Proton myo-inositol cotransporter

Overview
NameProton myo-inositol cotransporter
Smed IDSMED30017038
Length (bp)1477
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Proton myo-inositol cotransporter (SMED30017038) t-SNE clustered cells

Violin plots show distribution of expression levels for Proton myo-inositol cotransporter (SMED30017038) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Proton myo-inositol cotransporter (SMED30017038) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Proton myo-inositol cotransporter (SMED30017038) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017038

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30017038SMESG000056331.1 SMESG000056325.1 Contig482uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017038SMESG000056331.1 SMESG000056325.1 Contig482newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017038SMESG000056325.1 Contig1055GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017038SMESG000006139.1 Contig482uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30017038SMESG000006139.1 Contig482newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pigment cellSMED30017038SMESG000056326.1 SMESG000056325.1 SmedASXL_017015SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30017038SMESG000056326.1 SMESG000056325.1 dd_Smed_v4_4836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017038SMESG000056326.1 SMESG000056325.1 dd_Smed_v4_4836_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30017038SMESG000056325.1 Contig1055GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Proton myo-inositol cotransporter vs. Ensembl Human
Match: SLC2A13 (solute carrier family 2 member 13 [Source:HGNC Symbol;Acc:HGNC:15956])

HSP 1 Score: 137.502 bits (345), Expect = 4.469e-34
Identity = 84/286 (29.37%), Postives = 145/286 (50.70%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQL---VDVRYLKR-----NQNNICDNFLACDDWVSYHCEYCQIDENSGY 1042
            I+S   P+YIAE++P  +RGR++TI  + +T G F ASVV+   +Y             +L   AVPA+    G L +PES RWL+ K +  +A  ++ +++        + ++   ++     E+ +++      ++CR+L     R+ L++GC LQM  QL GIN +MYY+ ++ Q     + ++ +W   +  F N I + V   L++K+GRRKL   SL G   +L+I+A+   L   V  R   +      QN  C  +  C++        C +D + G+
Sbjct:  187 IASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQK-----DGWRYMLGLAAVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRG------NQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNATCTRYSYCNE--------CMLDPDCGF 453          

HSP 2 Score: 92.0485 bits (227), Expect = 4.122e-19
Identity = 50/111 (45.05%), Postives = 64/111 (57.66%), Query Frame = 3
Query: 1086 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYET----FWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            Y FC P+  +  W  LLG+ILY++ FA GMGP+PW V SEIYP W RST  A S+  NW FN  V++T      Y T    F++Y+ F   G+  IY   PE     +EEI
Sbjct:  498 YNFC-PTPYS--WTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEI 605          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Human
Match: SLC2A13 (solute carrier family 2 member 13 [Source:HGNC Symbol;Acc:HGNC:15956])

HSP 1 Score: 92.8189 bits (229), Expect = 6.200e-20
Identity = 56/171 (32.75%), Postives = 93/171 (54.39%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMY 721
            I+S   P+YIAE++P  +RGR++TI  + +T G F ASVV+   +Y             +L   AVPA+    G L +PES RWL+ K +  +A  ++ +++     N T  ++   ++     E+ +++      ++CR+L     R+ L++GC LQM  QL GIN +MY
Sbjct:  187 IASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDG-----WRYMLGLAAVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMR----GNQT--IDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMY 346          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Human
Match: SLC2A1 (solute carrier family 2 member 1 [Source:HGNC Symbol;Acc:HGNC:11005])

HSP 1 Score: 73.1738 bits (178), Expect = 3.483e-13
Identity = 59/242 (24.38%), Postives = 123/242 (50.83%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLL-SKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVD 931
            +++   P+Y+ E++P  +RG + T++Q+ +  G+ +A V     +     D  P  + II I    PAL   I +   PES R+LL ++N  + A  V++KL+    +++T  ++ + E +  +  + +         +  +      R+ +++   LQ+  QL GIN + YY+ S+F+K     ++  ++ T     +N   + V+  ++++ GRR L LI L G+    +++ + L L++
Sbjct:  135 LTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLD-SIMGNKDLWPLLLSIIFI----PALLQCIVLPFCPESPRFLLINRNEENRAKSVLKKLRGT--ADVTHDLQEMKEESRQMMREKKVT-------ILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK---AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAILMTIALALLE 359          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Human
Match: SLC2A2 (solute carrier family 2 member 2 [Source:HGNC Symbol;Acc:HGNC:11006])

HSP 1 Score: 70.0922 bits (170), Expect = 3.851e-12
Identity = 62/247 (25.10%), Postives = 118/247 (47.77%), Query Frame = 2
Query:  215 STCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATL---NYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIP-----ESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVD 931
            S   P+YI EI P  +RG + T +Q+ +  G+ ++ ++       NY            I+L    V A+   + +   PES R+L  K  +DE ++  + LK++        +I E  +   EA+            ++K  + ++  +   R+ +++   L +  Q  GING+ YY+ S+FQ   T  I   ++ T  +  +N++ + V+  L++K GRR L LI + G+    + ++V L L++
Sbjct:  169 SGLVPMYIGEIAPTALRGALGTFHQLAIVTGILISQIIGLEFILGNY--------DLWHILLGLSGVRAILQSLLLFFCPESPRYLYIK--LDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEAS-----------SEQKVSIIQLFTNSSYRQPILVALMLHVAQQFSGINGIFYYSTSIFQ---TAGISKPVYATIGVGAVNMVFTAVSVFLVEKAGRRSLFLIGMSGMFVCAIFMSVGLVLLN 391          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Human
Match: SLC2A12 (solute carrier family 2 member 12 [Source:HGNC Symbol;Acc:HGNC:18067])

HSP 1 Score: 69.3218 bits (168), Expect = 6.906e-12
Identity = 34/101 (33.66%), Postives = 59/101 (58.42%), Query Frame = 3
Query: 1116 INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFP----IGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            + W+ L  +++YV +F+IG+GP+PW+V SEI+P   R   MAL+++ NW  N  +++T       IGL    +IY+  +L  +  +    PE    ++E+I
Sbjct:  460 LKWLSLASLLVYVAAFSIGLGPMPWLVLSEIFPGGIRGRAMALTSSMNWGINLLISLTFLTVTDLIGLPWVCFIYTIMSLASLLFVVMFIPETKGCSLEQI 560          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Celegans
Match: hmit-1.3 (H(+) MyoInositol coTransporter [Source:UniProtKB/TrEMBL;Acc:Q21455])

HSP 1 Score: 127.102 bits (318), Expect = 3.823e-31
Identity = 82/286 (28.67%), Postives = 146/286 (51.05%), Query Frame = 2
Query:  212 SSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVE---NILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKR-NQNNICDNF-----LACDDWVSYHCEYCQIDENSGY 1042
            +S   P+Y++E +P  IRG+++T +Q+ +T GL +A+++    +Y  P     + M       AVPA+   +  L +PES RWL    R  EA EV+ ++     +  TE+V+   N +  +   E   + +       + RIL     RK +++G  LQM  QL GIN +MYY  ++ +     +    +W +   + IN + +F+   L++++GRR L L+S+ G+I  L+ + V+  L++   L+  +Q N   N+      A       +C++C  DEN G+
Sbjct:  138 ASMIVPIYVSEASPSHIRGKLVTGFQLMITVGLVIANIIGGAFSYVDPDQVGWRLM---FAFAAVPAIIQFVCFLFLPESPRWLYEHGRTVEAREVLTRIY----NGHTEWVDYEINEISFSYEEELRAKAEHAGNGPTIIRILKTPHVRKAMIIGSLLQMFQQLSGINTVMYYTGNIIRSAGVKDNHTTIWISVGTSAINFLGTFIPIALVERVGRRVLLLVSMIGVILFLIAMGVSFLLINNDSLRTFDQQNYTLNYNPSVKHAAKCLKYSNCDFCVTDENCGF 416          

HSP 2 Score: 71.2478 bits (173), Expect = 7.066e-13
Identity = 33/93 (35.48%), Postives = 55/93 (59.14%), Query Frame = 3
Query: 1140 MILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGL----YETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            M+ Y++SF+ G  P+PWV+ +E YP W RST +++ST  NW FN  V++T   +      Y TF+IY   T+  +  ++   PE    +++E+
Sbjct:  475 MVFYLLSFSAGYAPLPWVLNAEFYPLWARSTAVSVSTACNWIFNLIVSLTFLSLSQAATKYGTFFIYCGCTMVALVFVFFFVPETKGYSIDEV 567          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Celegans
Match: hmit-1.3 (H(+) MyoInositol coTransporter [Source:UniProtKB/TrEMBL;Acc:Q21455])

HSP 1 Score: 127.102 bits (318), Expect = 3.823e-31
Identity = 82/286 (28.67%), Postives = 146/286 (51.05%), Query Frame = 2
Query:  212 SSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVE---NILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKR-NQNNICDNF-----LACDDWVSYHCEYCQIDENSGY 1042
            +S   P+Y++E +P  IRG+++T +Q+ +T GL +A+++    +Y  P     + M       AVPA+   +  L +PES RWL    R  EA EV+ ++     +  TE+V+   N +  +   E   + +       + RIL     RK +++G  LQM  QL GIN +MYY  ++ +     +    +W +   + IN + +F+   L++++GRR L L+S+ G+I  L+ + V+  L++   L+  +Q N   N+      A       +C++C  DEN G+
Sbjct:  138 ASMIVPIYVSEASPSHIRGKLVTGFQLMITVGLVIANIIGGAFSYVDPDQVGWRLM---FAFAAVPAIIQFVCFLFLPESPRWLYEHGRTVEAREVLTRIY----NGHTEWVDYEINEISFSYEEELRAKAEHAGNGPTIIRILKTPHVRKAMIIGSLLQMFQQLSGINTVMYYTGNIIRSAGVKDNHTTIWISVGTSAINFLGTFIPIALVERVGRRVLLLVSMIGVILFLIAMGVSFLLINNDSLRTFDQQNYTLNYNPSVKHAAKCLKYSNCDFCVTDENCGF 416          

HSP 2 Score: 71.2478 bits (173), Expect = 7.066e-13
Identity = 33/93 (35.48%), Postives = 55/93 (59.14%), Query Frame = 3
Query: 1140 MILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGL----YETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            M+ Y++SF+ G  P+PWV+ +E YP W RST +++ST  NW FN  V++T   +      Y TF+IY   T+  +  ++   PE    +++E+
Sbjct:  475 MVFYLLSFSAGYAPLPWVLNAEFYPLWARSTAVSVSTACNWIFNLIVSLTFLSLSQAATKYGTFFIYCGCTMVALVFVFFFVPETKGYSIDEV 567          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Celegans
Match: hmit-1.2 (H(+) MyoInositol coTransporter [Source:UniProtKB/TrEMBL;Acc:Q9XXQ9])

HSP 1 Score: 108.997 bits (271), Expect = 5.111e-25
Identity = 78/299 (26.09%), Postives = 135/299 (45.15%), Query Frame = 2
Query:  212 SSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENIL---EANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVD---------------VRYLKRNQNNICDNFLACDDWV-SYHCEYCQIDENSGYTCV 1051
            +S   P+Y+ E +P  +RG +++ + + ++FG  +A+++    +Y  P     + M        +PAL   +  + +PE+ RWL      ++A +V+ K+        TE++E  L   +      +   E++++   ++ RIL      K   +G  LQ   QL GIN ++YY   + +     N    +W + +L+  NLI  F     I+K+GRRKL L S  G++ SLV+I V+  LV                  Y    +   C     CD  V S HC +C+  E     C+
Sbjct:  136 ASMVVPVYLGEASPTHVRGTLVSAFAMMISFGQVVANIMGGVFSYWEPYTIGWRLM---FAFAGIPALIQFVCFIFLPETPRWLYENGHTEQAEQVLEKIY----GGNTEWIEYELAEIKTYAEERQKQMEEEKKSGPVIWRILKTPHVLKACFIGSMLQAFQQLAGINTILYYTADIIRSAGIENYHTIIWISVILSICNLIGPFAPMFFIEKLGRRKLFLFSCAGVVVSLVLIGVSFLLVGNDSAPNFDRSAYLLAGNYQSNGEAESCLMLSNCDSCVTSEHCGFCEDSETRTGFCL 427          

HSP 2 Score: 58.9214 bits (141), Expect = 5.315e-9
Identity = 34/93 (36.56%), Postives = 54/93 (58.06%), Query Frame = 3
Query: 1140 MILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMT----VFPIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            M +Y+++F+ G   +PWV+ SE YP W RST +++ST +NW FN  + +T       I  Y  FW+Y+ FT+     IY   PE    +++E+
Sbjct:  479 MGVYLLTFSCGFTSLPWVLNSEFYPMWARSTCVSISTLSNWVFNLIIALTYLSLTHAITKYGAFWLYAIFTIIAFIFIYFLVPETTGYSIDEV 571          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Celegans
Match: hmit-1.1 (H(+) MyoInositol coTransporter [Source:UniProtKB/TrEMBL;Acc:Q9XXR3])

HSP 1 Score: 102.064 bits (253), Expect = 9.340e-23
Identity = 78/290 (26.90%), Postives = 133/290 (45.86%), Query Frame = 2
Query:  212 SSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKL----KQIPESNITE---FVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVD---VRYLKRNQ--NNICDNFLACDDWVSY-HCEYCQIDENSGY 1042
            +S   P+Y+ E  P  +RG ++  + + ++FG  +A++     +Y  P +   + M       AVP++   +  + +PE+ RWL       E  EV+ K+    K+  E  + E   F E+  + N        E+      ++ RIL      K   +G  LQ   QL GIN ++YY   + +    +N    +W + LL+  N I  FV   LI+K+GRR + L S   ++ SLV I V   LV+      L  NQ  +N   ++      ++Y +C+YC   +  G+
Sbjct:  135 ASMIVPVYLGETAPTHVRGMLVAAFALMISFGQVVANITGGAFSYIDPYNVGWRLM---FAFAAVPSIIQFVCFMFLPETPRWLYENGFETETREVLEKVYNGDKEWVEYEMAEIIAFNEDQAKEN--------EKAHASGPVIWRILKTPHVLKACFIGSMLQAFQQLAGINTILYYTADIIRSSGISNNHTTIWISVLLSLCNFIGPFVPMSLIEKVGRRIIFLFSCGLVVLSLVFIGVAFLLVNHDSAATLPANQYGSNFNSSYPDAKGCMAYSNCDYCVTTDACGF 413          

HSP 2 Score: 71.633 bits (174), Expect = 5.031e-13
Identity = 35/91 (38.46%), Postives = 53/91 (58.24%), Query Frame = 3
Query: 1146 LYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFP----IGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            +Y+++F+ G   +PWV+ SE YP W RST +A+STT+NW FN  + +T       IG Y  FW+Y+  T+     I    PE    ++EE+
Sbjct:  473 VYLLTFSSGFTSLPWVLNSEFYPMWARSTCVAISTTSNWVFNLIIALTYLSLTQVIGKYGAFWLYAGLTVIAFIFILFLVPETKGYSIEEV 563          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Celegans
Match: fgt-1 (Facilitated glucose transporter protein 1 [Source:UniProtKB/Swiss-Prot;Acc:O44827])

HSP 1 Score: 59.3066 bits (142), Expect = 3.727e-9
Identity = 68/275 (24.73%), Postives = 121/275 (44.00%), Query Frame = 2
Query:  212 SSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLS-KNRIDEAIEVVRKLKQIPE--SNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTL-VMGCSLQML--AQLIGINGLMYYANSLFQKY-VTNNIKIYLWFTPLLTFINLISSFVAYKLID--KIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSYHC 1009
            SS   P+++ EI+P  +RG + +++Q+ +T  + L S +    +     DR     P+I     VPA+  L  ++  PES ++ ++ + + +EA   ++KL+   +  + I    E    A V  +                 +GD      L  M  ++ M+   QL GIN  M+Y+  +F+   +T N   Y   T  +  +N+I + ++  L+D  K GRR L L  L G+  S +++   L +         QN+        D W SY  
Sbjct:  152 SSALVPMFLTEISPNNLRGMLGSLHQLLVTIAI-LVSQIFGLPHLLGTGDR----WPLIFAFTVVPAVLQLALLMLCPESPKYTMAVRGQRNEAESALKKLRDTEDVSTEIEAMQEEATAAGVQEKPK---------------MGDMFKGALLWPMSIAIMMMLAQQLSGINVAMFYSTVIFRGAGLTGNEPFYA--TIGMGAVNVIMTLISVWLVDHPKFGRRSLLLAGLTGMFVSTLLLVGALTI---------QNS------GGDKWASYSA 389          

HSP 2 Score: 52.373 bits (124), Expect = 5.519e-7
Identity = 31/92 (33.70%), Postives = 48/92 (52.17%), Query Frame = 3
Query: 1140 MILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIG---LYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            ++L+VISFA G G IPW   SEI+ +  R    +++   NW  N  V +T  PI       +F+I+S F    I   ++  PE    ++E+I
Sbjct:  393 VLLFVISFATGPGAIPWFFVSEIFDSSARGNANSIAVMVNWAANLLVGLTFLPINNLMQQYSFFIFSGFLAFFIFYTWKFVPETKGKSIEQI 484          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Fly
Match: CG6484 (gene:FBgn0034247 transcript:FBtr0086903)

HSP 1 Score: 66.2402 bits (160), Expect = 5.134e-20
Identity = 70/252 (27.78%), Postives = 122/252 (48.41%), Query Frame = 2
Query:  224 CPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRY-LKRNQNNICDNF 976
             P+Y  EIT   +RG I + +Q+ +  G+    +V A L            + I ++   +P +F +I    +PES  +L  K R D+A + ++ L+   +++I + ++ ILE +       Q+Q +  +  +   L   I  K L +   LQ+  Q  GIN +++Y+ S+F+   ++        T ++    + S+ VA  +IDK GRR L LI       S V++AV+  L+ V + LK N     DNF
Sbjct:  124 APMYCTEITATALRGTIGSFFQLLIVSGVLYGYLVGAFL----------PLLTINILCAILPVIFAIIHFF-MPESPVYLAMKGRNDDAAKALQWLRG-KDADIDDELKEILEES-------QKQIDMPQVNILSSLRRPIVLKGLGIAVLLQVFQQWTGINAVLFYSASIFEDTGSDISGSDA--TLIIGVTQVTSTLVAVAIIDKAGRRILLLI-------SGVLMAVSTALMGVYFQLKENDPASMDNF 347          

HSP 2 Score: 50.8322 bits (120), Expect = 5.134e-20
Identity = 38/115 (33.04%), Postives = 66/115 (57.39%), Query Frame = 3
Query: 1098 NPSTI-NINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFP-----IGLYETFWIYSAFTLCGIALIYRNF--PEMNQANMEEILHVL 1418
            +P+++ N  W+ +  + +++I F+IG GP+PW+V +E++    +S   +++ T+NW   F VT+ +FP     IG   TFWI++A  +  IA  Y  F  PE     + EI  +L
Sbjct:  340 DPASMDNFGWLPISSICIFIIFFSIGFGPVPWLVMAELFSEDVKSVAGSIAGTSNWLSAFVVTL-LFPILKSSIGPGPTFWIFTAIAV--IAFFYSLFFVPETKGKTIIEIQDLL 451          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Fly
Match: Glut1 (gene:FBgn0264574 transcript:FBtr0333504)

HSP 1 Score: 75.485 bits (184), Expect = 4.433e-14
Identity = 69/234 (29.49%), Postives = 114/234 (48.72%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLL-SKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGI-IFSLVI 904
            ++++  P+YI+EI P  +RG + T+ Q+ +T GL L+ V+            + +  PI+L     PA+  LI +   PES R+LL +K   +EA + +R+L+    S   E  E+I E          E       ++C        R  L++G  +Q+  Q  GIN + YY+ SLF        +   + T  +  I ++ + V+  L+D+ GRR L L  L G+ IFS+ I
Sbjct:  372 LNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILG-----TNEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRA---SGSVE--EDIEEMRAEERAQQSESHISTMELIC----SPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTE-ESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYGLGGMFIFSIFI 590          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Fly
Match: Glut1 (gene:FBgn0264574 transcript:FBtr0333508)

HSP 1 Score: 75.485 bits (184), Expect = 5.097e-14
Identity = 69/234 (29.49%), Postives = 114/234 (48.72%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLL-SKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGI-IFSLVI 904
            ++++  P+YI+EI P  +RG + T+ Q+ +T GL L+ V+            + +  PI+L     PA+  LI +   PES R+LL +K   +EA + +R+L+    S   E  E+I E          E       ++C        R  L++G  +Q+  Q  GIN + YY+ SLF        +   + T  +  I ++ + V+  L+D+ GRR L L  L G+ IFS+ I
Sbjct:  372 LNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILG-----TNEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRA---SGSVE--EDIEEMRAEERAQQSESHISTMELIC----SPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTE-ESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYGLGGMFIFSIFI 590          

HSP 2 Score: 51.2174 bits (121), Expect = 2.078e-6
Identity = 33/114 (28.95%), Postives = 54/114 (47.37%), Query Frame = 3
Query: 1116 INWILLLGMIL---YVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTM------------TVFPIGLY-ETFWIYSAFTLCGIALIYRNFPEMNQANMEEIL 1409
            I+W+  L ++    +V+ FA+G G IPW++T+E++    R + MA++   NW  NF V +            T  P  ++   FWI++          Y+  PE      EEIL
Sbjct:  600 IDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFT----------YKKVPETKNKTFEEIL 703          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Fly
Match: Glut1 (gene:FBgn0264574 transcript:FBtr0333509)

HSP 1 Score: 75.0998 bits (183), Expect = 5.637e-14
Identity = 69/234 (29.49%), Postives = 114/234 (48.72%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLL-SKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGI-IFSLVI 904
            ++++  P+YI+EI P  +RG + T+ Q+ +T GL L+ V+            + +  PI+L     PA+  LI +   PES R+LL +K   +EA + +R+L+    S   E  E+I E          E       ++C        R  L++G  +Q+  Q  GIN + YY+ SLF        +   + T  +  I ++ + V+  L+D+ GRR L L  L G+ IFS+ I
Sbjct:  372 LNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILG-----TNEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRA---SGSVE--EDIEEMRAEERAQQSESHISTMELIC----SPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTE-ESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYGLGGMFIFSIFI 590          

HSP 2 Score: 50.8322 bits (120), Expect = 2.365e-6
Identity = 33/114 (28.95%), Postives = 54/114 (47.37%), Query Frame = 3
Query: 1116 INWILLLGMIL---YVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTM------------TVFPIGLY-ETFWIYSAFTLCGIALIYRNFPEMNQANMEEIL 1409
            I+W+  L ++    +V+ FA+G G IPW++T+E++    R + MA++   NW  NF V +            T  P  ++   FWI++          Y+  PE      EEIL
Sbjct:  600 IDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFT----------YKKVPETKNKTFEEIL 703          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Fly
Match: Glut1 (gene:FBgn0264574 transcript:FBtr0333507)

HSP 1 Score: 75.0998 bits (183), Expect = 5.832e-14
Identity = 69/234 (29.49%), Postives = 114/234 (48.72%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLL-SKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGI-IFSLVI 904
            ++++  P+YI+EI P  +RG + T+ Q+ +T GL L+ V+            + +  PI+L     PA+  LI +   PES R+LL +K   +EA + +R+L+    S   E  E+I E          E       ++C        R  L++G  +Q+  Q  GIN + YY+ SLF        +   + T  +  I ++ + V+  L+D+ GRR L L  L G+ IFS+ I
Sbjct:  372 LNTSLVPMYISEIAPLNLRGGLGTVNQLAVTVGLLLSQVLGIEQILG-----TNEGWPILLGLAICPAILQLILLPVCPESPRYLLITKQWEEEARKALRRLRA---SGSVE--EDIEEMRAEERAQQSESHISTMELIC----SPTLRPPLIIGIVMQLSQQFSGINAVFYYSTSLFMSSGLTE-ESAKFATIGIGAIMVVMTLVSIPLMDRTGRRTLHLYGLGGMFIFSIFI 590          

HSP 2 Score: 51.2174 bits (121), Expect = 1.948e-6
Identity = 33/114 (28.95%), Postives = 54/114 (47.37%), Query Frame = 3
Query: 1116 INWILLLGMIL---YVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTM------------TVFPIGLY-ETFWIYSAFTLCGIALIYRNFPEMNQANMEEIL 1409
            I+W+  L ++    +V+ FA+G G IPW++T+E++    R + MA++   NW  NF V +            T  P  ++   FWI++          Y+  PE      EEIL
Sbjct:  600 IDWMSYLSVVATLGFVVFFAVGPGSIPWMITAELFSQGPRPSAMAIAVLVNWMANFVVGIGFPSMKTALENYTFLPFSVFLAIFWIFT----------YKKVPETKNKTFEEIL 703          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Zebrafish
Match: slc2a13b (solute carrier family 2 member 13b [Source:ZFIN;Acc:ZDB-GENE-090812-1])

HSP 1 Score: 139.813 bits (351), Expect = 3.255e-35
Identity = 90/294 (30.61%), Postives = 149/294 (50.68%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV-----DVRYLKRN---QNNICDNFLACDDWVSYHCEYCQIDENSGYTCVNYGAN 1066
            I+S   P+YIAE++P  +RG+++T+  + +T G F+ASVV+   +Y  P D        +L    VPA    +G L +PES RWLL K     A+ V+R+++   + ++ E  E+I           +++      +L R+L    AR+ L++GC LQM  QL GIN +MYY+ ++ Q     + ++ +W      F N + + V   L++++GRR+L + SL G   SL+++A    L       V +   N    N+ C N+          CE C +D + G+    YG N
Sbjct:  141 IASMTVPVYIAEVSPPDLRGQLVTVNTLFITGGQFIASVVDGAFSYL-PHD----GWRFMLGLSVVPAALQFLGFLFLPESPRWLLQKGFTQNALLVLRQIRG--DVDVEEEFESIR-----CSIQEEQRDVAGGPVLWRMLASPPARRALIVGCGLQMFQQLAGINTVMYYSATILQMSGVQDDQMAIWLAAGTAFTNFLFTLVGVWLVERVGRRRLTMASLLGTAVSLMVLAAGFLLSAQASPPVTFHPSNPSIHNSTCGNY--------GFCESCMLDPDCGFC---YGLN 411          

HSP 2 Score: 87.0409 bits (214), Expect = 1.098e-17
Identity = 44/100 (44.00%), Postives = 58/100 (58.00%), Query Frame = 3
Query: 1119 NWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYET----FWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            +W++LLG+ILY+  FA GMGP+PW V SEIYP W RST  A S   NW  N  V++T   +  Y T    F++Y+A  L G   +    PE     +EEI
Sbjct:  458 SWVVLLGLILYLAFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGVNWICNVLVSLTFLHVAQYLTYYGAFFLYAALALLGFVFVSGCLPETKGLRLEEI 557          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Zebrafish
Match: slc2a3b (solute carrier family 2 member 3b [Source:ZFIN;Acc:ZDB-GENE-121031-5])

HSP 1 Score: 72.7886 bits (177), Expect = 6.757e-21
Identity = 64/264 (24.24%), Postives = 129/264 (48.86%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVN--ATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLL-SKNRIDEAIEVVRKLKQIP--ESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLK----RNQNNICDN 973
            +S+   P+Y+ EI P  +RG   T++Q+ +  G+ +A ++   + L   +          +  +  ++  +F L       ES R+LL S N+ DEA + +  L+     E +I E  +  ++ ++           +K+  +  +  +   R+ +++   LQ+  QL GIN +MYY+  +F+      I   ++ T  +  +N + + V+  L+++ GRR L LI L G+ F ++++ ++L+LVD    K    +N   I D+
Sbjct:  139 LSTGLTPMYVGEIAPTALRGAFGTLHQLGVVIGILVAQILGLESLLGSQTLWPLLLALTALPAVIQSIMLIFCL-------ESPRYLLISLNKEDEARQALTSLRGHSDVEDDIREMKDEAMKMSM-----------EKRVSIPELFRNPAYRQPIIIAIILQLSQQLSGINAVMYYSTEIFRNA---GITEPVFATIGMGVVNTVFTVVSLFLVERAGRRTLHLIGLTGMTFCVLLVTISLKLVDSEIEKAKLLQNGTAIIDS 381          

HSP 2 Score: 47.7506 bits (112), Expect = 6.757e-21
Identity = 37/120 (30.83%), Postives = 58/120 (48.33%), Query Frame = 3
Query: 1068 NGTCSIYEFCNPST--ININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFP-----IGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            NGT +I +  +PS     +  + +L +  +V SF +G GPIPW + +E++    R   MA++   NW  +F V + +FP     IG Y  F I+    +  I   Y   PE      E+I
Sbjct:  374 NGT-AIIDSASPSEGISTVKVLAILAVFGFVASFEMGPGPIPWFIVAELFAQGPRPAAMAVAGCCNWTASFLVGL-LFPILSKKIGAY-VFIIFLILLVVFIVFTYFRVPETKGRTFEDI 490          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Zebrafish
Match: slc2a3b (solute carrier family 2 member 3b [Source:ZFIN;Acc:ZDB-GENE-121031-5])

HSP 1 Score: 72.7886 bits (177), Expect = 6.757e-21
Identity = 64/264 (24.24%), Postives = 129/264 (48.86%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVN--ATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLL-SKNRIDEAIEVVRKLKQIP--ESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLK----RNQNNICDN 973
            +S+   P+Y+ EI P  +RG   T++Q+ +  G+ +A ++   + L   +          +  +  ++  +F L       ES R+LL S N+ DEA + +  L+     E +I E  +  ++ ++           +K+  +  +  +   R+ +++   LQ+  QL GIN +MYY+  +F+      I   ++ T  +  +N + + V+  L+++ GRR L LI L G+ F ++++ ++L+LVD    K    +N   I D+
Sbjct:  139 LSTGLTPMYVGEIAPTALRGAFGTLHQLGVVIGILVAQILGLESLLGSQTLWPLLLALTALPAVIQSIMLIFCL-------ESPRYLLISLNKEDEARQALTSLRGHSDVEDDIREMKDEAMKMSM-----------EKRVSIPELFRNPAYRQPIIIAIILQLSQQLSGINAVMYYSTEIFRNA---GITEPVFATIGMGVVNTVFTVVSLFLVERAGRRTLHLIGLTGMTFCVLLVTISLKLVDSEIEKAKLLQNGTAIIDS 381          

HSP 2 Score: 47.7506 bits (112), Expect = 6.757e-21
Identity = 37/120 (30.83%), Postives = 58/120 (48.33%), Query Frame = 3
Query: 1068 NGTCSIYEFCNPST--ININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFP-----IGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            NGT +I +  +PS     +  + +L +  +V SF +G GPIPW + +E++    R   MA++   NW  +F V + +FP     IG Y  F I+    +  I   Y   PE      E+I
Sbjct:  374 NGT-AIIDSASPSEGISTVKVLAILAVFGFVASFEMGPGPIPWFIVAELFAQGPRPAAMAVAGCCNWTASFLVGL-LFPILSKKIGAY-VFIIFLILLVVFIVFTYFRVPETKGRTFEDI 490          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Zebrafish
Match: slc2a1b (solute carrier family 2 member 1b [Source:ZFIN;Acc:ZDB-GENE-090915-1])

HSP 1 Score: 72.4034 bits (176), Expect = 7.409e-21
Identity = 60/266 (22.56%), Postives = 128/266 (48.12%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLL-SKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSY 1003
            +S+   P+Y+ E+ P  +RG + T++Q+ +  G+ +A V        + T       P +L    +PAL     +   PES R+LL ++N   +A  V++KL+    ++++  ++ + E +  +  + +         +  +    + R+ +V+   LQ+  QL GIN + YY+  +F+K     ++  ++ T     +N   + V+  ++++ GRR L L+ L G+  S +++ + + L++ +Y                DW+SY
Sbjct:  134 LSTGFVPMYVGEVAPTALRGALGTLHQLGIVVGILMAQVFGMEAIMGNAT-----MWPFLLGFTFIPALVQCCLLPICPESPRFLLINRNEESKAKSVLKKLRGT--TDVSADMQEMKEESRQMMREKKVT-------IPELFRSPLYRQPIVIAIMLQLSQQLSGINAIFYYSTKIFEK---AGVQQPVYATIGAGVVNTAFTVVSLFVVERAGRRSLHLLGLLGMAGSAILMTIAIALLE-KY----------------DWMSY 365          

HSP 2 Score: 48.1358 bits (113), Expect = 7.409e-21
Identity = 30/101 (29.70%), Postives = 50/101 (49.50%), Query Frame = 3
Query: 1116 INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPI----GLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            ++++ ++ +  +V  F IG GPIPW + +E++    R +  A++  +NW  NF V M    +    G Y  F I++ F LC     Y   PE      +EI
Sbjct:  363 MSYMSIVAIFAFVAFFEIGPGPIPWFIVAELFSQGPRPSAFAVAGFSNWTANFIVGMCFQYVEEVCGAY-VFVIFTVFLLCFFIFTYFKVPETKGRTFDEI 462          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Zebrafish
Match: slc2a3b (solute carrier family 2 member 3b [Source:ZFIN;Acc:ZDB-GENE-121031-5])

HSP 1 Score: 70.0922 bits (170), Expect = 4.764e-20
Identity = 63/260 (24.23%), Postives = 128/260 (49.23%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVN--ATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLL-SKNRIDEAIEVVRKLKQIP--ESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDN 973
            +S+   P+Y+ EI P  +RG   T++Q+ +  G+ +A ++   + L   +          +  +  ++  +F L       ES R+LL S N+ DEA + +  L+     E +I E  +  ++ ++           +K+  +  +  +   R+ +++   LQ+  QL GIN +MYY+  +F+      I   ++ T  +  +N + + V+  L+++ GRR L LI L G+ F ++++ ++L+L  V  L +N   I D+
Sbjct:  143 LSTGLTPMYVGEIAPTALRGAFGTLHQLGVVIGILVAQILGLESLLGSQTLWPLLLALTALPAVIQSIMLIFCL-------ESPRYLLISLNKEDEARQALTSLRGHSDVEDDIREMKDEAMKMSM-----------EKRVSIPELFRNPAYRQPIIIAIILQLSQQLSGINAVMYYSTEIFRN---AGITEPVFATIGMGVVNTVFTVVSLFLVERAGRRTLHLIGLTGMTFCVLLVTISLKL--VAKLLQNGTAIIDS 379          

HSP 2 Score: 47.7506 bits (112), Expect = 4.764e-20
Identity = 37/120 (30.83%), Postives = 58/120 (48.33%), Query Frame = 3
Query: 1068 NGTCSIYEFCNPST--ININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFP-----IGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            NGT +I +  +PS     +  + +L +  +V SF +G GPIPW + +E++    R   MA++   NW  +F V + +FP     IG Y  F I+    +  I   Y   PE      E+I
Sbjct:  372 NGT-AIIDSASPSEGISTVKVLAILAVFGFVASFEMGPGPIPWFIVAELFAQGPRPAAMAVAGCCNWTASFLVGL-LFPILSKKIGAY-VFIIFLILLVVFIVFTYFRVPETKGRTFEDI 488          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Xenopus
Match: phf21b (PHD finger protein 21B [Source:Xenbase;Acc:XB-GENE-969993])

HSP 1 Score: 123.635 bits (309), Expect = 2.696e-47
Identity = 83/286 (29.02%), Postives = 144/286 (50.35%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV-----DVRYLKRN---QNNICDNFLACDDWVSYHCEYCQIDENSGY 1042
            I+S   P+YIAE  P  +RGR++TI  + +T G F A+VV+   +Y +           +L   AVPA+   +G L +PES RWL+ K +  +A  V+ +++      I E  ++I  +     ++ +++      I+ R+L     R+ L++GC LQM  QL GIN +MYY+ ++ Q    ++ ++ +W   +  F N   + +   L++K+GRRKL L SL G   +L ++A+   L       V +   +    N+ C  +         +C  C +D N G+
Sbjct:  185 IASMTVPVYIAEAAPPHLRGRLVTINTLFITGGQFSAAVVDGAFSYLARDG-----WRYMLGLSAVPAVLQFLGFLFLPESPRWLIQKGQTQKARRVLSQIRG--NQTIDEEYDSIKNS----IDEEEKEGATGGPIIYRMLIYPPTRRALIVGCGLQMFQQLAGINTVMYYSATILQMSGVDDDRLAIWLAAVTAFTNFSFTLLGVWLVEKLGRRKLTLGSLTGTTVALFVLALGFLLSAQVSPPVTFTPGDPSGPNSTCTQY--------SYCNKCMLDPNCGF 451          

HSP 2 Score: 86.2705 bits (212), Expect = 2.696e-47
Identity = 46/118 (38.98%), Postives = 63/118 (53.39%), Query Frame = 3
Query: 1062 QTNGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYET----FWIYSAFTLCGIALIYRNFPEMNQANMEE 1403
            +  G+   Y +C  S    +W  LLG+ILY++ FA GMGP+PW V SEIYP W RST  A S+  NW  N  +++T      Y T    F++Y+     G+  IY   PE     +EE
Sbjct:  488 KAGGSIWAYNYCPTS---YSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGVNWICNVLISLTFLHTAEYLTYYGAFFLYAGLACVGLIFIYGCLPETKGKKLEE 602          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Xenopus
Match: phf21b (PHD finger protein 21B [Source:Xenbase;Acc:XB-GENE-969993])

HSP 1 Score: 124.02 bits (310), Expect = 1.006e-43
Identity = 83/286 (29.02%), Postives = 144/286 (50.35%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV-----DVRYLKRN---QNNICDNFLACDDWVSYHCEYCQIDENSGY 1042
            I+S   P+YIAE  P  +RGR++TI  + +T G F A+VV+   +Y +           +L   AVPA+   +G L +PES RWL+ K +  +A  V+ +++      I E  ++I  +     ++ +++      I+ R+L     R+ L++GC LQM  QL GIN +MYY+ ++ Q    ++ ++ +W   +  F N   + +   L++K+GRRKL L SL G   +L ++A+   L       V +   +    N+ C  +         +C  C +D N G+
Sbjct:  185 IASMTVPVYIAEAAPPHLRGRLVTINTLFITGGQFSAAVVDGAFSYLAR-----DGWRYMLGLSAVPAVLQFLGFLFLPESPRWLIQKGQTQKARRVLSQIRG--NQTIDEEYDSIKNS----IDEEEKEGATGGPIIYRMLIYPPTRRALIVGCGLQMFQQLAGINTVMYYSATILQMSGVDDDRLAIWLAAVTAFTNFSFTLLGVWLVEKLGRRKLTLGSLTGTTVALFVLALGFLLSAQVSPPVTFTPGDPSGPNSTCTQY--------SYCNKCMLDPNCGF 451          

HSP 2 Score: 73.9442 bits (180), Expect = 1.006e-43
Identity = 43/101 (42.57%), Postives = 58/101 (57.43%), Query Frame = 3
Query: 1062 QTNGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYETFWIYSAFTL-CGIALI 1361
            +  G+   Y +C  S    +W  LLG+ILY++ FA GMGP+PW V SEIYP W RST  A S+  NW  N  +++T      Y T+  Y AF L  G+A +
Sbjct:  488 KAGGSIWAYNYCPTS---YSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGVNWICNVLISLTFLHTAEYLTY--YGAFFLYAGLARL 583          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Xenopus
Match: slc2a10 (solute carrier family 2 (facilitated glucose transporter), member 10 [Source:NCBI gene;Acc:780388])

HSP 1 Score: 77.411 bits (189), Expect = 1.788e-14
Identity = 43/101 (42.57%), Postives = 57/101 (56.44%), Query Frame = 3
Query: 1116 INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMT----VFPIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            +NWI LL M+ +V +F+IG GP+ W+V SEIYPA  R    A   + NW  N  +T+T    +  IGL  TF +Y    L  IA IY   PE    ++EEI
Sbjct:  427 LNWITLLSMMAFVSAFSIGFGPMTWIVLSEIYPADIRGRAFAFCNSFNWAANLLITLTFLDVIASIGLSWTFLLYGVVGLLAIAFIYFFIPETKGQSLEEI 527          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Xenopus
Match: slc2a10 (solute carrier family 2 (facilitated glucose transporter), member 10 [Source:NCBI gene;Acc:780388])

HSP 1 Score: 77.411 bits (189), Expect = 1.805e-14
Identity = 43/101 (42.57%), Postives = 57/101 (56.44%), Query Frame = 3
Query: 1116 INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMT----VFPIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            +NWI LL M+ +V +F+IG GP+ W+V SEIYPA  R    A   + NW  N  +T+T    +  IGL  TF +Y    L  IA IY   PE    ++EEI
Sbjct:  417 LNWITLLSMMAFVSAFSIGFGPMTWIVLSEIYPADIRGRAFAFCNSFNWAANLLITLTFLDVIASIGLSWTFLLYGVVGLLAIAFIYFFIPETKGQSLEEI 517          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Xenopus
Match: slc2a10 (solute carrier family 2 (facilitated glucose transporter), member 10 [Source:NCBI gene;Acc:780388])

HSP 1 Score: 77.411 bits (189), Expect = 1.818e-14
Identity = 43/101 (42.57%), Postives = 57/101 (56.44%), Query Frame = 3
Query: 1116 INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMT----VFPIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            +NWI LL M+ +V +F+IG GP+ W+V SEIYPA  R    A   + NW  N  +T+T    +  IGL  TF +Y    L  IA IY   PE    ++EEI
Sbjct:  417 LNWITLLSMMAFVSAFSIGFGPMTWIVLSEIYPADIRGRAFAFCNSFNWAANLLITLTFLDVIASIGLSWTFLLYGVVGLLAIAFIYFFIPETKGQSLEEI 517          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Mouse
Match: Slc2a13 (solute carrier family 2 (facilitated glucose transporter), member 13 [Source:MGI Symbol;Acc:MGI:2146030])

HSP 1 Score: 140.584 bits (353), Expect = 1.548e-53
Identity = 89/286 (31.12%), Postives = 146/286 (51.05%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQL---VDVRYLKR-----NQNNICDNFLACDDWVSYHCEYCQIDENSGY 1042
            I+S   P+YIAE++P  +RGR++TI  + +T G F ASVV+   +Y             +L   A+PA+   +G L +PES RWL+ K +  +A  ++ +++      I E  ++I  +    E++          I+CR+L     R+ LV+GC LQM  QL GIN +MYY+ ++ Q     + ++ +W   +  F N I + V   L++K+GRRKL   SL G   +L+I+A+   L   V  R   R     +QN  C  +  C++        C +D + G+
Sbjct:  176 IASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQK-----DGWRYMLGLAAIPAVIQFLGFLFLPESPRWLIQKGQTQKARRILSQMRG--NQTIDEEYDSIRNSIEEEEKEATAAGP----IICRMLSYPPTRRALVVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASITAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFLLSAQVSPRVTFRPTTPSDQNTTCTGYSYCNE--------CMLDPDCGF 442          

HSP 2 Score: 89.7373 bits (221), Expect = 1.548e-53
Identity = 48/119 (40.34%), Postives = 65/119 (54.62%), Query Frame = 3
Query: 1062 QTNGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYET----FWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            +  G    Y FC P+  +  W  L+G++LY++ FA GMGP+PW V SEIYP W RST  A S   NW FN  V++T      Y T    F++Y+ F   G+  +Y   PE     +EEI
Sbjct:  479 KAEGAHWAYSFC-PTPYS--WTALVGLVLYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFVYGCLPETKGKKLEEI 594          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Mouse
Match: Slc2a2 (solute carrier family 2 (facilitated glucose transporter), member 2 [Source:MGI Symbol;Acc:MGI:1095438])

HSP 1 Score: 83.1889 bits (204), Expect = 1.505e-16
Identity = 69/244 (28.28%), Postives = 121/244 (49.59%), Query Frame = 2
Query:  215 STCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPES-----NITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVD 931
            S   P+YI EI P  +RG + T++Q+ L  G+ ++ +   +    +          I+L   AVPAL   + +L  PES R+L  K  ++E +   + LK++  +     +I E  +   EA+            ++K  + ++  D   R+ +++   L M  Q  GING+ YY+ S+FQ   T  I   ++ T  +  IN+I + V+  L++K GRR L L  + G+ F  + ++V L L+D
Sbjct:  168 SGLVPMYIGEIAPTTLRGALGTLHQLALVTGILISQIAGLSFILGNQDHWH-----ILLGLSAVPALLQCLLLLFCPESPRYLYIK--LEEEVRAKKSLKRLRGTEDVTKDINEMKKEKEEAST-----------EQKVSVIQLFTDANYRQPILVALMLHMAQQFSGINGIFYYSTSIFQ---TAGISQPVYATIGVGAINMIFTAVSVLLVEKAGRRTLFLTGMIGMFFCTIFMSVGLVLLD 390          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Mouse
Match: Slc2a1 (solute carrier family 2 (facilitated glucose transporter), member 1 [Source:MGI Symbol;Acc:MGI:95755])

HSP 1 Score: 73.1738 bits (178), Expect = 2.328e-13
Identity = 59/242 (24.38%), Postives = 122/242 (50.41%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLL-SKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVD 931
            +++   P+Y+ E++P  +RG + T++Q+ +  G+ +A V     +     D  P  + +I I    PAL   I +   PES R+LL ++N  + A  V++KL+    +++T  ++ + E    +  + +         +  +      R+ +++   LQ+  QL GIN + YY+ S+F+K     ++  ++ T     +N   + V+  ++++ GRR L LI L G+    V++ + L L++
Sbjct:  135 LTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLD-SIMGNADLWPLLLSVIFI----PALLQCILLPFCPESPRFLLINRNEENRAKSVLKKLRGT--ADVTRDLQEMKEEGRQMMREKKVT-------ILELFRSPAYRQPILIAVVLQLSQQLSGINAVFYYSTSIFEK---AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMAGCAVLMTIALALLE 359          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Mouse
Match: Slc2a12 (solute carrier family 2 (facilitated glucose transporter), member 12 [Source:MGI Symbol;Acc:MGI:3052471])

HSP 1 Score: 71.2478 bits (173), Expect = 1.236e-12
Identity = 35/100 (35.00%), Postives = 59/100 (59.00%), Query Frame = 3
Query: 1119 NWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFP----IGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
             W+ L  +++YV +F+IG+GP+PW+V SEI+P   R   MAL+++ NW  N  +++T       IGL    +IY+  +L  +A +    PE    ++E+I
Sbjct:  466 KWLSLASLLVYVAAFSIGLGPMPWLVLSEIFPGGIRGRAMALTSSMNWGVNLLISLTFLTVTDLIGLSWVCFIYTIMSLASLAFVVLFIPETKGCSLEQI 565          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Mouse
Match: Slc2a10 (solute carrier family 2 (facilitated glucose transporter), member 10 [Source:MGI Symbol;Acc:MGI:2156687])

HSP 1 Score: 67.0106 bits (162), Expect = 2.342e-11
Identity = 36/99 (36.36%), Postives = 56/99 (56.57%), Query Frame = 3
Query: 1122 WILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMT----VFPIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            W  L+ M++YV +F++G GP+ W+V SEIYPA  R    A  ++ NW  N  ++++    +  IGL  TF +Y    + G+A IY   PE    ++ EI
Sbjct:  406 WSALVCMMVYVSAFSVGFGPVTWLVLSEIYPAEIRGRAFAFCSSFNWAANLFISLSFLDLIGAIGLAWTFLLYGLTAVLGLAFIYLLVPETKGQSLAEI 504          
BLAST of Proton myo-inositol cotransporter vs. UniProt/SwissProt
Match: sp|Q3UHK1|MYCT_MOUSE (Proton myo-inositol cotransporter OS=Mus musculus OX=10090 GN=Slc2a13 PE=1 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 9.315e-53
Identity = 89/286 (31.12%), Postives = 146/286 (51.05%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQL---VDVRYLKR-----NQNNICDNFLACDDWVSYHCEYCQIDENSGY 1042
            I+S   P+YIAE++P  +RGR++TI  + +T G F ASVV+   +Y             +L   A+PA+   +G L +PES RWL+ K +  +A  ++ +++      I E  ++I  +    E++          I+CR+L     R+ LV+GC LQM  QL GIN +MYY+ ++ Q     + ++ +W   +  F N I + V   L++K+GRRKL   SL G   +L+I+A+   L   V  R   R     +QN  C  +  C++        C +D + G+
Sbjct:  176 IASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQK-----DGWRYMLGLAAIPAVIQFLGFLFLPESPRWLIQKGQTQKARRILSQMRG--NQTIDEEYDSIRNSIEEEEKEATAAGP----IICRMLSYPPTRRALVVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASITAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFLLSAQVSPRVTFRPTTPSDQNTTCTGYSYCNE--------CMLDPDCGF 442          

HSP 2 Score: 89.7373 bits (221), Expect = 9.315e-53
Identity = 48/119 (40.34%), Postives = 65/119 (54.62%), Query Frame = 3
Query: 1062 QTNGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYET----FWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            +  G    Y FC P+  +  W  L+G++LY++ FA GMGP+PW V SEIYP W RST  A S   NW FN  V++T      Y T    F++Y+ F   G+  +Y   PE     +EEI
Sbjct:  479 KAEGAHWAYSFC-PTPYS--WTALVGLVLYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFVYGCLPETKGKKLEEI 594          
BLAST of Proton myo-inositol cotransporter vs. UniProt/SwissProt
Match: sp|Q9ZQP6|INT3_ARATH (Probable inositol transporter 3 OS=Arabidopsis thaliana OX=3702 GN=INT3 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.372e-34
Identity = 81/301 (26.91%), Postives = 141/301 (46.84%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDK--------IARKTLVMGCSLQMLAQLIGINGLMYYANSLFQ--KYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVD---VRYLKRNQNNICDN--------FLA---------CDDWVSYHCEYCQ 1021
            ++S   PLYI+E++P  IRG +++   + +T G FL+ ++N    +      +P T   +L   A+PA+     MLT+PES RWL   +R  E+ +++ ++          +   ++EA +   ++    +   + I+     DK        + R  L  G ++Q+  Q +GIN +MYY+ ++ Q   Y +N   + L    + + +N + S V+   +D+ GRRKL +IS+FGII  LVI+A           +  KR+  N   N        F A         C   + Y C +C 
Sbjct:  135 MASMTSPLYISEMSPARIRGALVSTNGLLITGGQFLSYLINLAFVH------TPGTWRWMLGVSAIPAIIQFCLMLTLPESPRWLYRNDRKAESRDILERI----------YPAEMVEAEIAALKESVRAETADEDIIGHTFSDKLRGALSNPVVRHGLAAGITVQVAQQFVGINTVMYYSPTILQFAGYASNKTAMALAL--ITSGLNAVGSVVSMMFVDRYGRRKLMIISMFGIITCLVILAAVFNEASNHAPKIDKRDSRNFAKNATCPAFAPFTASRSPPSNWNCMKCLQYDCGFCS 417          

HSP 2 Score: 59.6918 bits (143), Expect = 1.372e-34
Identity = 38/123 (30.89%), Postives = 58/123 (47.15%), Query Frame = 3
Query: 1062 QTNGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVF----PIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEILHVL 1418
             + G     + C PS      I+ LG  LY+I +A GMG +PW+V SEIYP   R     ++  +NW  N  V+ T       +G   TF +++  +  G+  I+   PE      EE+  +L
Sbjct:  440 HSKGRTFFKDGC-PSKFGYLAIVFLG--LYIIVYAPGMGTVPWIVNSEIYPLRYRGLAGGIAAVSNWMSNLVVSETFLTLTNAVGSSGTFLLFAGSSAVGLFFIWLLVPETKGLQFEEVEKLL 559          
BLAST of Proton myo-inositol cotransporter vs. UniProt/SwissProt
Match: sp|Q96QE2|MYCT_HUMAN (Proton myo-inositol cotransporter OS=Homo sapiens OX=9606 GN=SLC2A13 PE=1 SV=3)

HSP 1 Score: 137.502 bits (345), Expect = 2.146e-33
Identity = 84/286 (29.37%), Postives = 145/286 (50.70%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQL---VDVRYLKR-----NQNNICDNFLACDDWVSYHCEYCQIDENSGY 1042
            I+S   P+YIAE++P  +RGR++TI  + +T G F ASVV+   +Y             +L   AVPA+    G L +PES RWL+ K +  +A  ++ +++        + ++   ++     E+ +++      ++CR+L     R+ L++GC LQM  QL GIN +MYY+ ++ Q     + ++ +W   +  F N I + V   L++K+GRRKL   SL G   +L+I+A+   L   V  R   +      QN  C  +  C++        C +D + G+
Sbjct:  187 IASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQK-----DGWRYMLGLAAVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILSQMRG------NQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNATCTRYSYCNE--------CMLDPDCGF 453          

HSP 2 Score: 92.0485 bits (227), Expect = 1.980e-18
Identity = 50/111 (45.05%), Postives = 64/111 (57.66%), Query Frame = 3
Query: 1086 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYET----FWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            Y FC P+  +  W  LLG+ILY++ FA GMGP+PW V SEIYP W RST  A S+  NW FN  V++T      Y T    F++Y+ F   G+  IY   PE     +EEI
Sbjct:  498 YNFC-PTPYS--WTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEI 605          
BLAST of Proton myo-inositol cotransporter vs. UniProt/SwissProt
Match: sp|Q921A2|MYCT_RAT (Proton myo-inositol cotransporter OS=Rattus norvegicus OX=10116 GN=Slc2a13 PE=1 SV=2)

HSP 1 Score: 137.117 bits (344), Expect = 2.413e-33
Identity = 88/286 (30.77%), Postives = 143/286 (50.00%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQL---VDVRYLKR-----NQNNICDNFLACDDWVSYHCEYCQIDENSGY 1042
            I+S   P+YIAE++P  +RGR++TI  + +T G F ASVV+   +Y             +L   A+PA+   +G L +PES RWL+ K +  +A  ++ +++      I E  ++I  +    E++          I+CR+L     R+ L +GC LQM  QL GIN +MYY+ ++ Q     + ++ +W   +  F N I + V   L++K+GRRKL   SL G   +L I+A+   L   V  R   R      QN  C  +  C++        C +D + G+
Sbjct:  176 IASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDG-----WRYMLGLAAIPAVIQFLGFLFLPESPRWLIQKGQTQKARRILSQMRG--NQTIDEEYDSIRNSIEEEEKEASAAGP----IICRMLSYPPTRRALAVGCGLQMFQQLSGINTIMYYSATILQMSGVEDDRLAIWLASITAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALTILALGFLLSAQVSPRVTFRPTAPSGQNATCTEYSYCNE--------CMLDPDCGF 442          

HSP 2 Score: 89.3521 bits (220), Expect = 1.382e-17
Identity = 47/111 (42.34%), Postives = 63/111 (56.76%), Query Frame = 3
Query: 1086 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYET----FWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            Y FC P+  +  W  L+G++LY++ FA GMGP+PW V SEIYP W RST  A S   NW FN  V++T      Y T    F++Y+ F   G+  +Y   PE     +EEI
Sbjct:  487 YSFC-PTPYS--WTALVGLVLYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGFAAVGLLFVYGCLPETKGKKLEEI 594          
BLAST of Proton myo-inositol cotransporter vs. UniProt/SwissProt
Match: sp|Q8VZR6|INT1_ARATH (Inositol transporter 1 OS=Arabidopsis thaliana OX=3702 GN=INT1 PE=1 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 9.557e-25
Identity = 74/237 (31.22%), Postives = 127/237 (53.59%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNL 919
            ++S   P+YIAE +P  +RG +++   + +T G FL+ +VN+         + P T   +L    VPA+   I ML +PES RWL  KNR  EAI+V+ +   I  S + + ++++  A        +E++ ++      +   K  R   + G  LQ   Q  GIN +MYY+ ++ Q    ++ ++ L+ + ++  +N   + V    ID  GR+KLAL SLFG+I SL+I++V+ 
Sbjct:  140 VASVTAPVYIAEASPSEVRGGLVSTNVLMITGGQFLSYLVNSAFT------QVPGTWRWMLGVSGVPAVIQFILMLFMPESPRWLFMKNRKAEAIQVLARTYDI--SRLEDEIDHLSAAE------EEEKQRKRTVGYLDVFRSKELRLAFLAGAGLQAFQQFTGINTVMYYSPTIVQMAGFHSNQLALFLSLIVAAMNAAGTVVGIYFIDHCGRKKLALSSLFGVIISLLILSVSF 362          

HSP 2 Score: 63.929 bits (154), Expect = 1.617e-9
Identity = 35/103 (33.98%), Postives = 48/103 (46.60%), Query Frame = 3
Query: 1119 NWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPI----GLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEILHV 1415
             W+ +LG+ LY++ FA GMGP+PW V SEIYP   R     +S T NW  N  V  T   I    G   TF I +   +  +  +    PE       E+  +
Sbjct:  376 GWLAVLGLALYIVFFAPGMGPVPWTVNSEIYPQQYRGICGGMSATVNWISNLIVAQTFLTIAEAAGTGMTFLILAGIAVLAVIFVIVFVPETQGLTFSEVEQI 478          
BLAST of Proton myo-inositol cotransporter vs. TrEMBL
Match: A0A0H3YJX4 (Slc2a-9 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc2a-9 PE=2 SV=1)

HSP 1 Score: 505.753 bits (1301), Expect = 0.000e+0
Identity = 271/286 (94.76%), Postives = 274/286 (95.80%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSYHCEYCQIDENSGYTCVNYGAN 1066
            ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPT  S  T PIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIEEDLQEQKEQKKFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGII S VIIAVNLQLVDVRYLKRNQNN C NFL+CDD ++  CEYCQIDENSGYTCVNYGAN
Sbjct:  134 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTYGSDTTTPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIEEDLQEQKEQKKFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIISSSVIIAVNLQLVDVRYLKRNQNNNCRNFLSCDDCINNICEYCQIDENSGYTCVNYGAN 419          

HSP 2 Score: 199.134 bits (505), Expect = 0.000e+0
Identity = 98/117 (83.76%), Postives = 101/117 (86.32%), Query Frame = 3
Query: 1068 NGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEILHVL 1418
             G   IY F N  T NINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTA W  N +VTMTVF   LYETFWIYSAFT+CGIALIY+NFPEMNQANMEEILHVL
Sbjct:  423 KGNYPIYNFDNHCTNNINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTAKWLCNLTVTMTVFTRRLYETFWIYSAFTICGIALIYKNFPEMNQANMEEILHVL 539          

HSP 3 Score: 139.043 bits (349), Expect = 7.892e-32
Identity = 67/74 (90.54%), Postives = 70/74 (94.59%), Query Frame = 3
Query:    3 EFIVILNFIFICSFNLMNFEYSIDSLFDAGNIEVLYTNQFIHYITFPIIGGFMFGYVTETVPNVYGIFVFLLLA 224
            EFIVILNFIFICSFNLMNFEYSIDSLFDAGNIEVLYTNQFIHYITFPIIGGFMFGYVT TVP+VYGIF   ++A
Sbjct:    1 EFIVILNFIFICSFNLMNFEYSIDSLFDAGNIEVLYTNQFIHYITFPIIGGFMFGYVTGTVPDVYGIFHMFMVA 74          
BLAST of Proton myo-inositol cotransporter vs. TrEMBL
Match: A0A0H3YIU7 (Slc2a-10 OS=Schmidtea mediterranea OX=79327 GN=slc2a-10 PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 3.835e-59
Identity = 114/275 (41.45%), Postives = 174/275 (63.27%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRN--QNNICDNFLACDDWV-SYHCEYCQI 1024
            IS+ CCP+YIAE++P  IRGR+I IYQI +T G+F A++V+A+  Y        +    +L   A+P+    IGMLTVPESYRWLLSKN++DEA  ++    Q+PE  ITE+++ I+ AN  I+  ++E +   + ++ +I  + +AR++L++GC LQML Q+IGIN +MYY   + +     +I   LW + L+ F N I SF+ + LIDKIGRRKL++ SL  ++ SL+ IA+  Q++  +  K     NN C   + C++ V S  C +C I
Sbjct:  130 ISAACCPVYIAEVSPHQIRGRLIVIYQISITGGMFFAALVDASFFYLGK-----EGWRYMLGGAAIPSFIEFIGMLTVPESYRWLLSKNKVDEARTIIVNQGQVPEERITEYIDEIVRANQQIQMQVKEHEGNSRSLIFQIFRNDVARRSLLIGCGLQMLQQIIGINTIMYYTALVIRMSGVKDISTILWLSALVAFFNFIPSFIGFILIDKIGRRKLSISSLCCVLLSLITIAITFQVLVSQSEKVTYPSNNYCGKKINCEECVTSSACGFCYI 399          

HSP 2 Score: 128.642 bits (322), Expect = 3.666e-28
Identity = 62/115 (53.91%), Postives = 81/115 (70.43%), Query Frame = 3
Query: 1086 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVF----PIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEILHVL 1418
            Y+FC       +W++++G+ILY+ISF+IGMGPIPW +TSEIYP WCRSTNMALST+ NW FN  V++T       I  Y TFW+YS+F   GI  IY+  PE NQ ++EEI  +L
Sbjct:  444 YDFC---VSKYSWVIIVGLILYLISFSIGMGPIPWAITSEIYPLWCRSTNMALSTSTNWVFNLIVSLTFLSLTEAITKYGTFWLYSSFAFFGILFIYKFVPETNQRSLEEINDLL 555          
BLAST of Proton myo-inositol cotransporter vs. TrEMBL
Match: L7MH30 (Putative proton myo-inositol cotransporter (Fragment) OS=Rhipicephalus pulchellus OX=72859 PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.241e-50
Identity = 98/298 (32.89%), Postives = 151/298 (50.67%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITP------------------AVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRN-----QNNICDNFLACDDWVSYH-CEYCQIDE 1030
            ++S   P+YIAE++P  +RG ++TI Q+ +T G F+ASV +    ++S T+   + M  +   P                   VP+L  L+G L +PES RWL SK    EAIEV+R+ +  P++NI    E   EA      D  + +E    +L ++L D   R  L++GC+L M  Q+ GIN +MYY  ++ Q    ++    +W     +F+N   SF+   L+++IGRR L L+SL G+I SL ++A   QL D+            + IC NF  C        C YC I +
Sbjct:  138 LASMTVPVYIAEVSPAELRGFLVTINQVFITGGQFIASVADGL--FSSDTENGWRYMLALAGVPSLIQLLGFLXWRYMLALAGVPSLIQLLGFLGMPESPRWLASKGAYQEAIEVLRRFRG-PDANI----EPEFEALKATCIDNDQDEEHSGPVLIQVLRDGPLRLALIVGCALMMFQQIAGINTVMYYGATIIQMSGVHDASKAIWLAAATSFVNFACSFIGMALVERIGRRLLTLLSLAGVIASLSVLAGGFQLADMESPSVGPIVVPSSGICGNFSTCASCTGVSGCGYCYIPD 428          

HSP 2 Score: 78.9518 bits (193), Expect = 1.241e-50
Identity = 44/111 (39.64%), Postives = 66/111 (59.46%), Query Frame = 3
Query: 1086 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVF----PIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            Y +C PS    +W+ +LG++LY+  FA G+G +PW + SEIYP W RST  +++T+ NW FN  V+MT       I  Y TFW+Y+  +L G    +   PE    ++EE+
Sbjct:  464 YNWC-PS--RYSWMTILGLVLYLFFFAPGLGAMPWTINSEIYPLWARSTCFSVATSFNWAFNLLVSMTFLTLTEAITKYGTFWLYAGLSLLGWFFFFLFLPETKGKSLEEV 571          
BLAST of Proton myo-inositol cotransporter vs. TrEMBL
Match: R7U3K5 (MFS domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_175747 PE=3 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 1.295e-50
Identity = 86/287 (29.97%), Postives = 145/287 (50.52%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIP--ESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRY----LKRNQNNI---CDNFLACDDWVSY-HCEYCQIDENSG 1039
            +SS   P+YIAE  P  +RGR++T+  I +T G  +AS+++   +Y    D+       +L    VPA    +  + +PES RWL+ K RI +A EV++K++     +  + E   +  EA+    E              R L     R+ L++GC LQ+  Q+ GIN +MYY+ ++ +     +  + +W + L   +N I +FV   L++++GRR+L L S+ G+  SL ++A+  Q+  +R          N+    CD F  CD  VS   C +C +  +SG
Sbjct:  145 LSSMAIPMYIAENAPCHLRGRLVTMNNIFITGGQLIASLIDGAFSY----DKI-NGWRYMLGLAGVPAAIQFVAFIFMPESARWLVGKGRISQAGEVLKKIRGTENIDHELEEIRSSYAEAHACTSEAEGSSST-----FVRALKTPHVRRALIVGCGLQLFQQICGINTVMYYSATIIKMSGVKDASLAIWLSSLTAGVNFIFTFVGLYLVERMGRRRLTLFSVVGVTISLAVLAIGFQITAIRSPRVTFDEGMNSTSYDCDRFSTCDGCVSSPDCGFCFLPSSSG 421          

HSP 2 Score: 86.6557 bits (213), Expect = 1.295e-50
Identity = 44/111 (39.64%), Postives = 63/111 (56.76%), Query Frame = 3
Query: 1086 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVF----PIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            Y++C PS++   W+   G++LY+  FA GMGP+PW + SEIYP W RST  +LST  NW  N  V+MT       +  Y  FW+YS  +L G    +   PE    ++E +
Sbjct:  460 YDYC-PSSMA--WMSTFGLVLYLAFFAPGMGPMPWTINSEIYPLWARSTGNSLSTATNWIANLVVSMTFLSLLEALTKYGAFWLYSVLSLLGTIFFFALLPETRGLSLEHM 567          
BLAST of Proton myo-inositol cotransporter vs. TrEMBL
Match: L7MDM9 (Putative proton myo-inositol cotransporter (Fragment) OS=Rhipicephalus pulchellus OX=72859 PE=2 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 1.477e-50
Identity = 98/298 (32.89%), Postives = 152/298 (51.01%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPA------------------VPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRN-----QNNICDNFLACDDWVSYH-CEYCQIDE 1030
            ++S   P+YIAE++P  +RG ++TI Q+ +T G F+ASV +    ++S T+   + M  +   P+                  VP+L  L+G L +PES RWL SK    EAIEV+R+ +  P++NI    E   EA      D  + +E    +L ++L D   R  L++GC+L M  Q+ GIN +MYY  ++ Q    ++    +W     +F+N   SF+   L+++IGRR L L+SL G+I SL ++A   QL D+            + IC NF  C        C YC I +
Sbjct:  129 LASMTVPVYIAEVSPAELRGFLVTINQVFITGGQFIASVADGL--FSSDTENGWRYMLALAGVPSLIQLLGFLXWRYMLALAGVPSLIQLLGFLGMPESPRWLASKGAYQEAIEVLRRFRG-PDANI----EPEFEALKATCIDNDQDEEHSGPVLIQVLRDGPLRLALIVGCALMMFQQIAGINTVMYYGATIIQMSGVHDASKAIWLAAATSFVNFACSFIGMALVERIGRRLLTLLSLAGVIASLSVLAGGFQLADMESPSVGPIVVPSSGICGNFSTCASCTGVSGCGYCYIPD 419          

HSP 2 Score: 78.5666 bits (192), Expect = 1.477e-50
Identity = 44/111 (39.64%), Postives = 66/111 (59.46%), Query Frame = 3
Query: 1086 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVF----PIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            Y +C PS    +W+ +LG++LY+  FA G+G +PW + SEIYP W RST  +++T+ NW FN  V+MT       I  Y TFW+Y+  +L G    +   PE    ++EE+
Sbjct:  455 YNWC-PS--RYSWMTILGLVLYLFFFAPGLGAMPWTINSEIYPLWARSTCFSVATSFNWAFNLLVSMTFLTLTEAITKYGTFWLYAGLSLLGWFFFFLFLPETKGKSLEEV 562          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Cavefish
Match: SLC2A13 (solute carrier family 2 member 13 [Source:NCBI gene;Acc:103031966])

HSP 1 Score: 132.109 bits (331), Expect = 1.545e-32
Identity = 88/279 (31.54%), Postives = 145/279 (51.97%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSY-HCEYCQIDENSGY 1042
            ISS   P+YIAE +P  +RG+++T+  + +T G F+AS+++   +Y             +L   AVPAL    G L +PES RWL+ K    +A  V+ +++     NI E  E+I  +     E+ ++       IL R+L    AR+ L++GC LQM  QL GIN +MYY+ ++ Q     + K+ +W + L    N + + +   L++K+GRR+L+L S+ G   SL ++A    L+  ++      +  D  LA      Y  CE C +D + G+
Sbjct:  199 ISSMTVPVYIAEASPPHLRGQLVTVNTLFITAGQFVASLIDGAFSYVQHGG-----WRYMLGLSAVPALVQFFGFLFLPESPRWLIQKGLTQKARRVLSQIRG--NQNIDEEYESIKSS----IEEEEKDCGGDGPILWRMLTYPPARRALIVGCGLQMFQQLSGINTVMYYSATILQMSGVRDDKLAIWLSSLTALTNFLFTLLGVWLVEKVGRRRLSLGSIIGTSVSLCLLAFGF-LLSAQHSPPVTIHPTDPSLANSSCTRYLSCEPCMLDPSCGF 465          

HSP 2 Score: 93.5893 bits (231), Expect = 7.609e-20
Identity = 50/111 (45.05%), Postives = 65/111 (58.56%), Query Frame = 3
Query: 1086 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYET----FWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            Y FC  S    +W++LLG+ILY+  FA G+GP+PW V SEIYP W RST  A S   NW FN  V++T   +  Y T    F++YS+ +L G   IY   PE     +EEI
Sbjct:  509 YNFCPTS---YSWVVLLGLILYLAFFAPGLGPMPWTVNSEIYPLWARSTGNACSAGVNWTFNVLVSLTFLHLAQYLTYYGAFFLYSSLSLLGFFFIYGCLPETKGRRLEEI 616          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Cavefish
Match: slc2a13b (solute carrier family 2 member 13b [Source:ZFIN;Acc:ZDB-GENE-090812-1])

HSP 1 Score: 126.716 bits (317), Expect = 4.780e-31
Identity = 91/285 (31.93%), Postives = 141/285 (49.47%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILE--ANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV-----DVRYLKRNQNNICDNFLACDDWVSYHCEYCQIDENSGY 1042
            I+S   P+YIAE++P  +RG+++TI  + +T G F+ASVV+   +Y S           +L   AVPA+   IG L +PES RWLL K R  +A EV+  ++           EN+ E   N+    + +E++     +L RIL    AR+ LV+GC LQM  QL GIN +MYY+ ++ Q     + K+ +W +    F N + + V   L++   + KL L+   G   SL ++AV   L       V     + N  C ++          CE C +D   G+
Sbjct:   82 IASMTVPVYIAEVSPSHLRGQLVTINTLFITGGQFIASVVDGAFSYLSHGGWR-----YMLGLSAVPAVLQFIGFLFLPESPRWLLQKGRSQQAREVLTHIRA---------TENVDEEFNNIKNIIEEEEKESGGGLVLWRILTSAPARRALVVGCGLQMFQQLSGINTVMYYSATILQMAGVRDDKMAIWLSAATAFTNFLFTLVGVWLVEH--KTKLYLLLSSGTTVSLSVLAVGFLLSAQASPPVTIHPTSLNTTCSHY--------GFCENCMLDPACGF 342          

HSP 2 Score: 81.6481 bits (200), Expect = 3.480e-16
Identity = 42/100 (42.00%), Postives = 57/100 (57.00%), Query Frame = 3
Query: 1119 NWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYET----FWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            +WI++LG++LY+  FA GMGP+PW V SEIYP W RST  A S   NW  N  V++T   +  Y T    F++YS   L G   +    PE     +E+I
Sbjct:  388 SWIVMLGLLLYLAFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGVNWICNVLVSLTFLHVAEYLTYYGAFFLYSGLALLGFFFVLGCLPETKGLMLEDI 487          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Cavefish
Match: slc2a3b (solute carrier family 2, facilitated glucose transporter member 3-like [Source:NCBI gene;Acc:103028878])

HSP 1 Score: 63.929 bits (154), Expect = 3.732e-20
Identity = 60/261 (22.99%), Postives = 124/261 (47.51%), Query Frame = 2
Query:  227 PLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEA---IEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVS 1000
            P+Y+ E+ P   RG   T++Q+ +  G+ +A ++   +   S         P++L   A+PA+   + ++   ES R+LL   + +E    I V+ + ++  E +I E  E   EA+ L +E            +  +  + I R+ +++   + +  Q  GIN + YY+  +F+   ++ +   ++ T     IN + + V+  L+++ GRR L +  L G+    +++ + LQLV        Q ++C   + C+  V+
Sbjct:   94 PMYVGELAPTAQRGAFGTLHQLAIVIGILIAQILGLEVLLGSE-----YLWPLLLGLTALPAVLQSVMLIFCSESPRYLLINLKQEEEARRILVLLRGQEDVEDDIREMKE---EADKLNQEQKVS--------IPELFRNPIYRQPIIIAIVMNVSQQFSGINAVFYYSTQIFK---SSGVSEPIYATIGTGIINTVFTVVSLFLVERAGRRTLQMFGLGGMAICALVMTIVLQLVLDPCAP--QEDLCAAPVVCNGTVA 333          

HSP 2 Score: 53.9138 bits (128), Expect = 3.732e-20
Identity = 27/78 (34.62%), Postives = 44/78 (56.41%), Query Frame = 3
Query: 1068 NGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPI 1301
            NGT ++    +  T  I+++ +L +  +V SF IG GPIPW + +E++    R   +A+   +NW  NF V M  FP+
Sbjct:  329 NGTVAVTSDASSKTPVISYVAILAVFGFVASFEIGPGPIPWFIATELFAQDARPAAVAVGGCSNWISNFLVAM-FFPM 405          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Cavefish
Match: slc2a3b (solute carrier family 2, facilitated glucose transporter member 3-like [Source:NCBI gene;Acc:103028878])

HSP 1 Score: 63.1586 bits (152), Expect = 6.454e-20
Identity = 60/261 (22.99%), Postives = 124/261 (47.51%), Query Frame = 2
Query:  227 PLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEA---IEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVS 1000
            P+Y+ E+ P   RG   T++Q+ +  G+ +A ++   +   S         P++L   A+PA+   + ++   ES R+LL   + +E    I V+ + ++  E +I E  E   EA+ L +E            +  +  + I R+ +++   + +  Q  GIN + YY+  +F+   ++ +   ++ T     IN + + V+  L+++ GRR L +  L G+    +++ + LQLV        Q ++C   + C+  V+
Sbjct:  146 PMYVGELAPTAQRGAFGTLHQLAIVIGILIAQILGLEVLLGSE-----YLWPLLLGLTALPAVLQSVMLIFCSESPRYLLINLKQEEEARRILVLLRGQEDVEDDIREMKE---EADKLNQEQKVS--------IPELFRNPIYRQPIIIAIVMNVSQQFSGINAVFYYSTQIFK---SSGVSEPIYATIGTGIINTVFTVVSLFLVERAGRRTLQMFGLGGMAICALVMTIVLQLVLDPCAP--QEDLCAAPVVCNGTVA 385          

HSP 2 Score: 53.9138 bits (128), Expect = 6.454e-20
Identity = 27/78 (34.62%), Postives = 44/78 (56.41%), Query Frame = 3
Query: 1068 NGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPI 1301
            NGT ++    +  T  I+++ +L +  +V SF IG GPIPW + +E++    R   +A+   +NW  NF V M  FP+
Sbjct:  381 NGTVAVTSDASSKTPVISYVAILAVFGFVASFEIGPGPIPWFIATELFAQDARPAAVAVGGCSNWISNFLVAM-FFPM 457          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Cavefish
Match: slc2a1b (solute carrier family 2, facilitated glucose transporter member 1-like [Source:NCBI gene;Acc:103036684])

HSP 1 Score: 79.337 bits (194), Expect = 2.200e-15
Identity = 61/242 (25.21%), Postives = 124/242 (51.24%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLL-SKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVD 931
            +S+   P+Y+ E+ P  +RG + T++Q+ +  G+ +A V    +   + T       P +L    +PAL   I +   PES R+LL ++N   +A   ++KL+    S+++  ++ + E +  +  + +         +  +L   I R+ LV+   LQ+  QL GIN + Y++ ++F+K     ++  ++ T     +N   + V+  L+++ GRR L LI L G+  S +++ + L L++
Sbjct:  135 LSTGFVPMYVGEVAPTALRGALGTLHQLGIVVGILVAQVFGLDVIMGNAT-----MWPFLLGFTFIPALAQCILLPMCPESPRYLLINRNEESKAKAALKKLRGT--SDVSADMQEMKEESRQMMREKKVT-------IPELLRSSIYRQPLVIAVMLQLSQQLSGINAVFYFSTAIFEK---AGVEQPVYATIGAGVVNTAFTVVSLFLVERAGRRSLHLIGLLGMAGSAILMTIALALLN 359          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002434.1 (pep scaffold:Pmarinus_7.0:GL479978:1522:11010:-1 gene:ENSPMAG00000002223.1 transcript:ENSPMAT00000002434.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 3.121e-16
Identity = 35/99 (35.35%), Postives = 58/99 (58.59%), Query Frame = 2
Query:  614 FILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA 910
            ++L +++     R+ LV+GC LQM  QL GIN +MYY+ ++ Q     +    +W      F N I S +   L++++GRR+L+LIS+ G I SL ++ 
Sbjct:    2 WVLWKMIKHPPTRRALVVGCGLQMFQQLAGINTVMYYSATILQMAGVADDSTAIWLASATAFTNFIFSALGVWLVERVGRRQLSLISMAGAIVSLALLG 100          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Sea Lamprey
Match: SLC2A9 (solute carrier family 2 member 9 [Source:HGNC Symbol;Acc:HGNC:13446])

HSP 1 Score: 63.5438 bits (153), Expect = 4.111e-11
Identity = 66/246 (26.83%), Postives = 119/246 (48.37%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRW-LLSKNRIDEAIEVVRKL--KQIPESNITEF-VENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLF-QKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFG---IIFSLVIIAVNLQ 922
            IS +  P+Y+AEI+PK +RG    +  I +  G+F   V+N        +  S     I+     VP L  L  +  +PES R+ LL +  +  A + +++L  +Q  +  + E   E I +A++ +              L  +L ++  R  ++         QL G+N + +YA+S+F Q  +   I  Y+  +   T   ++++ ++   I+K+GRR L LI  FG   +IF ++ +A+NLQ
Sbjct:   97 ISLSVLPMYLAEISPKNLRGSTGQVSAIFICLGVFTGQVLNLKEVLGQESHWS-----ILFGILVVPPLVQLATLPFMPESPRYLLLERQDVKAAEKALQRLLGRQDVQREMVEIQAEGIAQAHISVMS------------LWGLLRERAVRWQVITVAITMACYQLCGVNAIWFYASSIFRQAGIDPAITPYIIISTGGT--EVLAALLSGLAIEKLGRRSL-LIVGFGAMAVIFGVLTVALNLQ 322          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006105.1 (pep scaffold:Pmarinus_7.0:GL483550:10411:12132:-1 gene:ENSPMAG00000005515.1 transcript:ENSPMAT00000006105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 8.530e-9
Identity = 32/111 (28.83%), Postives = 49/111 (44.14%), Query Frame = 3
Query: 1095 CNPSTININWILLL---GMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVT----MTVFPIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
               ST ++ W+ L    G+      F++G GPIPW+V SE++P   R     +    NW   F VT      V  +G    FW +++    G  L     PE    ++E+I
Sbjct:   47 AGASTGSLGWLALASMAGLHRRCGRFSLGWGPIPWIVMSEVFPVRWRGVASGVCVAVNWISAFVVTKPTSAAVEWLGFPGAFWFFASVCAAGFVLTIVALPETKGRSLEQI 157          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Yeast
Match: ITR1 (Myo-inositol transporter; member of the sugar transporter superfamily; expression is repressed by inositol and choline via Opi1p and derepressed via Ino2p and Ino4p; relative distribution to the vacuole increases upon DNA replication stress; ITR1 has a paralog, ITR2, that arose from the whole genome duplication [Source:SGD;Acc:S000002905])

HSP 1 Score: 90.5077 bits (223), Expect = 7.495e-20
Identity = 70/245 (28.57%), Postives = 118/245 (48.16%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVV-RKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRY 940
            I S   PL+I+EI PK+IRGR+  I  + LT G  +A    A LNY +   R      I++    +P       +  +P++ R+ + K  +  A EV+ R      E  I   VE ++  N  I      +K          +   +  + L++GC LQ + Q  G N LMY++ ++F+   T   K     + +++  N I + VA+  IDKIGRR + LI L G+  +LV+ ++    + +++
Sbjct:  195 IGSLIAPLFISEIAPKMIRGRLTVINSLWLTGGQLVAYGCGAGLNYVNNGWR------ILVGLSLIPTAVQFTCLCFLPDTPRYYVMKGDLARATEVLKRSYTDTSEEIIERKVEELVTLNQSIPGKNVPEKVWNTIKELHTVPSNL--RALIIGCGLQAIQQFTGWNSLMYFSGTIFE---TVGFKNSSAVSIIVSGTNFIFTLVAFFSIDKIGRRTILLIGLPGMTMALVVCSIAFHFLGIKF 428          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Yeast
Match: HXT13 (Putative transmembrane polyol transporter; supports growth on and uptake of mannitol and sorbitol with moderate affinity when overexpressed in a strain deleted for hexose family members; minor hexose transport activity when overexpressed in a similar strain; induced by non-fermentable carbon sources; induced in low glucose, repressed in high glucose; HXT13 has a paralog, HXT17, that arose from a segmental duplication [Source:SGD;Acc:S000000795])

HSP 1 Score: 87.8113 bits (216), Expect = 6.103e-19
Identity = 71/237 (29.96%), Postives = 123/237 (51.90%), Query Frame = 2
Query:  215 STCCPLYIAEITPKVIRGRIITIYQICLTFGLFLA-SVVNATLNYASPTD-RSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQI-PESNITEFVENILEANVLIXXXXXXXXXXXXF-ILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKY-VTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA 910
            S  CP+ ++EI P  +RG ++++YQ+ +TFG+FL    V  T  Y +    R P  +  +       AL ++IGML VPES R+L+   R +EA   + K+ ++ PE        + + A VL + +L E   ++ F +  ++L      + L+ G  +Q   QL G N   +Y  ++F+   +T+  +  +    +L  +N  S+ +A  ++DKIGRRK  L    G++  +VI A
Sbjct:  178 SVLCPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLW------ALIIIIGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEINAGVLAQRELGEASWKELFSVKTKVL------QRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSI----VLGTVNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFA 398          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Yeast
Match: HXT5 (Hexose transporter with moderate affinity for glucose; induced in the presence of non-fermentable carbon sources, induced by a decrease in growth rate, contains an extended N-terminal domain relative to other HXTs; HXT5 has a paralog, HXT3, that arose from the whole genome duplication [Source:SGD;Acc:S000001138])

HSP 1 Score: 87.8113 bits (216), Expect = 7.090e-19
Identity = 68/236 (28.81%), Postives = 119/236 (50.42%), Query Frame = 2
Query:  227 PLYIAEITPKVIRGRIITIYQICLTFGLFLASVVN-ATLNYASPTD-RSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESN--ITEFVENI---LEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKY-VTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA 910
            P+ I+E++PK +RG +++ YQ+ +TFG+FL    N  T NY++    R P  +          ++F+++GM  VPES R+L+   +I+EA   + +  +  E +  +T  +EN    +EA  L       +    K         ++ R+TL MG  +Q L QL G N   YY  ++FQ   + ++ +  +    +L  +N +S+F +   +D+ GRR   L    G+I   V+ A
Sbjct:  210 PMLISEVSPKQLRGTLVSCYQLMITFGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAW------SIFMIVGMTFVPESPRYLVEVGKIEEAKRSLARANKTTEDSPLVTLEMENYQSSIEAERLAGSASWGELVTGK--------PQMFRRTL-MGMMIQSLQQLTGDNYFFYYGTTIFQAVGLEDSFETAI----VLGVVNFVSTFFSLYTVDRFGRRNCLLWGCVGMICCYVVYA 426          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Yeast
Match: ITR2 (Myo-inositol transporter; member of the sugar transporter superfamily; expressed constitutively; ITR2 has a paralog, ITR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005463])

HSP 1 Score: 87.4261 bits (215), Expect = 8.004e-19
Identity = 76/280 (27.14%), Postives = 129/280 (46.07%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDR---SPKTMPIIL------ITPAVPALFLLIGMLTVPE---SYRWLLSKNR-IDEAIEVVRKLKQ-IPESN-ITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSY 1003
            I S   PL+I+EI PK+IRGR+  I  + LT G  +A    A LN+     R       +P +L        P  P  +++ G L   +      ++ +++  ID+ +E +  L Q IP  N IT+F   + E + +                          + L++GC LQ + Q  G N LMY++ ++F+   T   K     + +++  N + + +A+  IDKIGRR + LI L G+  +LVI A+    + +++      N  D  +A D + S+
Sbjct:  218 IGSLISPLFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHVKNGWRILVGLSLIPTVLQFSFFCFLPDTPRYYVMKGDLKRAKMVLKRSYVNTEDEIIDQKVEELSSLNQSIPGKNPITKFWNMVKELHTVPSNF----------------------RALIIGCGLQAIQQFTGWNSLMYFSGTIFE---TVGFKNSSAVSIIVSGTNFVFTLIAFFCIDKIGRRYILLIGLPGMTVALVICAIAFHFLGIKF------NGADAVVASDGFSSW 466          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Yeast
Match: HXT3 (Low affinity glucose transporter of the major facilitator superfamily; expression is induced in low or high glucose conditions; HXT3 has a paralog, HXT5, that arose from the whole genome duplication [Source:SGD;Acc:S000002753])

HSP 1 Score: 87.0409 bits (214), Expect = 9.514e-19
Identity = 66/233 (28.33%), Postives = 109/233 (46.78%), Query Frame = 2
Query:  227 PLYIAEITPKVIRGRIITIYQICLTFGLFLASVVN-ATLNYASPTD-RSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQI-PESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTF--INLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIA 910
            P+ I+E+ PK +RG +++ YQ+ +T G+FL    N  T NY++    R P  +          ALF++ GM  VPES R+L+   +IDEA   + K+ ++ P+    +    ++EA+V            + F      G     K  +MG  +Q L QL G N   YY  ++F     N + +   F   + F  +N  S+  +   +D+ GRR   L    G++   V+ A
Sbjct:  186 PMLISEVAPKEMRGTLVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAW------ALFMIGGMTFVPESPRYLVEAGQIDEARASLSKVNKVAPDHPFIQQELEVIEASVEEARAAGSASWGELFT-----GKPAMFKRTMMGIMIQSLQQLTGDNYFFYYGTTVF-----NAVGMSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLLYGAIGMVCCYVVYA 402          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Nematostella
Match: EDO46902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNS4])

HSP 1 Score: 119.783 bits (299), Expect = 4.151e-29
Identity = 91/284 (32.04%), Postives = 143/284 (50.35%), Query Frame = 2
Query:  212 SSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNI-------CDNFLACDDWVSY-HCEYCQIDENSG 1039
            +S   P+Y+AE  P  +RG+++T+  + +T G F+ASVV+    Y    DR       +L   AVP++ +  G + +PES RWL+SK +  EA   + K++   +      V+  LEA  +      E+KE+   +L RIL     R+ L++GC LQ + QL GIN +MYY+ ++       N K  +W    + F N + + V   L+++IGRRKL L SL G+I SL ++     L      K +           C N   C D V+  +C YC   ++ G
Sbjct:  112 ASMTVPIYVAEAAPSSMRGKLVTLNNLFITGGQFIASVVDGIFAY----DRQ-NGWRFMLGLAAVPSIIMFFGCVILPESPRWLISKCKYAEARAALCKIRGRTD------VDRELEA--VRRTCKVERKERSGQVLIRILRFPNTRRALLVGCMLQAIQQLCGINTVMYYSATIILMSGIGNSKTSIWLAAAIAFGNTLFTIVGIFLVERIGRRKLLLGSLAGVILSLFLLGGAFYLAMQHNPKVSTAETINPVFTHCTNQTTCMDCVNVRNCGYCYSTDSDG 382          

HSP 2 Score: 77.7962 bits (190), Expect = 2.281e-15
Identity = 37/99 (37.37%), Postives = 55/99 (55.56%), Query Frame = 3
Query: 1122 WILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYET----FWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            W+  LG+++Y+ +FA GMGP+PW + SE+YP W RST  A ST  NW  N  ++MT   +  + T    FW+Y    + G    +   PE     +EE+
Sbjct:  424 WMAFLGLVIYIATFAPGMGPMPWTLNSEMYPLWARSTGNACSTAVNWICNLVISMTFLSLMGWITRPGAFWLYGCIAVAGWVFFFVFVPETKGKTLEEL 522          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Nematostella
Match: EDO32615 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUJ6])

HSP 1 Score: 70.0922 bits (170), Expect = 5.478e-13
Identity = 40/119 (33.61%), Postives = 63/119 (52.94%), Query Frame = 3
Query: 1074 TCSIYEFC----NPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPI--GLYE--TFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            TC++Y F       + ++I W+ +  + +Y++ FA+G GP  W++ SEI+P   R T   ++T  NWF +F VT T   +  GL E  TF  + AF    +  +Y   PE     +EEI
Sbjct:  315 TCAVYFFITVNFGMTEVDIAWLSVTSVAVYIVGFALGWGPCTWLIMSEIFPVRARGTATGIATFFNWFCSFVVTKTFSALIDGLTEAGTFCFFGAFVFASVLFVYFFVPETKGKTLEEI 433          

HSP 2 Score: 56.225 bits (134), Expect = 1.617e-8
Identity = 60/255 (23.53%), Postives = 114/255 (44.71%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNI-TEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAV--------NLQLVDVRYLK 946
            ++S   P+YI+E      RG + +I Q+ +T G+ ++  +    ++               +  + PA  L++ M  +PE+ RWL++K +   A + +  L+  P+ +I  E  E  ++A++          + ++F L       + R  L+   SL    Q  GIN  M+Y  ++FQK      K       L+  +  ++S ++  LID+ GRR L +++  G+  S    AV         +  VD+ +L 
Sbjct:  109 MASLNVPVYISETASFSNRGAMGSINQLGITAGILISYAIGYAFDWRWSA-----------VAGSFPAALLVVLMAFMPETARWLIAKKKETRARKTLLWLRG-PDYDIDKELCE--IKASI--------DTQNQRFSLKEFKNPSLLRPFLI-SMSLHFFQQFSGINAFMFYCATIFQK---AGFKDPTGVPILIGAVQFVASAISLALIDRGGRRFLLIVAGVGMSISCFTCAVYFFITVNFGMTEVDIAWLS 337          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Nematostella
Match: EDO35120 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMF8])

HSP 1 Score: 68.1662 bits (165), Expect = 3.085e-12
Identity = 56/226 (24.78%), Postives = 114/226 (50.44%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGI 886
            +++   P+Y++E+ P  +RG + T+ Q  +  GL +  +    L     T    K    +L    +PA+F L+ +   P S R+LL +  +D+ ++ V  L+++  ++  +  E+I E  +  + +   +      +  R    +  +  L++GC + M  QL GIN ++YY+ S+F+K      ++    T  +  + L+ + +A +L++ +GRR L LI L G+
Sbjct:  145 MNTAIAPIYLSELAPIHLRGSLGTLNQFGIVSGLLVGFIFG--LKQVLGTS---KGWQYLLGFSILPAVFQLVTLPWCPNSPRYLLIE--LDQELQAVEALRKLRATD--DVTEDINEMKIERDREATTEHVSVLQLFVR----RDLQMPLLIGCVMMMAQQLGGINAVLYYSTSIFEKVGVPESRVA---TTGIGVVALVFTAIAVRLVEVLGRRTLMLIGLGGM 354          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Nematostella
Match: EDO42861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E6])

HSP 1 Score: 63.1586 bits (152), Expect = 1.155e-10
Identity = 31/102 (30.39%), Postives = 52/102 (50.98%), Query Frame = 3
Query: 1113 NINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVF----PIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
             I+W+ +  ++++ + FA+  GP+PW+V SEI+P   R    ++ST  NW   F+VT T       I +  T+W Y   +  G   +    PE     +E+I
Sbjct:  350 KISWLAITSIVVFNLVFALAWGPVPWLVMSEIFPLQARGIASSISTLCNWSLAFAVTKTFVNIEDAITIQGTYWFYGGLSFLGFLFVLMFVPETKGKTLEQI 451          

HSP 2 Score: 62.7734 bits (151), Expect = 1.211e-10
Identity = 57/249 (22.89%), Postives = 110/249 (44.18%), Query Frame = 2
Query:  215 STCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNN 961
            S   P+YIAEI+   +RG + ++ Q+ +T GL LA  +   L +             +  + A+    L++ M  VPE+ RW LS  R  +A++ +   +  PE+++ E    I EA +          +  + + C         K L +  +L    Q  GIN +++ + S+F +    + K     + ++  +  + + +A  ++DK GR+ L   +  G+  SL+ +    +L    Y+   Q  
Sbjct:  113 SLTVPVYIAEISSPSLRGMLGSVNQLAVTMGLLLAYSMGVVLKWR-----------WLACSGAIFPALLVVLMFFVPETPRWSLSHKRRRDALDAMMWFRG-PEADVEEECYRI-EATM----------DNTQSMSCAEFCRPAIMKPLFISIALMFFQQFCGINAILFNSASIFHQAGFQDSKAV---SVIIGAVQFVGTGIACLVVDKAGRKLLLWTTALGMTVSLIALGFYFEL----YIPTTQEQ 331          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Nematostella
Match: EDO42667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0Y9])

HSP 1 Score: 52.373 bits (124), Expect = 2.584e-7
Identity = 59/256 (23.05%), Postives = 116/256 (45.31%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRID----EAIEVVRKLKQIPESNITEF----VENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQ-------KYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFG--IIFSLVIIAVNLQL 925
            +++   P+Y++EI+P  +RG + T+ Q  + FG+ L  +        S +       P ++    VPA+  ++ +   P S R+LL K   +     A++++R    + E +I E      +++ E +V +              L R+   K  R  L++G  +QM  QL GIN ++YY+ ++         +Y T  + I    +P            +  L++ +GRR L L  L G  I++ ++ +  +L++
Sbjct:  125 LNTAVVPIYLSEISPIQLRGSLGTLNQFGICFGILLGYIFGLKEVLGSGSK-----WPWLIGFSIVPAIIQMMTLPFCPRSPRYLLLKRNKEADAVHALQILRGTNDVSE-DIAEMRIEQEQSLREPHVSVTS------------LFRL---KHLRMPLLIGVVMQMSQQLSGINSVIYYSTTILDEAHIPGSRYATLGVGI---ISP--------DKDRSGGLVEVLGRRTLMLWGLGGMCIMYGVITLGFSLKV 348          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Medaka
Match: slc2a13b (proton myo-inositol cotransporter [Source:NCBI gene;Acc:101158939])

HSP 1 Score: 135.191 bits (339), Expect = 9.177e-34
Identity = 87/283 (30.74%), Postives = 148/283 (52.30%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV-----DVRYLKRNQNNICDNFLACDDWVSYHCEYCQIDENSGY 1042
            I+S   P+YIAE++P  +RG+++T+  + +T G F+AS+V+   +Y S           +L    +PA+   +G + +PES RWLL K +  EA++V+R ++   + N+ E  ++I +AN+   E+ +++      +L R+L     R+ L++GC LQM  QL GIN +MYY+ ++ Q     + K  +W     +  N + + V   L++++GRRKL L SL G   SL ++AV   L       V     + NN               CE C +D + G+
Sbjct:  141 IASMTVPVYIAEVSPPHLRGQLVTVNALFITGGQFIASMVDGAFSYLSE-----DGWRYMLGLSVLPAVLQFLGFIFLPESPRWLLQKGQNQEALQVLRWIRG--DQNVEEEYDSI-KANI---EEEEKEVGAGGVVLLRMLSHGPTRRALIVGCGLQMFQQLSGINTVMYYSATILQMAGVRDDKEAIWLAAATSATNFVFTLVGVWLVERVGRRKLTLGSLLGTGLSLALLAVGFLLSAQSSPPVTLHPVDPNNSTYRLYGS-------CEPCMLDPDCGF 405          

HSP 2 Score: 77.7962 bits (190), Expect = 7.864e-15
Identity = 41/86 (47.67%), Postives = 52/86 (60.47%), Query Frame = 3
Query: 1086 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYETFWIYSAFTL 1343
            Y +C  S    +WI+L+G+ LY+  FA GMGP+PW V SEIYP W RST  A S   NW FN  V++T   +  Y T+  Y AF L
Sbjct:  449 YNYCPTS---YSWIVLMGLFLYLAFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGVNWIFNVLVSLTFLHVAEYLTY--YGAFFL 529          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Medaka
Match: slc2a13b (proton myo-inositol cotransporter [Source:NCBI gene;Acc:101158939])

HSP 1 Score: 135.191 bits (339), Expect = 1.018e-33
Identity = 87/283 (30.74%), Postives = 148/283 (52.30%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV-----DVRYLKRNQNNICDNFLACDDWVSYHCEYCQIDENSGY 1042
            I+S   P+YIAE++P  +RG+++T+  + +T G F+AS+V+   +Y S           +L    +PA+   +G + +PES RWLL K +  EA++V+R ++   + N+ E  ++I +AN+   E+ +++      +L R+L     R+ L++GC LQM  QL GIN +MYY+ ++ Q     + K  +W     +  N + + V   L++++GRRKL L SL G   SL ++AV   L       V     + NN               CE C +D + G+
Sbjct:  141 IASMTVPVYIAEVSPPHLRGQLVTVNALFITGGQFIASMVDGAFSYLSEDGWR-----YMLGLSVLPAVLQFLGFIFLPESPRWLLQKGQNQEALQVLRWIRG--DQNVEEEYDSI-KANI---EEEEKEVGAGGVVLLRMLSHGPTRRALIVGCGLQMFQQLSGINTVMYYSATILQMAGVRDDKEAIWLAAATSATNFVFTLVGVWLVERVGRRKLTLGSLLGTGLSLALLAVGFLLSAQSSPPVTLHPVDPNNSTYRLYG-------SCEPCMLDPDCGF 405          

HSP 2 Score: 77.7962 bits (190), Expect = 9.007e-15
Identity = 41/86 (47.67%), Postives = 52/86 (60.47%), Query Frame = 3
Query: 1086 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYETFWIYSAFTL 1343
            Y +C  S    +WI+L+G+ LY+  FA GMGP+PW V SEIYP W RST  A S   NW FN  V++T   +  Y T+  Y AF L
Sbjct:  449 YNYCPTS---YSWIVLMGLFLYLAFFAPGMGPMPWTVNSEIYPLWARSTGNACSAGVNWIFNVLVSLTFLHVAEYLTY--YGAFFL 529          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Medaka
Match: SLC2A13 (solute carrier family 2 member 13 [Source:NCBI gene;Acc:101157657])

HSP 1 Score: 110.153 bits (274), Expect = 1.054e-25
Identity = 78/273 (28.57%), Postives = 139/273 (50.92%), Query Frame = 2
Query:  227 PLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSYH-CEYCQIDENSGY 1042
            P+YIAE +P  +RG+++T+  + +T G F AS+++   +Y             +L    +PA+   +G L +PES RWL+ +    +A  V+ +++     NI E  ++I  +     E+ ++       ++ R+L     R+ L++GC LQM  QL GIN +MYY+ ++ Q     + ++ +W   L T  N + + +   L++K+GRRKL L S+ G   SL ++AV   L+  ++         D  +A      Y  CE C +D + G+
Sbjct:    4 PVYIAEASPPHLRGQLVTVNTLFITGGQFTASLIDGAFSYLQH-----DGWRYMLGLSVIPAVLQFLGFLFLPESPRWLIQRGLTQKARRVLSQIRG--NQNIDEEYDSIKNS----IEEEEKDSGGDGPVVWRMLTYPPTRRALLVGCGLQMFQQLSGINTVMYYSATILQMSGVRDDRLAIWLAGLATLTNFLFTLLGVWLVEKVGRRKLTLGSILGTTLSLSLLAVGF-LMSAQHSPPVTFRPLDPAMANSTCSKYRLCEPCMLDPSCGF 264          

HSP 2 Score: 89.7373 bits (221), Expect = 7.592e-19
Identity = 45/111 (40.54%), Postives = 63/111 (56.76%), Query Frame = 3
Query: 1086 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYET----FWIYSAFTLCGIALIYRNFPEMNQANMEEI 1406
            Y +C  S     W++LLG+++Y  +FA GMGP+PW + SEIYP W RST  A +   NW FN  V++T   +  Y T    F++YS+  L G   +Y   PE     +EEI
Sbjct:  308 YNYCPTSYF---WLVLLGLVMYFAAFAPGMGPMPWTINSEIYPLWARSTGNACAAGVNWTFNILVSVTFLHLAQYLTYYGVFFLYSSLALLGFVFVYGCLPETKARRLEEI 415          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Medaka
Match: SLC2A13 (solute carrier family 2 member 13 [Source:NCBI gene;Acc:101157657])

HSP 1 Score: 110.923 bits (276), Expect = 1.816e-25
Identity = 78/273 (28.57%), Postives = 139/273 (50.92%), Query Frame = 2
Query:  227 PLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSYH-CEYCQIDENSGY 1042
            P+YIAE +P  +RG+++T+  + +T G F AS+++   +Y             +L    +PA+   +G L +PES RWL+ +    +A  V+ +++     NI E  ++I  +     E+ ++       ++ R+L     R+ L++GC LQM  QL GIN +MYY+ ++ Q     + ++ +W   L T  N + + +   L++K+GRRKL L S+ G   SL ++AV   L+  ++         D  +A      Y  CE C +D + G+
Sbjct:  196 PVYIAEASPPHLRGQLVTVNTLFITGGQFTASLIDGAFSYLQHDG-----WRYMLGLSVIPAVLQFLGFLFLPESPRWLIQRGLTQKARRVLSQIRG--NQNIDEEYDSIKNS----IEEEEKDSGGDGPVVWRMLTYPPTRRALLVGCGLQMFQQLSGINTVMYYSATILQMSGVRDDRLAIWLAGLATLTNFLFTLLGVWLVEKVGRRKLTLGSILGTTLSLSLLAVGF-LMSAQHSPPVTFRPLDPAMANSTCSKYRLCEPCMLDPSCGF 456          

HSP 2 Score: 73.9442 bits (180), Expect = 1.534e-13
Identity = 34/79 (43.04%), Postives = 49/79 (62.03%), Query Frame = 3
Query: 1086 YEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYETFW 1322
            Y +C  S     W++LLG+++Y  +FA GMGP+PW + SEIYP W RST  A +   NW FN  V++T   +  Y T++
Sbjct:  500 YNYCPTSYF---WLVLLGLVMYFAAFAPGMGPMPWTINSEIYPLWARSTGNACAAGVNWTFNILVSVTFLHLAQYLTYY 575          
BLAST of Proton myo-inositol cotransporter vs. Ensembl Medaka
Match: slc2a1a (solute carrier family 2, facilitated glucose transporter member 1-like [Source:NCBI gene;Acc:101161039])

HSP 1 Score: 79.337 bits (194), Expect = 1.881e-15
Identity = 61/247 (24.70%), Postives = 124/247 (50.20%), Query Frame = 2
Query:  200 HFRISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASV--VNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLL-SKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVD 931
            H  +S+   P+Y+ EI+P  +RG + T++Q+ +  G+ +A +  + + +  AS         P++L    VPA+   + +   PES R+LL ++N   +A  V+ KL+   E  ++E ++ + E +  +  + +         +  +    + R+ +++   LQ+  QL GIN + YY+  +F++     +   ++ T     +N   + V+  ++++ GRR L LI L G+  S V + V + L D
Sbjct:  120 HSGLSTGFVPMYVEEISPTSLRGAMGTLHQLGVVIGILVAQIFGLESIMGNAS-------LWPLLLGFTLVPAILQCVLLPFCPESPRYLLINRNEESKACSVLMKLRGTDE--VSEDIQEMREESQKMMREKKVT-------IAELFRSPVYRQPMIVAIMLQLSQQLSGINAVFYYSTGIFER---AGVAQPVYATIGAGVVNTAFTVVSLFVVERTGRRPLHLIGLMGMAVSAVFLTVAMALQD 347          
BLAST of Proton myo-inositol cotransporter vs. Planmine SMEST
Match: SMESG000056331.1 (SMESG000056331.1)

HSP 1 Score: 314.694 bits (805), Expect = 2.103e-127
Identity = 175/283 (61.84%), Postives = 222/283 (78.45%), Query Frame = 2
Query:  218 TCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSYHCEYCQIDENSGYTCVNYGAN 1066
            TCCPLYIAE+TPK+IRGR+IT+YQ+ +TFG+ LAS+V A++       R  ++  I+L TP +PA+ +LIGMLTV ESYRWLL+KNR DEA EV+RKLKQ+ ES+I EFV+ ILEAN++IEE+  +++    F+L RIL +KIARK+L+ GC +Q++ Q+ GIN ++Y +  LFQ +   + +  LWF  L+ F N I SFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV VR L  NQNN C NFL+CDD ++ +CEYCQIDE+SGYTCVN GAN
Sbjct:  124 TCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASIC------RKDESYIIVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKR----FMLFRILRNKIARKSLLFGCYIQIIGQIAGINAILYNSPLLFQYFNNMSYERALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRL--NQNNNCSNFLSCDDCINNYCEYCQIDESSGYTCVNSGAN 394          

HSP 2 Score: 161.77 bits (408), Expect = 2.103e-127
Identity = 81/117 (69.23%), Postives = 89/117 (76.07%), Query Frame = 3
Query: 1068 NGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEILHVL 1418
             G  SIY F NP T  INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALST A W  N   T+  F    Y  FWIY AFT+CGIALIY+ FPE NQ ++E++ +VL
Sbjct:  398 KGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNLIFTLIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVL 514          

HSP 3 Score: 65.855 bits (159), Expect = 3.000e-11
Identity = 28/45 (62.22%), Postives = 37/45 (82.22%), Query Frame = 3
Query:   51 MNFEYSIDSLFDAGNIEVLYTNQFIHYITFPIIGGFMFGYVTETV 185
            MNF+ S+DSL+D   IEV +T Q+IH+I FP+IGGFMFG+VT +V
Sbjct:    1 MNFDISLDSLYDINKIEVYFTRQYIHHIIFPMIGGFMFGHVTGSV 45          
BLAST of Proton myo-inositol cotransporter vs. Planmine SMEST
Match: SMESG000056331.1 (SMESG000056331.1)

HSP 1 Score: 314.309 bits (804), Expect = 2.403e-127
Identity = 175/283 (61.84%), Postives = 222/283 (78.45%), Query Frame = 2
Query:  218 TCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPKTMPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLIXXXXXXXXXXXXFILCRILGDKIARKTLVMGCSLQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNFLACDDWVSYHCEYCQIDENSGYTCVNYGAN 1066
            TCCPLYIAE+TPK+IRGR+IT+YQ+ +TFG+ LAS+V A++       R  ++  I+L TP +PA+ +LIGMLTV ESYRWLL+KNR DEA EV+RKLKQ+ ES+I EFV+ ILEAN++IEE+  +++    F+L RIL +KIARK+L+ GC +Q++ Q+ GIN ++Y +  LFQ +   + +  LWF  L+ F N I SFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLV VR L  NQNN C NFL+CDD ++ +CEYCQIDE+SGYTCVN GAN
Sbjct:   93 TCCPLYIAEMTPKLIRGRVITLYQVSITFGILLASIVKASI------CRKDESYIIVLTTPLIPAIIVLIGMLTVSESYRWLLTKNRKDEAKEVIRKLKQLQESSIEEFVKIILEANIVIEEENSQKR----FMLFRILRNKIARKSLLFGCYIQIIGQIAGINAILYNSPLLFQYFNNMSYERALWFGSLIYFFNFIPSFVAYKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVYVRRL--NQNNNCSNFLSCDDCINNYCEYCQIDESSGYTCVNSGAN 363          

HSP 2 Score: 161.384 bits (407), Expect = 2.403e-127
Identity = 81/117 (69.23%), Postives = 89/117 (76.07%), Query Frame = 3
Query: 1068 NGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEILHVL 1418
             G  SIY F NP T  INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALST A W  N   T+  F    Y  FWIY AFT+CGIALIY+ FPE NQ ++E++ +VL
Sbjct:  367 KGNYSIYNFDNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTGAMWLCNLIFTLIFFSRIFYAIFWIYCAFTICGIALIYKYFPETNQIDLEKMNYVL 483          
BLAST of Proton myo-inositol cotransporter vs. Planmine SMEST
Match: SMESG000056325.1 (SMESG000056325.1)

HSP 1 Score: 221.476 bits (563), Expect = 6.070e-69
Identity = 108/117 (92.31%), Postives = 108/117 (92.31%), Query Frame = 3
Query: 1068 NGTCSIYEFCNPSTININWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFPIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEILHVL 1418
             G  SIY F NP T  INWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVF IGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEILHVL
Sbjct:  139 KGNYSIYNFHNPCTNYINWILLLGMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTMTVFAIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEILHVL 255          

HSP 2 Score: 99.7525 bits (247), Expect = 1.599e-23
Identity = 49/49 (100.00%), Postives = 49/49 (100.00%), Query Frame = 2
Query:  431 MLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLI 577
            MLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLI
Sbjct:    1 MLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLI 49          
BLAST of Proton myo-inositol cotransporter vs. Planmine SMEST
Match: SMESG000056326.1 (SMESG000056326.1)

HSP 1 Score: 116.701 bits (291), Expect = 1.853e-30
Identity = 55/55 (100.00%), Postives = 55/55 (100.00%), Query Frame = 2
Query:  209 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPK 373
            ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPK
Sbjct:  118 ISSTCCPLYIAEITPKVIRGRIITIYQICLTFGLFLASVVNATLNYASPTDRSPK 172          

HSP 2 Score: 99.3673 bits (246), Expect = 3.660e-24
Identity = 48/58 (82.76%), Postives = 52/58 (89.66%), Query Frame = 3
Query:   51 MNFEYSIDSLFDAGNIEVLYTNQFIHYITFPIIGGFMFGYVTETVPNVYGIFVFLLLA 224
            MNFEYSIDSLFDAGNIEVLYTNQFIHYITFPIIGGFMFGYVT T+P+V G    L++A
Sbjct:    1 MNFEYSIDSLFDAGNIEVLYTNQFIHYITFPIIGGFMFGYVTGTIPDVNGTSHMLIVA 58          
BLAST of Proton myo-inositol cotransporter vs. Planmine SMEST
Match: SMESG000056221.1 (SMESG000056221.1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.442e-14
Identity = 33/64 (51.56%), Postives = 45/64 (70.31%), Query Frame = 2
Query:  386 ILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPESNITEFVENILEANVLI 577
            +L   A+P+    IGMLTVPESYRWLLSKN++DEA  ++    Q+PE  ITE+++ I+ AN  I
Sbjct:  146 MLGGAAIPSFIEFIGMLTVPESYRWLLSKNKVDEARTIIVNQGQVPEERITEYIDEIVRANQQI 209          
The following BLAST results are available for this feature:
BLAST of Proton myo-inositol cotransporter vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC2A134.469e-3429.37solute carrier family 2 member 13 [Source:HGNC Sym... [more]
SLC2A136.200e-2032.75solute carrier family 2 member 13 [Source:HGNC Sym... [more]
SLC2A13.483e-1324.38solute carrier family 2 member 1 [Source:HGNC Symb... [more]
SLC2A23.851e-1225.10solute carrier family 2 member 2 [Source:HGNC Symb... [more]
SLC2A126.906e-1233.66solute carrier family 2 member 12 [Source:HGNC Sym... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmit-1.33.823e-3128.67H(+) MyoInositol coTransporter [Source:UniProtKB/... [more]
hmit-1.33.823e-3128.67H(+) MyoInositol coTransporter [Source:UniProtKB/... [more]
hmit-1.25.111e-2526.09H(+) MyoInositol coTransporter [Source:UniProtKB/... [more]
hmit-1.19.340e-2326.90H(+) MyoInositol coTransporter [Source:UniProtKB/... [more]
fgt-13.727e-924.73Facilitated glucose transporter protein 1 [Source... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG64845.134e-2027.78gene:FBgn0034247 transcript:FBtr0086903[more]
Glut14.433e-1429.49gene:FBgn0264574 transcript:FBtr0333504[more]
Glut15.097e-1429.49gene:FBgn0264574 transcript:FBtr0333508[more]
Glut15.637e-1429.49gene:FBgn0264574 transcript:FBtr0333509[more]
Glut15.832e-1429.49gene:FBgn0264574 transcript:FBtr0333507[more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc2a13b3.255e-3530.61solute carrier family 2 member 13b [Source:ZFIN;Ac... [more]
slc2a3b6.757e-2124.24solute carrier family 2 member 3b [Source:ZFIN;Acc... [more]
slc2a3b6.757e-2124.24solute carrier family 2 member 3b [Source:ZFIN;Acc... [more]
slc2a1b7.409e-2122.56solute carrier family 2 member 1b [Source:ZFIN;Acc... [more]
slc2a3b4.764e-2024.23solute carrier family 2 member 3b [Source:ZFIN;Acc... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
phf21b2.696e-4729.02PHD finger protein 21B [Source:Xenbase;Acc:XB-GENE... [more]
phf21b1.006e-4329.02PHD finger protein 21B [Source:Xenbase;Acc:XB-GENE... [more]
slc2a101.788e-1442.57solute carrier family 2 (facilitated glucose trans... [more]
slc2a101.805e-1442.57solute carrier family 2 (facilitated glucose trans... [more]
slc2a101.818e-1442.57solute carrier family 2 (facilitated glucose trans... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc2a131.548e-5331.12solute carrier family 2 (facilitated glucose trans... [more]
Slc2a21.505e-1628.28solute carrier family 2 (facilitated glucose trans... [more]
Slc2a12.328e-1324.38solute carrier family 2 (facilitated glucose trans... [more]
Slc2a121.236e-1235.00solute carrier family 2 (facilitated glucose trans... [more]
Slc2a102.342e-1136.36solute carrier family 2 (facilitated glucose trans... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3UHK1|MYCT_MOUSE9.315e-5331.12Proton myo-inositol cotransporter OS=Mus musculus ... [more]
sp|Q9ZQP6|INT3_ARATH1.372e-3426.91Probable inositol transporter 3 OS=Arabidopsis tha... [more]
sp|Q96QE2|MYCT_HUMAN2.146e-3329.37Proton myo-inositol cotransporter OS=Homo sapiens ... [more]
sp|Q921A2|MYCT_RAT2.413e-3330.77Proton myo-inositol cotransporter OS=Rattus norveg... [more]
sp|Q8VZR6|INT1_ARATH9.557e-2531.22Inositol transporter 1 OS=Arabidopsis thaliana OX=... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJX47.892e-3294.76Slc2a-9 (Fragment) OS=Schmidtea mediterranea OX=79... [more]
A0A0H3YIU73.835e-5941.45Slc2a-10 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
L7MH301.241e-5032.89Putative proton myo-inositol cotransporter (Fragme... [more]
R7U3K51.295e-5029.97MFS domain-containing protein OS=Capitella teleta ... [more]
L7MDM91.477e-5032.89Putative proton myo-inositol cotransporter (Fragme... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC2A131.545e-3231.54solute carrier family 2 member 13 [Source:NCBI gen... [more]
slc2a13b4.780e-3131.93solute carrier family 2 member 13b [Source:ZFIN;Ac... [more]
slc2a3b3.732e-2022.99solute carrier family 2, facilitated glucose trans... [more]
slc2a3b6.454e-2022.99solute carrier family 2, facilitated glucose trans... [more]
slc2a1b2.200e-1525.21solute carrier family 2, facilitated glucose trans... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002434.13.121e-1635.35pep scaffold:Pmarinus_7.0:GL479978:1522:11010:-1 g... [more]
SLC2A94.111e-1126.83solute carrier family 2 member 9 [Source:HGNC Symb... [more]
ENSPMAT00000006105.18.530e-928.83pep scaffold:Pmarinus_7.0:GL483550:10411:12132:-1 ... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ITR17.495e-2028.57Myo-inositol transporter; member of the sugar tran... [more]
HXT136.103e-1929.96Putative transmembrane polyol transporter; support... [more]
HXT57.090e-1928.81Hexose transporter with moderate affinity for gluc... [more]
ITR28.004e-1927.14Myo-inositol transporter; member of the sugar tran... [more]
HXT39.514e-1928.33Low affinity glucose transporter of the major faci... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO469024.151e-2932.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326155.478e-1333.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351203.085e-1224.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428611.155e-1030.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426672.584e-723.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc2a13b9.177e-3430.74proton myo-inositol cotransporter [Source:NCBI gen... [more]
slc2a13b1.018e-3330.74proton myo-inositol cotransporter [Source:NCBI gen... [more]
SLC2A131.054e-2528.57solute carrier family 2 member 13 [Source:NCBI gen... [more]
SLC2A131.816e-2528.57solute carrier family 2 member 13 [Source:NCBI gen... [more]
slc2a1a1.881e-1524.70solute carrier family 2, facilitated glucose trans... [more]
back to top
BLAST of Proton myo-inositol cotransporter vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056331.12.103e-12761.84SMESG000056331.1[more]
SMESG000056331.12.403e-12761.84SMESG000056331.1[more]
SMESG000056325.16.070e-6992.31SMESG000056325.1[more]
SMESG000056326.11.853e-30100.00SMESG000056326.1[more]
SMESG000056221.13.442e-1451.56SMESG000056221.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017038 ID=SMED30017038|Name=Proton myo-inositol cotransporter|organism=Schmidtea mediterranea sexual|type=transcript|length=1477bp
CAGAGTTCATTGTAATTTTAAATTTCATATTTATTTGTAGTTTTAATTTA
ATGAATTTCGAATACAGTATAGATAGTCTATTTGACGCTGGTAACATTGA
AGTGCTTTACACTAACCAATTTATCCATTATATTACTTTCCCTATAATTG
GCGGGTTTATGTTTGGCTATGTCACTGAAACCGTTCCAAACGTCTATGGC
ATTTTCGTATTTCTTCTACTTGCTGTCCACTTTACATCGCTGAAATAACT
CCGAAAGTTATTCGAGGTCGCATTATTACTATTTATCAAATTTGTTTAAC
ATTTGGACTGTTTCTGGCCTCGGTTGTCAATGCAACACTCAATTATGCAT
CACCCACTGATAGATCACCCAAAACAATGCCAATCATACTAATTACCCCT
GCCGTACCGGCACTTTTCCTATTGATCGGAATGCTTACGGTTCCGGAGAG
TTACAGGTGGCTGTTGTCGAAAAACAGAATCGACGAAGCGATAGAAGTAG
TTCGGAAGCTGAAACAAATTCCAGAATCGAATATTACAGAGTTTGTGGAA
AATATTTTGGAAGCTAACGTTTTGATTGAAGAGGATTTGCAAGAACAAAA
AGAACAAAAGAAATTTATTTTATGTCGAATTCTTGGCGATAAAATAGCGA
GAAAGACTCTCGTAATGGGATGTTCTCTCCAAATGCTTGCTCAGTTAATT
GGAATAAATGGGCTAATGTATTACGCGAATTCATTGTTTCAAAAGTACGT
AACTAATAATATCAAAATTTACTTGTGGTTCACTCCATTGCTTACTTTCA
TCAATTTGATATCGTCGTTTGTTGCTTATAAACTAATTGACAAAATTGGA
AGAAGAAAATTGGCGCTCATCAGTTTGTTTGGAATCATTTTCAGTTTGGT
AATCATTGCGGTAAACCTTCAACTAGTCGACGTGAGGTATCTAAAAAGAA
ACCAGAATAATATTTGTGACAATTTTCTGGCATGCGATGACTGGGTTAGT
TATCACTGTGAATATTGTCAAATTGACGAAAATTCCGGATATACTTGTGT
TAATTATGGGGCAAACTAATGGCACTTGTTCAATTTATGAGTTTTGTAAT
CCAAGCACAATAAATATTAATTGGATTCTTTTGTTGGGAATGATATTGTA
TGTCATCAGTTTTGCAATTGGAATGGGGCCGATTCCTTGGGTGGTCACTT
CGGAAATATACCCCGCGTGGTGCCGCAGTACCAATATGGCATTATCAACG
ACAGCAAATTGGTTTTTCAATTTTTCCGTTACAATGACTGTATTTCCCAT
TGGATTGTACGAAACATTTTGGATTTATTCCGCGTTTACTCTTTGTGGAA
TTGCTCTAATATATAGAAATTTTCCCGAAATGAACCAAGCGAATATGGAA
GAAATATTACATGTGCTATAAATTAAATTGTGATTTGAATATTTGATTTA
ATAAATAATTTATTTTGTAAAAAAAAA
back to top

protein sequence of SMED30017038-orf-1

>SMED30017038-orf-1 ID=SMED30017038-orf-1|Name=SMED30017038-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=231bp
MPIILITPAVPALFLLIGMLTVPESYRWLLSKNRIDEAIEVVRKLKQIPE
SNITEFVENILEANVLIEEDLQEQKEQKKFILCRILGDKIARKTLVMGCS
LQMLAQLIGINGLMYYANSLFQKYVTNNIKIYLWFTPLLTFINLISSFVA
YKLIDKIGRRKLALISLFGIIFSLVIIAVNLQLVDVRYLKRNQNNICDNF
LACDDWVSYHCEYCQIDENSGYTCVNYGAN*
back to top

protein sequence of SMED30017038-orf-2

>SMED30017038-orf-2 ID=SMED30017038-orf-2|Name=SMED30017038-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=145bp
MTGLVITVNIVKLTKIPDILVLIMGQTNGTCSIYEFCNPSTININWILLL
GMILYVISFAIGMGPIPWVVTSEIYPAWCRSTNMALSTTANWFFNFSVTM
TVFPIGLYETFWIYSAFTLCGIALIYRNFPEMNQANMEEILHVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0022857transmembrane transporter activity
GO:0022891substrate-specific transmembrane transporter activity
GO:0005215transporter activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005667transcription factor complex
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002075pigment cell
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR005828MFS_sugar_transport-like
IPR020846MFS_dom
IPR003663Sugar/inositol_transpt
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005828Major facilitator, sugar transporter-likePFAMPF00083Sugar_trcoord: 1..162
e-value: 2.6E-27
score: 95.8
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 1..183
e-value: 2.4E-32
score: 114.3
NoneNo IPR availablePANTHERPTHR23503FAMILY NOT NAMEDcoord: 2..164
NoneNo IPR availablePANTHERPTHR23503:SF8GLUCOSE TRANSPORTER TYPE 1coord: 2..164
NoneNo IPR availableCDDcd17360MFS_HMIT_likecoord: 74..165
e-value: 2.03311E-22
score: 91.1776
NoneNo IPR availableTMHMMTMhelixcoord: 144..166
NoneNo IPR availableTMHMMTMhelixcoord: 113..132
NoneNo IPR availableTMHMMTMhelixcoord: 76..98
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 2..161