGVLFMSYFSQY
KPDWMDFYSMPFFEYFFNLKSYSHDFYPYHFFNYFYNYQETGFPSYTYLE
HFYENPKNDSTMHPYRFFEYFFSNDSSKSTFFPFKFFEYFFKNSHYESDF
YPYTFFQEFFSDEYYNYYSKDQKPTDKFCKRCENIPAERFLKWANSIDIK
MLTDAGYIAMCSNMKSTEKEKCREMILHVGRVILHKLESVLSVKSICHQI
YRCPMNIEMKTEDFTFYEKPHPKKPTKQCEVCSLITNVYSNAMDKDIFEK
YVVEIFQMKYCNKLFPKKENECKKFLKNELPNILNKIRVSLHKNYLCNLT
CNANPNSLWSMEFSEFFSSFNDKKCPVCKIIMTLLKSLIRSSDLKTEVYR
RSEESYCDIIFKSKSKCRTFLRSNYTSIIKNMSRIIESNFLCKPYCKKND
ILMFPSYYYYEVEETSCDMCEDLVDALEEFNPSSITIDNDLNRLCQLFTG
KKETYCKTLLDQYKTQIKTLIVNNRPKDEICRTINQCFTNPKFYGIFSYH
HL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR008139SaposinB_dom
IPR011001Saposin-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 652..652
NoneNo IPR availableGENE3DG3DSA:1.10.225.10coord: 560..643
e-value: 4.7E-10
score: 41.8
coord: 469..550
e-value: 2.4E-5
score: 26.7
coord: 375..456
e-value: 1.2E-5
score: 27.7
coord: 58..140
e-value: 1.6E-7
score: 33.8
NoneNo IPR availablePANTHERPTHR11480SAPOSIN-RELATEDcoord: 563..638
coord: 57..139
coord: 269..543
NoneNo IPR availablePANTHERPTHR11480:SF3BCDNA.GH08312coord: 563..638
coord: 57..139
coord: 269..543
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.798
IPR008139Saposin B type domainSMARTSM00741sapb_4coord: 59..135
e-value: 0.11
score: 20.9
coord: 277..353
e-value: 1.1
score: 7.8
coord: 565..637
e-value: 3.4E-10
score: 49.9
coord: 473..546
e-value: 0.89
score: 9.0
coord: 377..451
e-value: 1.4
score: 6.4
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 57..139
score: 11.312
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 275..357
score: 8.316
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 375..457
score: 9.018
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 563..641
score: 14.447
IPR008139Saposin B type domainPROSITEPS50015SAP_Bcoord: 471..550
score: 9.346
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 378..449
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 59..135
IPR011001Saposin-likeSUPERFAMILYSSF47862Saposincoord: 565..637