V-type proton ATPase subunit E

Overview
NameV-type proton ATPase subunit E
Smed IDSMED30017042
Length (bp)829
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of V-type proton ATPase subunit E (SMED30017042) t-SNE clustered cells

Violin plots show distribution of expression levels for V-type proton ATPase subunit E (SMED30017042) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of V-type proton ATPase subunit E (SMED30017042) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for V-type proton ATPase subunit E (SMED30017042) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of V-type proton ATPase subunit E vs. Ensembl Human
Match: ATP6V1E1 (ATPase H+ transporting V1 subunit E1 [Source:HGNC Symbol;Acc:HGNC:857])

HSP 1 Score: 152.14 bits (383), Expect = 1.254e-44
Identity = 109/226 (48.23%), Postives = 154/226 (68.14%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI EYY+KKE QI+  K IQ SNLMN A+LK+L  + + I  LL  +K +L  + KD   Y+  L  L+ Q L QLLE  +++RC  +D  ++   + + +  Y+  TK  V+V ID+E++L  +I GGVE+   + KI+V NTL+SRLDL++ QM+PE+R  LFG N NRKF D
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD 226          
BLAST of V-type proton ATPase subunit E vs. Ensembl Human
Match: ATP6V1E1 (ATPase H+ transporting V1 subunit E1 [Source:HGNC Symbol;Acc:HGNC:857])

HSP 1 Score: 138.272 bits (347), Expect = 1.472e-39
Identity = 84/184 (45.65%), Postives = 120/184 (65.22%), Query Frame = 2
Query:  191 NKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
             ++VQ QR KI EYY+KKE QI+  K IQ SNLMN A+LK+L  + + I  LL  +K +L  + KD   Y+  L  L+ Q L QLLE  +++RC  +D  ++   + + +  Y+  TK  V+V ID+E++L  +I GGVE+   + KI+V NTL+SRLDL++ QM+PE+R  LFG N NRKF D
Sbjct:   21 GRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD 204          
BLAST of V-type proton ATPase subunit E vs. Ensembl Human
Match: ATP6V1E2 (ATPase H+ transporting V1 subunit E2 [Source:HGNC Symbol;Acc:HGNC:18125])

HSP 1 Score: 138.272 bits (347), Expect = 2.380e-39
Identity = 102/224 (45.54%), Postives = 151/224 (67.41%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHLN-NIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKF 733
            + +++ +V+KQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI EYY+KKE QI+  K I  S + N A+LK+L  + + I  LL  +K +L  I +D  +Y+  L +L+ Q LL+LLE  +++RC  +D+ ++   + + +  Y   +++ V V ID+E +L  N  GGVEV + N +I+V NTL+SRLDL + Q +PE+R  LFG NTNRKF
Sbjct:    1 MALSDVDVKKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKILMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLVLQGLLRLLEPVMIVRCRPQDLLLVEAAVQKAIPEYMTISQKHVEVQIDKEAYLAVNAAGGVEVYSGNQRIKVSNTLESRLDLSAKQKMPEIRMALFGANTNRKF 224          
BLAST of V-type proton ATPase subunit E vs. Ensembl Human
Match: ATP6V1E2 (ATPase H+ transporting V1 subunit E2 [Source:HGNC Symbol;Acc:HGNC:18125])

HSP 1 Score: 138.272 bits (347), Expect = 2.380e-39
Identity = 102/224 (45.54%), Postives = 151/224 (67.41%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHLN-NIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKF 733
            + +++ +V+KQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI EYY+KKE QI+  K I  S + N A+LK+L  + + I  LL  +K +L  I +D  +Y+  L +L+ Q LL+LLE  +++RC  +D+ ++   + + +  Y   +++ V V ID+E +L  N  GGVEV + N +I+V NTL+SRLDL + Q +PE+R  LFG NTNRKF
Sbjct:    1 MALSDVDVKKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKILMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPEVYQGLLDKLVLQGLLRLLEPVMIVRCRPQDLLLVEAAVQKAIPEYMTISQKHVEVQIDKEAYLAVNAAGGVEVYSGNQRIKVSNTLESRLDLSAKQKMPEIRMALFGANTNRKF 224          
BLAST of V-type proton ATPase subunit E vs. Ensembl Human
Match: ATP6V1E1 (ATPase H+ transporting V1 subunit E1 [Source:HGNC Symbol;Acc:HGNC:857])

HSP 1 Score: 136.732 bits (343), Expect = 3.780e-39
Identity = 99/226 (43.81%), Postives = 141/226 (62.39%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI EYY+KKE QI+  K IQ SNLMN A+LK+L  + + I                  G+Y+             LLE  +++RC  +D  ++   + + +  Y+  TK  V+V ID+E++L  +I GGVE+   + KI+V NTL+SRLDL++ QM+PE+R  LFG N NRKF D
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLIT-----------------GLYQ-------------LLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD 196          
BLAST of V-type proton ATPase subunit E vs. Ensembl Celegans
Match: vha-8 (Vacuolar H ATPase [Source:UniProtKB/TrEMBL;Acc:Q95X44])

HSP 1 Score: 162.54 bits (410), Expect = 3.711e-49
Identity = 107/224 (47.77%), Postives = 158/224 (70.54%), Query Frame = 2
Query:   71 VNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            +++N+VQKQ+ +M A I+ EANEK EEI+AK EEEF IEK ++VQ+QR KI E+++KKE Q++L + IQ SN +N  +L+ L  +++HI  +L+ ++  L  IS D   Y   LK L+ Q LLQLLEK+V++RC  KD+ ++ Q+LPE L   QK    T  VV+D++N L +   GGVE+S   GKI+V +TL+SRL+L+++Q++P++R  LFG N NR F D
Sbjct:    3 ISDNDVQKQLRHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRQKIMEFFEKKEKQVELQRKIQASNSLNAGRLRCLKAREDHIGAVLDEARSNLSRISGDAARYPAILKGLVMQGLLQLLEKEVVLRCREKDLRLVEQLLPECLDGLQKEWGSTTKVVLDKQNFLPSESAGGVELSARAGKIKVSSTLESRLELIANQIVPQVRTALFGPNPNRSFFD 226          
BLAST of V-type proton ATPase subunit E vs. Ensembl Fly
Match: Vha26 (gene:FBgn0283535 transcript:FBtr0346137)

HSP 1 Score: 167.162 bits (422), Expect = 8.984e-51
Identity = 104/226 (46.02%), Postives = 163/226 (72.12%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHLN-NIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ+QR KI EYY+KKE Q++L K IQ+SN++N A+LK+L  +++H+  +L+ ++ +LG ++K++  Y+  L +LI Q L Q++E  V++RC   DV ++  +LP  +  Y+    + V + ID ++ L+ +  GGVE+  +NG+I+V NTL+SRLDL+S Q++PE+R  LFG N NRKF D
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKKIQSSNMLNQARLKVLKVREDHVSSVLDDARKRLGEVTKNQSEYETVLTKLIVQGLFQIMEPKVILRCREVDVPLVRNVLPAAVEQYKAQINQNVELFIDEKDFLSADTCGGVELLALNGRIKVPNTLESRLDLISQQLVPEIRNALFGRNVNRKFTD 226          
BLAST of V-type proton ATPase subunit E vs. Ensembl Fly
Match: Vha26 (gene:FBgn0283535 transcript:FBtr0078701)

HSP 1 Score: 167.162 bits (422), Expect = 8.984e-51
Identity = 104/226 (46.02%), Postives = 163/226 (72.12%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHLN-NIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ+QR KI EYY+KKE Q++L K IQ+SN++N A+LK+L  +++H+  +L+ ++ +LG ++K++  Y+  L +LI Q L Q++E  V++RC   DV ++  +LP  +  Y+    + V + ID ++ L+ +  GGVE+  +NG+I+V NTL+SRLDL+S Q++PE+R  LFG N NRKF D
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKKIQSSNMLNQARLKVLKVREDHVSSVLDDARKRLGEVTKNQSEYETVLTKLIVQGLFQIMEPKVILRCREVDVPLVRNVLPAAVEQYKAQINQNVELFIDEKDFLSADTCGGVELLALNGRIKVPNTLESRLDLISQQLVPEIRNALFGRNVNRKFTD 226          
BLAST of V-type proton ATPase subunit E vs. Ensembl Fly
Match: Vha26 (gene:FBgn0283535 transcript:FBtr0078700)

HSP 1 Score: 167.162 bits (422), Expect = 8.984e-51
Identity = 104/226 (46.02%), Postives = 163/226 (72.12%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHLN-NIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ+QR KI EYY+KKE Q++L K IQ+SN++N A+LK+L  +++H+  +L+ ++ +LG ++K++  Y+  L +LI Q L Q++E  V++RC   DV ++  +LP  +  Y+    + V + ID ++ L+ +  GGVE+  +NG+I+V NTL+SRLDL+S Q++PE+R  LFG N NRKF D
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKKIQSSNMLNQARLKVLKVREDHVSSVLDDARKRLGEVTKNQSEYETVLTKLIVQGLFQIMEPKVILRCREVDVPLVRNVLPAAVEQYKAQINQNVELFIDEKDFLSADTCGGVELLALNGRIKVPNTLESRLDLISQQLVPEIRNALFGRNVNRKFTD 226          
BLAST of V-type proton ATPase subunit E vs. Ensembl Zebrafish
Match: atp6v1e1a (ATPase H+ transporting V1 subunit E1a [Source:ZFIN;Acc:ZDB-GENE-041212-51])

HSP 1 Score: 153.68 bits (387), Expect = 2.080e-45
Identity = 108/226 (47.79%), Postives = 152/226 (67.26%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHLN-NIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++  VQKQI++M A ID EA+EK EEI+AK EEEF IEK ++VQ QR KI EYY+KKE QI+  K IQ SNLMN A+LK+L  + + IK LL  ++ +L  I+KD   Y+  L+ L+ Q   QLLE  V+IRC  +DV ++   + + +  Y++  K  + V ID    L+ +I GGVEV   +G+I+  NTL+SRLDL++ QM+P++R  LFG N NRKF D
Sbjct:    1 MALSDAAVQKQIKHMMAFIDQEASEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLKARDDMIKDLLNDARERLATIAKDPNQYQTLLEGLVLQGFYQLLESRVIIRCRKEDVAMVQTAVQKNIPIYKEAVKSNIEVRIDENTFLSPDISGGVEVYNADGRIKASNTLESRLDLLAQQMMPDIRVSLFGANPNRKFTD 226          
BLAST of V-type proton ATPase subunit E vs. Ensembl Zebrafish
Match: atp6v1e1b (ATPase H+ transporting V1 subunit E1b [Source:ZFIN;Acc:ZDB-GENE-020419-11])

HSP 1 Score: 152.91 bits (385), Expect = 3.839e-45
Identity = 106/226 (46.90%), Postives = 152/226 (67.26%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHLN-NIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI EYY+KKE QI+  K IQ SNLMN A+LK+L  + + I  LL  ++ +L  +++D   Y   +  L+ Q   QLLE  V IRC  +DV I+   + + ++ Y+   K  + V ID++N L+  I GG+E+   +GKI+V NTL+SRL+L++ QM+PE+R  LFG N NRKF D
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLKARDDMIADLLNDARQRLANVARDPSRYAALMDGLVLQGFYQLLEPKVTIRCRKQDVGIVQAAVQKNISIYKAAVKNNLEVRIDQDNFLSPEISGGIELYNADGKIKVANTLESRLELIAQQMMPEIRVALFGANQNRKFMD 226          
BLAST of V-type proton ATPase subunit E vs. Ensembl Xenopus
Match: nfe2l3 (nuclear factor, erythroid 2 like 3 [Source:Xenbase;Acc:XB-GENE-483338])

HSP 1 Score: 173.326 bits (438), Expect = 6.250e-53
Identity = 118/226 (52.21%), Postives = 159/226 (70.35%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI EYY+KKE QI+  K IQ SNLMN A+LK+L  + +HI +LL  ++ +L  + KD   Y+  L  LI Q L QLLE  VLIRC  +D  +I+  + + +  Y+  TK+ V V+ID+ENHL   I GGVE+   +GKI+V NTL+SRLDL++ QM+PE+R  LFG NTNRKF D
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLKARDDHISELLNEARQRLSRVVKDTARYQMLLDGLILQGLFQLLEPRVLIRCRKQDFPLISASVQKSIPTYKAATKQGVEVIIDQENHLPPEIAGGVELYNGDGKIKVSNTLESRLDLIAQQMMPEIRVALFGANTNRKFMD 226          
BLAST of V-type proton ATPase subunit E vs. Ensembl Xenopus
Match: nfe2l3 (nuclear factor, erythroid 2 like 3 [Source:Xenbase;Acc:XB-GENE-483338])

HSP 1 Score: 166.007 bits (419), Expect = 3.552e-50
Identity = 115/216 (53.24%), Postives = 150/216 (69.44%), Query Frame = 2
Query:   95 QIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            QI +M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI EYY+KKE QI+  K IQ SNLMN A+LK+L  + +HI +LL  ++ +L  + KD   Y+  L  LI Q L QLLE  VLIRC  +D  +I+  + + +  Y+  TK+ V V+ID+ENHL   I GGVE+   +GKI+V NTL+SRLDL++ QM+PE+R  LFG NTNRKF D
Sbjct:   10 QIRHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLKARDDHISELLNEARQRLSRVVKDTARYQMLLDGLILQGLFQLLEPRVLIRCRKQDFPLISASVQKSIPTYKAATKQGVEVIIDQENHLPPEIAGGVELYNGDGKIKVSNTLESRLDLIAQQMMPEIRVALFGANTNRKFMD 225          
BLAST of V-type proton ATPase subunit E vs. Ensembl Xenopus
Match: nfe2l3 (nuclear factor, erythroid 2 like 3 [Source:Xenbase;Acc:XB-GENE-483338])

HSP 1 Score: 164.466 bits (415), Expect = 1.606e-49
Identity = 114/215 (53.02%), Postives = 150/215 (69.77%), Query Frame = 2
Query:   98 IENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            I++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI EYY+KKE QI+  K IQ SNLMN A+LK+L  + +HI +LL  ++ +L  + KD   Y+  L  LI Q L QLLE  VLIRC  +D  +I+  + + +  Y+  TK+ V V+ID+ENHL   I GGVE+   +GKI+V NTL+SRLDL++ QM+PE+R  LFG NTNRKF D
Sbjct:    8 IKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLKARDDHISELLNEARQRLSRVVKDTARYQMLLDGLILQGLFQLLEPRVLIRCRKQDFPLISASVQKSIPTYKAATKQGVEVIIDQENHLPPEIAGGVELYNGDGKIKVSNTLESRLDLIAQQMMPEIRVALFGANTNRKFMD 222          
BLAST of V-type proton ATPase subunit E vs. Ensembl Xenopus
Match: nfe2l3 (nuclear factor, erythroid 2 like 3 [Source:Xenbase;Acc:XB-GENE-483338])

HSP 1 Score: 164.466 bits (415), Expect = 1.611e-49
Identity = 114/215 (53.02%), Postives = 150/215 (69.77%), Query Frame = 2
Query:   98 IENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            I++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI EYY+KKE QI+  K IQ SNLMN A+LK+L  + +HI +LL  ++ +L  + KD   Y+  L  LI Q L QLLE  VLIRC  +D  +I+  + + +  Y+  TK+ V V+ID+ENHL   I GGVE+   +GKI+V NTL+SRLDL++ QM+PE+R  LFG NTNRKF D
Sbjct:   14 IKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLKARDDHISELLNEARQRLSRVVKDTARYQMLLDGLILQGLFQLLEPRVLIRCRKQDFPLISASVQKSIPTYKAATKQGVEVIIDQENHLPPEIAGGVELYNGDGKIKVSNTLESRLDLIAQQMMPEIRVALFGANTNRKFMD 228          
BLAST of V-type proton ATPase subunit E vs. Ensembl Mouse
Match: Atp6v1e1 (ATPase, H+ transporting, lysosomal V1 subunit E1 [Source:MGI Symbol;Acc:MGI:894326])

HSP 1 Score: 151.754 bits (382), Expect = 9.585e-45
Identity = 109/226 (48.23%), Postives = 153/226 (67.70%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI EYY+KKE QI+  K IQ SNLMN A+LK+L  + + I  LL  +K +L  + KD   Y+  L  L+ Q L QLLE  +++RC  +D  ++   + + +  Y+  TK+ V+V ID+E +L   I GGVE+   + KI+V NTL+SRLDL++ QM+PE+R  LFG N NRKF D
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKKDVDVQIDQEAYLPEEIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD 226          
BLAST of V-type proton ATPase subunit E vs. Ensembl Mouse
Match: Atp6v1e2 (ATPase, H+ transporting, lysosomal V1 subunit E2 [Source:MGI Symbol;Acc:MGI:1922165])

HSP 1 Score: 135.191 bits (339), Expect = 2.471e-38
Identity = 99/224 (44.20%), Postives = 153/224 (68.30%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKF 733
            + + + +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI +Y++KKE QI+  K IQ S + N A++ +L  +   I +LL+ +K +L  I  DE IY++ L +L+ Q+LL+LLE  +++RC  +D+ ++   +   +  Y +  ++ + V +D+  HL +N  GGVEV + + KI+V NTL+SRL+L + Q +PE+R ILFG NT+RKF
Sbjct:    1 MALTDIDVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMDYFEKKEKQIEQQKKIQLSTMRNQARITVLRARDNLILELLKDAKMRLSRIVSDEEIYQDLLDKLVLQALLRLLEPVMIVRCRPQDLHLVESAVLRAIPQYMRLCQKHLEVQVDQTEHLPSNAAGGVEVYSSDQKIKVSNTLESRLNLAAMQKMPEIRGILFGDNTSRKF 224          
BLAST of V-type proton ATPase subunit E vs. Ensembl Mouse
Match: Atp6v1e2 (ATPase, H+ transporting, lysosomal V1 subunit E2 [Source:MGI Symbol;Acc:MGI:1922165])

HSP 1 Score: 135.191 bits (339), Expect = 2.471e-38
Identity = 99/224 (44.20%), Postives = 153/224 (68.30%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKF 733
            + + + +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI +Y++KKE QI+  K IQ S + N A++ +L  +   I +LL+ +K +L  I  DE IY++ L +L+ Q+LL+LLE  +++RC  +D+ ++   +   +  Y +  ++ + V +D+  HL +N  GGVEV + + KI+V NTL+SRL+L + Q +PE+R ILFG NT+RKF
Sbjct:    1 MALTDIDVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMDYFEKKEKQIEQQKKIQLSTMRNQARITVLRARDNLILELLKDAKMRLSRIVSDEEIYQDLLDKLVLQALLRLLEPVMIVRCRPQDLHLVESAVLRAIPQYMRLCQKHLEVQVDQTEHLPSNAAGGVEVYSSDQKIKVSNTLESRLNLAAMQKMPEIRGILFGDNTSRKF 224          
BLAST of V-type proton ATPase subunit E vs. Ensembl Mouse
Match: Atp6v1e2 (ATPase, H+ transporting, lysosomal V1 subunit E2 [Source:MGI Symbol;Acc:MGI:1922165])

HSP 1 Score: 135.191 bits (339), Expect = 2.471e-38
Identity = 99/224 (44.20%), Postives = 153/224 (68.30%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKF 733
            + + + +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI +Y++KKE QI+  K IQ S + N A++ +L  +   I +LL+ +K +L  I  DE IY++ L +L+ Q+LL+LLE  +++RC  +D+ ++   +   +  Y +  ++ + V +D+  HL +N  GGVEV + + KI+V NTL+SRL+L + Q +PE+R ILFG NT+RKF
Sbjct:    1 MALTDIDVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMDYFEKKEKQIEQQKKIQLSTMRNQARITVLRARDNLILELLKDAKMRLSRIVSDEEIYQDLLDKLVLQALLRLLEPVMIVRCRPQDLHLVESAVLRAIPQYMRLCQKHLEVQVDQTEHLPSNAAGGVEVYSSDQKIKVSNTLESRLNLAAMQKMPEIRGILFGDNTSRKF 224          
BLAST of V-type proton ATPase subunit E vs. Ensembl Mouse
Match: Atp6v1e1 (ATPase, H+ transporting, lysosomal V1 subunit E1 [Source:MGI Symbol;Acc:MGI:894326])

HSP 1 Score: 65.4698 bits (158), Expect = 4.852e-13
Identity = 55/102 (53.92%), Postives = 71/102 (69.61%), Query Frame = 2
Query:   98 IENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYK 403
            I++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI EYY+KKE QI+  K IQ SNLMN A+LK+L  + + I  LL  +K +L  + KD   Y+
Sbjct:    1 IKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQ 102          
BLAST of V-type proton ATPase subunit E vs. UniProt/SwissProt
Match: sp|P54611|VATE_DROME (V-type proton ATPase subunit E OS=Drosophila melanogaster OX=7227 GN=Vha26 PE=2 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 9.005e-50
Identity = 104/226 (46.02%), Postives = 163/226 (72.12%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHLN-NIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ+QR KI EYY+KKE Q++L K IQ+SN++N A+LK+L  +++H+  +L+ ++ +LG ++K++  Y+  L +LI Q L Q++E  V++RC   DV ++  +LP  +  Y+    + V + ID ++ L+ +  GGVE+  +NG+I+V NTL+SRLDL+S Q++PE+R  LFG N NRKF D
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKKIQSSNMLNQARLKVLKVREDHVSSVLDDARKRLGEVTKNQSEYETVLTKLIVQGLFQIMEPKVILRCREVDVPLVRNVLPAAVEQYKAQINQNVELFIDEKDFLSADTCGGVELLALNGRIKVPNTLESRLDLISQQLVPEIRNALFGRNVNRKFTD 226          
BLAST of V-type proton ATPase subunit E vs. UniProt/SwissProt
Match: sp|Q9U1G5|VATE_HETSC (V-type proton ATPase subunit E OS=Heterodera schachtii OX=97005 PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 4.364e-45
Identity = 108/224 (48.21%), Postives = 152/224 (67.86%), Query Frame = 2
Query:   71 VNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHLN-NIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            +++N+VQKQ+ +M A I+ EANEK EEI+AK EEEF IEK K+VQ QR KI EYY+KKE Q++L + IQ SN+ N ++LK L  + +H+K +LE ++  L  IS D   Y   LK L+ Q L QLLE  V++RC  KD +++ +ILPE L   Q+T      V ID E+ L+    GGVE+   +GKIRV +TL++RLDL++ ++ P++R  LFG N NR+F D
Sbjct:    3 ISDNDVQKQLRHMMAFIEQEANEKAEEIDAKAEEEFNIEKGKLVQLQRQKIMEYYEKKEKQVELQRKIQRSNMQNQSRLKCLKARDDHLKNVLEEARANLSKISADRERYPAILKGLLLQGLFQLLESKVVLRCRKKDEEMVARILPECLEEVQRTWGNRSEVKIDNEHFLSPESAGGVELLAKDGKIRVSSTLEARLDLIADKITPQVRTALFGPNQNRRFFD 226          
BLAST of V-type proton ATPase subunit E vs. UniProt/SwissProt
Match: sp|P11019|VATE1_BOVIN (V-type proton ATPase subunit E 1 OS=Bos taurus OX=9913 GN=ATP6V1E1 PE=2 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.425e-44
Identity = 110/226 (48.67%), Postives = 153/226 (67.70%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI EYY+KKE QI+  K IQ SNLMN A+LK+L  + + I  LL  +K +L  + KD   Y+  L  L+ Q L QLLE  +++RC  +D  ++   + + +  Y+  TKR V+V ID+E +L   I GGVE+   + KI+V NTL+SRLDL++ QM+PE+R  LFG N NRKF D
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPVYKVATKRDVDVQIDQEAYLPEEIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD 226          
BLAST of V-type proton ATPase subunit E vs. UniProt/SwissProt
Match: sp|Q4R761|VATE1_MACFA (V-type proton ATPase subunit E 1 OS=Macaca fascicularis OX=9541 GN=ATP6V1E1 PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 6.021e-44
Identity = 109/226 (48.23%), Postives = 154/226 (68.14%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI EYY+KKE QI+  K IQ SNLMN A+LK+L  + + I  LL  +K +L  + KD   Y+  L  L+ Q L QLLE  +++RC  +D  ++   + + +  Y+  TK  V+V ID+E++L  +I GGVE+   + KI+V NTL+SRLDL++ QM+PE+R  LFG N NRKF D
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD 226          
BLAST of V-type proton ATPase subunit E vs. UniProt/SwissProt
Match: sp|P36543|VATE1_HUMAN (V-type proton ATPase subunit E 1 OS=Homo sapiens OX=9606 GN=ATP6V1E1 PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 6.021e-44
Identity = 109/226 (48.23%), Postives = 154/226 (68.14%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI EYY+KKE QI+  K IQ SNLMN A+LK+L  + + I  LL  +K +L  + KD   Y+  L  L+ Q L QLLE  +++RC  +D  ++   + + +  Y+  TK  V+V ID+E++L  +I GGVE+   + KI+V NTL+SRLDL++ QM+PE+R  LFG N NRKF D
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFPLVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDLIAQQMMPEVRGALFGANANRKFLD 226          
BLAST of V-type proton ATPase subunit E vs. TrEMBL
Match: A0A1A9YKK4 (Uncharacterized protein OS=Glossina fuscipes fuscipes OX=201502 PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 4.588e-57
Identity = 112/226 (49.56%), Postives = 175/226 (77.43%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ+QR KI EYY+KKE Q++L K IQ+SN++N A+L++L  +++H+  +LE ++ +LG I+K++  YK+ L++LI Q+L Q +E++V++RC   DVD+I +ILP V+ NY++     + + +DRENHL +N+ GG+E+  +NG+++V NTL+SRLDL++ Q++PE+R  LFG N NRKFAD
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKKIQSSNMLNQARLEVLKVREDHVASVLEEARKRLGEITKNKAEYKQVLEKLILQALFQTMEQNVILRCRQADVDLIKEILPSVINNYKEIIGDDIEIAVDRENHLSSNLCGGIEIIALNGRVKVPNTLESRLDLIAQQLVPEIRNALFGRNVNRKFAD 226          
BLAST of V-type proton ATPase subunit E vs. TrEMBL
Match: A0A1B0C4F9 (Uncharacterized protein OS=Glossina palpalis gambiensis OX=67801 PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 4.588e-57
Identity = 112/226 (49.56%), Postives = 175/226 (77.43%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ+QR KI EYY+KKE Q++L K IQ+SN++N A+L++L  +++H+  +LE ++ +LG I+K++  YK+ L++LI Q+L Q +E++V++RC   DVD+I +ILP V+ NY++     + + +DRENHL +N+ GG+E+  +NG+++V NTL+SRLDL++ Q++PE+R  LFG N NRKFAD
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKKIQSSNMLNQARLEVLKVREDHVASVLEEARKRLGEITKNKAEYKQVLEKLILQALFQTMEQNVILRCRQADVDLIKEILPSVINNYKEIIGDDIEIAVDRENHLSSNLCGGIEIIALNGRVKVPNTLESRLDLIAQQLVPEIRNALFGRNVNRKFAD 226          
BLAST of V-type proton ATPase subunit E vs. TrEMBL
Match: A0A1A9WSC9 (Uncharacterized protein OS=Glossina brevipalpis OX=37001 PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 3.230e-56
Identity = 114/226 (50.44%), Postives = 172/226 (76.11%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ+QR KI EYY+KKE Q++L K IQ+SN++N A+L++L  +++H+  +LE ++ +LG I+K++  YK+ L++LI Q+L Q +EK V++RC   DVD I +ILP V  NY+K     + + +DR+NHL +++ GGVE+  +NG+I+V NTL+SRLDL++ Q++PE+R  LFG N NRKFAD
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKKIQSSNMLNQARLEVLKVREDHVASVLEEARKRLGEITKNKADYKQVLEKLILQALFQTMEKSVILRCRQADVDFIKEILPSVTNNYKKVIGDDIEINVDRDNHLCSSLCGGVEIIALNGRIKVPNTLESRLDLIAQQLVPEIRNALFGRNVNRKFAD 226          
BLAST of V-type proton ATPase subunit E vs. TrEMBL
Match: A0A1A9UZW8 (Uncharacterized protein OS=Glossina austeni OX=7395 PE=3 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 5.674e-56
Identity = 109/226 (48.23%), Postives = 173/226 (76.55%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ+QR KI EYY+KKE Q++L K IQ+SN++N A+L++L  +++H+  +LE ++ +LG I+K++  YK+ L++L+ Q+L Q +E+ V++RC   DVD++ +ILP V+ NY+      + + +DR+NHL +N+ GG+E+  +NG+++V NTL+SRLDL++ Q++PE+R  LFG N NRKFAD
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKKIQSSNMLNQARLEVLKVREDHVASVLEEARKRLGEITKNKAEYKQVLEKLVLQALFQTMEQSVILRCRQADVDLVKEILPSVVNNYKDIIGDDIEIAVDRDNHLSSNLCGGIEIIALNGRVKVPNTLESRLDLIAQQLVPEIRNALFGRNVNRKFAD 226          
BLAST of V-type proton ATPase subunit E vs. TrEMBL
Match: A0A1A9ZHJ1 (Uncharacterized protein OS=Glossina pallidipes OX=7398 PE=3 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 1.148e-55
Identity = 111/226 (49.12%), Postives = 172/226 (76.11%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ+QR KI EYY+KKE Q++L K IQ+SN++N A+L++L  +++H+  +LE ++ +LG I+K++  YK+ L++LI Q+L Q +EK V++RC   DVD+I +ILP V+  Y+      + + +DR+NHL +N+ GG+E+  +NG+++V NTL+SRLDL++ Q++PE+R  LFG N NRKFAD
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQQQRLKIMEYYEKKEKQVELQKKIQSSNMLNQARLEVLKVREDHVASVLEEARKRLGEITKNKAEYKQVLEKLILQALFQTMEKSVILRCRQADVDLIKEILPSVINYYKDIIGDDIEIAVDRDNHLSSNLCGGIEIIALNGRVKVPNTLESRLDLIAQQLVPEIRNALFGRNVNRKFAD 226          
BLAST of V-type proton ATPase subunit E vs. Ensembl Cavefish
Match: atp6v1e1a (V-type proton ATPase subunit E 1-like [Source:NCBI gene;Acc:103026420])

HSP 1 Score: 158.303 bits (399), Expect = 2.113e-47
Identity = 109/226 (48.23%), Postives = 156/226 (69.03%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHLN-NIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EE+EAK EEEF IEK ++VQ QR KI EYY+KKE QI+  K I+ SNLMN A+LK+L  + + +  LL  ++ +L  I+KD   Y   L+ L+ Q   Q LE  V+IRC  +DV ++   + + +  Y++T KR + V ID++N L+ ++ GGVEV   NGKI+V NTL+SRL+L++ QM+PE+R  LFG N NRKF D
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEVEAKAEEEFNIEKGRLVQTQRVKIMEYYEKKEKQIEQQKKIRMSNLMNQARLKVLKTRDDMVTDLLNEARKRLADIAKDPAKYSMLLEGLVLQGFYQQLEPKVIIRCRKEDVALVEGAVQKNIPIYKETVKRNIEVSIDKDNFLSPDVSGGVEVYNANGKIKVSNTLESRLELLAQQMMPEIRVELFGANQNRKFMD 226          
BLAST of V-type proton ATPase subunit E vs. Ensembl Cavefish
Match: atp6v1e1b (V-type proton ATPase subunit E 1-like [Source:NCBI gene;Acc:103026244])

HSP 1 Score: 149.443 bits (376), Expect = 5.738e-44
Identity = 104/226 (46.02%), Postives = 150/226 (66.37%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHLN-NIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI EYY+KKE QI+  K IQ SNLMN A+LK+L  + + I  +L  ++ +L  +++D   Y   +  L+ Q   QLLE  V IRC  +D+ ++   + + +  Y+   K  + V ID++N L   I GG+E+   +GKI+V NTL+SRLDL++ QM+PE+R  LFG N NRKF D
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLKARDDMISDMLNEARQRLANVARDPSRYSALIDGLVLQGFYQLLEPKVTIRCRKQDLALLQASVQKNIPIYKAAAKNNLEVRIDQDNFLPAEISGGIEIYNADGKIKVSNTLESRLDLIAQQMMPEIRVALFGANQNRKFMD 226          
BLAST of V-type proton ATPase subunit E vs. Ensembl Cavefish
Match: atp6v1e1a (V-type proton ATPase subunit E 1-like [Source:NCBI gene;Acc:103026420])

HSP 1 Score: 141.354 bits (355), Expect = 4.557e-41
Identity = 99/226 (43.81%), Postives = 142/226 (62.83%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHLN-NIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EE+EAK EEEF IEK ++VQ QR KI EYY+KKE QI+  K I+ SNLMN A+LK+L  + + +                  G Y++              E  V+IRC  +DV ++   + + +  Y++T KR + V ID++N L+ ++ GGVEV   NGKI+V NTL+SRL+L++ QM+PE+R  LFG N NRKF D
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEVEAKAEEEFNIEKGRLVQTQRVKIMEYYEKKEKQIEQQKKIRMSNLMNQARLKVLKTRDDMVT-----------------GFYQQL-------------EPKVIIRCRKEDVALVEGAVQKNIPIYKETVKRNIEVSIDKDNFLSPDVSGGVEVYNANGKIKVSNTLESRLELLAQQMMPEIRVELFGANQNRKFMD 196          
BLAST of V-type proton ATPase subunit E vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009927.1 (pep scaffold:Pmarinus_7.0:GL481399:6453:19951:1 gene:ENSPMAG00000008972.1 transcript:ENSPMAT00000009927.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.272 bits (347), Expect = 2.835e-40
Identity = 96/226 (42.48%), Postives = 157/226 (69.47%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI+ M A I+ EANEK EE+EAK EEEF IEK +++Q QR KI ++++KKE QI + K IQ SNLMN+A+LK+L  +++ I+ LL  +K +L   ++D   Y+  ++ L+ Q L QLLE  V+IRC  +DV ++ + + +  A Y+   KR +++ ID  + L  ++ GG+E+ + +G+I+V NTL+ RL+L++ Q++P++R +LF  N NR+F D
Sbjct:    1 MALSDADVQKQIKQMMAFIEQEANEKAEEVEAKAEEEFNIEKGRLLQTQRLKIIDHFEKKEKQIDMQKKIQVSNLMNHARLKVLKAREDLIQDLLADAKKRLVTDARDPARYRSLIEGLLMQGLFQLLEPQVVIRCRQQDVTLVKEAMEKGKAEYKACVKRDIHIRIDENDCLPPDVAGGLEMYSGDGRIKVENTLEKRLELIAEQLLPDVRVMLFKVNPNRRFFD 226          
BLAST of V-type proton ATPase subunit E vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002075.1 (pep scaffold:Pmarinus_7.0:GL478102:45668:49015:-1 gene:ENSPMAG00000001886.1 transcript:ENSPMAT00000002075.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.7297 bits (208), Expect = 2.896e-21
Identity = 41/98 (41.84%), Postives = 63/98 (64.29%), Query Frame = 2
Query:  449 EKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHLN-NIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            E  V++RC   D+ ++   + + +  Y+  TK+ + + +D +  L  +I GGVE+   N KI+V NTLDSRL+ MS QM+PE+R  L+G N+NRKF D
Sbjct:    8 EPVVIVRCRQSDLALVKSSVTKNIPTYRAATKKEICITVDEQLFLPLDICGGVELYNANAKIKVSNTLDSRLEFMSHQMMPEIRVYLYGKNSNRKFND 105          
BLAST of V-type proton ATPase subunit E vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003615.1 (pep scaffold:Pmarinus_7.0:GL479041:4766:11691:-1 gene:ENSPMAG00000003304.1 transcript:ENSPMAT00000003615.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 2.231e-12
Identity = 46/113 (40.71%), Postives = 82/113 (72.57%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYK 403
            + + + +V KQ+++M A I+ EA EKVEEI++K EEEF +EK +++Q  R+KI E+Y KK+ Q+++ K IQ SNLMN ++LK+L  + + +K+LL  ++ +L  ++++  +Y+
Sbjct:    1 MPLTDGDVLKQVKHMVAFIEQEATEKVEEIDSKAEEEFNLEKGRLMQSHRSKIMEHYDKKDKQLEMQKKIQISNLMNQSRLKVLETRNDLLKELLNEARGRLVQLTRNATVYR 113          
BLAST of V-type proton ATPase subunit E vs. Ensembl Yeast
Match: VMA4 (Subunit E of the V1 domain of the vacuolar H+-ATPase (V-ATPase); V-ATPase is an electrogenic proton pump found throughout the endomembrane system; V1 domain has eight subunits; required for the V1 domain to assemble onto the vacuolar membrane; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000005859])

HSP 1 Score: 80.8777 bits (198), Expect = 9.493e-19
Identity = 75/231 (32.47%), Postives = 133/231 (57.58%), Query Frame = 2
Query:   56 SMTIVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANY-QKTTKRTVNVVIDRENHLNN--IMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            S    +  N+V  ++  M A I  EA EK +EI+ K ++E++IEK  IV+ +   I+  +K K  +  L++ I  S + N  +LK+LS +++ +  + E +K KL  I+ +   YK  L+ LI ++LL+LLE   +++   +DVD+I  +  +++  Y +K  +  +  ++   ++LN   + GGV VS  + KI + NTL+ RL L+S + +P +R  L+G +  RKF D
Sbjct:    3 SAITALTPNQVNDELNKMQAFIRKEAEEKAKEIQLKADQEYEIEKTNIVRNETNNIDGNFKSKLKKAMLSQQITKSTIANKMRLKVLSAREQSLDGIFEETKEKLSGIANNRDEYKPILQSLIVEALLKLLEPKAIVKALERDVDLIESMKDDIMREYGEKAQRAPLEEIVISNDYLNKDLVSGGVVVSNASDKIEINNTLEERLKLLSEEALPAIRLELYGPSKTRKFFD 233          
BLAST of V-type proton ATPase subunit E vs. Ensembl Nematostella
Match: EDO39197 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAS6])

HSP 1 Score: 157.918 bits (398), Expect = 1.280e-47
Identity = 104/224 (46.43%), Postives = 158/224 (70.54%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHLN-NIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKF 733
            + +N+ EV+KQIE+M   I+ EA EK EEI+AK EEEF IEK ++VQ++R KI  YY+KKE Q++L K IQ SN +N ++LK+L  + +HIK++L+ +  +LG +++D+G Y++ ++ LI+Q L QLLE  VLIRC  +DV ++  +       Y+K TK+ + + +D +N L  +  GG+E+    GKI+VVNTL+SRL+++  QM+PE+REILFG N  R F
Sbjct:    1 MALNDAEVKKQIEHMMKFIEQEAKEKAEEIDAKAEEEFNIEKGRLVQQERLKIMNYYEKKEKQVELQKKIQRSNQLNQSRLKVLKSQDDHIKRILDEAVERLGKVTQDQGKYQQIIQGLITQGLYQLLESKVLIRCRKQDVSLVKAVFGPATEEYKKQTKKEIELTVDEQNFLGPDCAGGIELHAKQGKIKVVNTLESRLEMLGRQMMPEIREILFGRNKGRHF 224          
BLAST of V-type proton ATPase subunit E vs. Ensembl Medaka
Match: atp6v1e1b (V-type proton ATPase subunit E 1 [Source:NCBI gene;Acc:101174147])

HSP 1 Score: 159.073 bits (401), Expect = 1.321e-47
Identity = 109/226 (48.23%), Postives = 153/226 (67.70%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + +++ +VQKQI++M A I+ EANEK EEI+AK EEEF IEK ++VQ QR KI EYY+KKE QI+  K IQ SNLMN A+LK+L  + + I  +L  ++ +L  I+KD   Y   +  L+ Q   QLLE  V IRC  +DV ++   + + +  Y+   K ++ V ID+EN L +++ GG+E+   NGKI+V NTL+SRLDLM+ QM+PE+R  LFG N NRKF D
Sbjct:    1 MALSDADVQKQIKHMMAFIEQEANEKAEEIDAKAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLKVLKARDDMISDMLNEARQRLTNIAKDPSRYAGLMDGLLMQGFYQLLEPKVTIRCRKQDVQLVQASIQKNIPIYKAAVKNSLEVRIDQENFLPSDVSGGIEIYNANGKIKVSNTLESRLDLMAQQMMPEIRVALFGANPNRKFLD 226          
BLAST of V-type proton ATPase subunit E vs. Ensembl Medaka
Match: atp6v1e1a (V-type proton ATPase subunit E 1 [Source:NCBI gene;Acc:101155846])

HSP 1 Score: 145.206 bits (365), Expect = 2.578e-42
Identity = 105/226 (46.46%), Postives = 151/226 (66.81%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHL-NNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + + + +VQKQI++M A I+ EA EKVEEI +K EEEF IEK ++VQ  R KI E+++KKE QI+  K IQ S+LMN  +LK+L  + + I  LL  ++ +L  ++KD   Y + L  LI Q L QLLE  V IRC  +DV+I+   + + +  YQ+  + ++ V IDR+  L  +I GG+E+   NGKI+V NTL+SRL+L++ QM+PE+R  LFG N NRKF D
Sbjct:    1 MALTDADVQKQIKHMMAFIEQEAKEKVEEINSKAEEEFNIEKGRLVQTHRVKIMEFFEKKEKQIEQHKRIQTSHLMNQGRLKVLKARDDMITDLLNEARKRLSELAKDPETYSKLLDGLILQGLYQLLEPKVTIRCRQQDVEIVQASVRKNIPIYQEAVRSSIAVRIDRDLFLPPDICGGIEMCNENGKIKVSNTLESRLELLAEQMMPEIRVSLFGANPNRKFLD 226          
BLAST of V-type proton ATPase subunit E vs. Ensembl Medaka
Match: atp6v1e1a (V-type proton ATPase subunit E 1 [Source:NCBI gene;Acc:101155846])

HSP 1 Score: 110.538 bits (275), Expect = 3.858e-29
Identity = 99/227 (43.61%), Postives = 138/227 (60.79%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHLNNIMGGVEVSTINGK--IRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + + + +VQKQI++M A I+ EA EKVEEI +K EEEF IEK ++VQ  R KI E+++KKE QI+  K IQ S+LMN  +LK+L  + + I  LL  ++ +L  ++KD   Y + L  LI Q L QLLE  V IRC  +DV+I         A+ +K      N+ I +E         V    I+ K  I+V NTL+SRL+L++ QM+PE+R  LFG N NRKF D
Sbjct:    1 MALTDADVQKQIKHMMAFIEQEAKEKVEEINSKAEEEFNIEKGRLVQTHRVKIMEFFEKKEKQIEQHKRIQTSHLMNQGRLKVLKARDDMITDLLNEARKRLSELAKDPETYSKLLDGLILQGLYQLLEPKVTIRCRQQDVEI---------ASVRK------NIPIYQE--------AVRSGLIDPKFLIKVSNTLESRLELLAEQMMPEIRVSLFGANPNRKFLD 204          
BLAST of V-type proton ATPase subunit E vs. Planmine SMEST
Match: SMESG000064093.1 (SMESG000064093.1)

HSP 1 Score: 376.711 bits (966), Expect = 2.459e-133
Identity = 226/227 (99.56%), Postives = 227/227 (100.00%), Query Frame = 2
Query:   59 MTIVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHLNNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            MTIVVNENEVQKQIENMTALIDLEANEKVEEIEAKTEEEFQIEKNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETLKQLISQSLLQLLEKDVLIRCHAKDVDIINQILPEVLA+YQKTTKRTVNVVIDRENHLNNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD
Sbjct:    1 MTIVVNENEVQKQIENMTALIDLEANEKVEEIEAKTEEEFQIEKNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETLKQLISQSLLQLLEKDVLIRCHAKDVDIINQILPEVLASYQKTTKRTVNVVIDRENHLNNIMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 227          
BLAST of V-type proton ATPase subunit E vs. Planmine SMEST
Match: SMESG000000425.1 (SMESG000000425.1)

HSP 1 Score: 160.229 bits (404), Expect = 3.623e-48
Identity = 105/226 (46.46%), Postives = 167/226 (73.89%), Query Frame = 2
Query:   65 IVVNENEVQKQIENMTALIDLEANXXXXXXXXXXXXXXXXXXNKIVQEQRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEASKYKLGLISKDEGIYKETXXXXXXXXXXXXXEKDVLIRCHAKDVDIINQILPEVLANYQKTTKRTVNVVIDRENHLNN-IMGGVEVSTINGKIRVVNTLDSRLDLMSSQMIPELREILFGFNTNRKFAD 739
            + + +++V+KQI+NM + I+ EA EKV+EI +K +EEF+IEK+++VQ+QR+K+ E++ K+E +++  K IQ+SN+MN A+LKIL  +QEHI+ +LE ++ +L  ++ D   YKET+K+LI Q L QLLE  V+IRC   D+ ++ +IL E  + Y++ T   + + ++R+  L++ I GGVE+   NG+++VVNTL+SRL L+S Q+IPE+RE+LFG N NR F D
Sbjct:    1 MALTDDDVRKQIKNMISFIEQEAKEKVDEINSKADEEFEIEKSRLVQDQRSKMNEFFTKEEKKLEQRKKIQHSNMMNQARLKILGCQQEHIRDVLEETQKQLYNLTNDPHKYKETMKRLIVQGLFQLLEPKVIIRCRQSDIKLVEEILEECASKYEEKTDMKLELSVNRDQCLSDEIAGGVELIVPNGRMKVVNTLESRLKLLSQQLIPEIREVLFGKNENRVFYD 226          
The following BLAST results are available for this feature:
BLAST of V-type proton ATPase subunit E vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP6V1E11.254e-4448.23ATPase H+ transporting V1 subunit E1 [Source:HGNC ... [more]
ATP6V1E11.472e-3945.65ATPase H+ transporting V1 subunit E1 [Source:HGNC ... [more]
ATP6V1E22.380e-3945.54ATPase H+ transporting V1 subunit E2 [Source:HGNC ... [more]
ATP6V1E22.380e-3945.54ATPase H+ transporting V1 subunit E2 [Source:HGNC ... [more]
ATP6V1E13.780e-3943.81ATPase H+ transporting V1 subunit E1 [Source:HGNC ... [more]
back to top
BLAST of V-type proton ATPase subunit E vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vha-83.711e-4947.77Vacuolar H ATPase [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
back to top
BLAST of V-type proton ATPase subunit E vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Vha268.984e-5146.02gene:FBgn0283535 transcript:FBtr0346137[more]
Vha268.984e-5146.02gene:FBgn0283535 transcript:FBtr0078701[more]
Vha268.984e-5146.02gene:FBgn0283535 transcript:FBtr0078700[more]
back to top
BLAST of V-type proton ATPase subunit E vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
atp6v1e1a2.080e-4547.79ATPase H+ transporting V1 subunit E1a [Source:ZFIN... [more]
atp6v1e1b3.839e-4546.90ATPase H+ transporting V1 subunit E1b [Source:ZFIN... [more]
back to top
BLAST of V-type proton ATPase subunit E vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
nfe2l36.250e-5352.21nuclear factor, erythroid 2 like 3 [Source:Xenbase... [more]
nfe2l33.552e-5053.24nuclear factor, erythroid 2 like 3 [Source:Xenbase... [more]
nfe2l31.606e-4953.02nuclear factor, erythroid 2 like 3 [Source:Xenbase... [more]
nfe2l31.611e-4953.02nuclear factor, erythroid 2 like 3 [Source:Xenbase... [more]
back to top
BLAST of V-type proton ATPase subunit E vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp6v1e19.585e-4548.23ATPase, H+ transporting, lysosomal V1 subunit E1 [... [more]
Atp6v1e22.471e-3844.20ATPase, H+ transporting, lysosomal V1 subunit E2 [... [more]
Atp6v1e22.471e-3844.20ATPase, H+ transporting, lysosomal V1 subunit E2 [... [more]
Atp6v1e22.471e-3844.20ATPase, H+ transporting, lysosomal V1 subunit E2 [... [more]
Atp6v1e14.852e-1353.92ATPase, H+ transporting, lysosomal V1 subunit E1 [... [more]
back to top
BLAST of V-type proton ATPase subunit E vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P54611|VATE_DROME9.005e-5046.02V-type proton ATPase subunit E OS=Drosophila melan... [more]
sp|Q9U1G5|VATE_HETSC4.364e-4548.21V-type proton ATPase subunit E OS=Heterodera schac... [more]
sp|P11019|VATE1_BOVIN1.425e-4448.67V-type proton ATPase subunit E 1 OS=Bos taurus OX=... [more]
sp|Q4R761|VATE1_MACFA6.021e-4448.23V-type proton ATPase subunit E 1 OS=Macaca fascicu... [more]
sp|P36543|VATE1_HUMAN6.021e-4448.23V-type proton ATPase subunit E 1 OS=Homo sapiens O... [more]
back to top
BLAST of V-type proton ATPase subunit E vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1A9YKK44.588e-5749.56Uncharacterized protein OS=Glossina fuscipes fusci... [more]
A0A1B0C4F94.588e-5749.56Uncharacterized protein OS=Glossina palpalis gambi... [more]
A0A1A9WSC93.230e-5650.44Uncharacterized protein OS=Glossina brevipalpis OX... [more]
A0A1A9UZW85.674e-5648.23Uncharacterized protein OS=Glossina austeni OX=739... [more]
A0A1A9ZHJ11.148e-5549.12Uncharacterized protein OS=Glossina pallidipes OX=... [more]
back to top
BLAST of V-type proton ATPase subunit E vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
atp6v1e1a2.113e-4748.23V-type proton ATPase subunit E 1-like [Source:NCBI... [more]
atp6v1e1b5.738e-4446.02V-type proton ATPase subunit E 1-like [Source:NCBI... [more]
atp6v1e1a4.557e-4143.81V-type proton ATPase subunit E 1-like [Source:NCBI... [more]
back to top
BLAST of V-type proton ATPase subunit E vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000009927.12.835e-4042.48pep scaffold:Pmarinus_7.0:GL481399:6453:19951:1 ge... [more]
ENSPMAT00000002075.12.896e-2141.84pep scaffold:Pmarinus_7.0:GL478102:45668:49015:-1 ... [more]
ENSPMAT00000003615.12.231e-1240.71pep scaffold:Pmarinus_7.0:GL479041:4766:11691:-1 g... [more]
back to top
BLAST of V-type proton ATPase subunit E vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
VMA49.493e-1932.47Subunit E of the V1 domain of the vacuolar H+-ATPa... [more]
back to top
BLAST of V-type proton ATPase subunit E vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO391971.280e-4746.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of V-type proton ATPase subunit E vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
atp6v1e1b1.321e-4748.23V-type proton ATPase subunit E 1 [Source:NCBI gene... [more]
atp6v1e1a2.578e-4246.46V-type proton ATPase subunit E 1 [Source:NCBI gene... [more]
atp6v1e1a3.858e-2943.61V-type proton ATPase subunit E 1 [Source:NCBI gene... [more]
back to top
BLAST of V-type proton ATPase subunit E vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000064093.12.459e-13399.56SMESG000064093.1[more]
SMESG000000425.13.623e-4846.46SMESG000000425.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017042 ID=SMED30017042|Name=V-type proton ATPase subunit E|organism=Schmidtea mediterranea sexual|type=transcript|length=829bp
AACAAATTAACCTAATTTTTAAAATTTATCATTAGGAATAAGAAATTAAA
TATTTTCTATGACAATCGTAGTTAATGAAAATGAAGTTCAAAAGCAGATT
GAAAACATGACTGCTCTTATAGATTTGGAAGCAAATGAAAAAGTAGAAGA
AATTGAAGCCAAAACAGAGGAAGAATTTCAAATAGAAAAAAATAAAATTG
TTCAAGAACAACGTACTAAAATTGAAGAATATTACAAAAAGAAAGAAAAT
CAAATAAAATTAGCAAAACACATTCAAAATTCTAATTTGATGAATAATGC
CAAATTGAAGATTTTATCAAAAAAGCAAGAACATATTAAAAAATTATTGG
AAGCGTCAAAATATAAGCTAGGTTTAATAAGTAAAGATGAAGGAATTTAT
AAAGAAACTTTAAAACAATTAATAAGTCAAAGTTTGCTTCAATTGTTAGA
AAAAGATGTCCTCATACGTTGCCATGCCAAAGATGTTGACATTATTAATC
AAATTTTACCCGAGGTTCTCGCAAACTATCAAAAAACTACCAAAAGAACC
GTCAATGTTGTAATTGATCGCGAAAATCATTTAAATAATATAATGGGAGG
AGTGGAAGTGTCGACAATCAATGGGAAAATTCGAGTTGTGAATACGTTGG
ATAGTCGGCTAGATTTGATGAGCAGCCAGATGATTCCTGAATTGCGGGAA
ATATTATTTGGATTCAATACTAACCGGAAATTCGCTGATTAAGACTGATC
TAGAATTTTACTTTGAAATATGAAAAAAATGCATAATATTTGTAATCGTT
AAAATAAAATTTTCGAATTGAAAAAAAAA
back to top

protein sequence of SMED30017042-orf-1

>SMED30017042-orf-1 ID=SMED30017042-orf-1|Name=SMED30017042-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=228bp
MTIVVNENEVQKQIENMTALIDLEANEKVEEIEAKTEEEFQIEKNKIVQE
QRTKIEEYYKKKENQIKLAKHIQNSNLMNNAKLKILSKKQEHIKKLLEAS
KYKLGLISKDEGIYKETLKQLISQSLLQLLEKDVLIRCHAKDVDIINQIL
PEVLANYQKTTKRTVNVVIDRENHLNNIMGGVEVSTINGKIRVVNTLDSR
LDLMSSQMIPELREILFGFNTNRKFAD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:1902600hydrogen ion transmembrane transport
GO:0015991ATP hydrolysis coupled proton transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038495ATPase_E_C
IPR002842ATPase_V1_Esu
Vocabulary: cellular component
TermDefinition
GO:0033178proton-transporting two-sector ATPase complex, catalytic domain
Vocabulary: molecular function
TermDefinition
GO:0046961proton-transporting ATPase activity, rotational mechanism
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002842V-type ATPase subunit EPFAMPF01991vATP-synt_Ecoord: 21..217
e-value: 1.5E-56
score: 191.0
IPR038495V-type ATPase subunit E, C-terminal domain superfamilyGENE3DG3DSA:3.30.2320.30coord: 95..227
e-value: 1.5E-39
score: 136.6
NoneNo IPR availablePANTHERPTHR45715FAMILY NOT NAMEDcoord: 5..227
NoneNo IPR availablePANTHERPTHR45715:SF6coord: 5..227
NoneNo IPR availableSUPERFAMILYSSF160527V-type ATPase subunit E-likecoord: 91..218