FMRFamide-activated amiloride-sensitive sodium channel

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel
Smed IDSMED30017031
Length (bp)1832
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30017031) t-SNE clustered cells

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30017031) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30017031) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30017031) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017031

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30017031h1SMcG0002529 dd_Smed_v4_18219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30017031h1SMcG0002529 dd_Smed_v4_18219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30017031h1SMcG0002529 dd_Smed_v4_18219_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 56.9954 bits (136), Expect = 8.664e-8
Identity = 53/182 (29.12%), Postives = 78/182 (42.86%), Query Frame = 3
Query:  984 LTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSY--KYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYT 1523
            L+  TG +V++H       +++ G NL+PG    IS      +R       C  N S++  + N Y  KYT   C+ +  Q+S IK CGC    +PRP    QN+ YC     S+      Y    ++    +      TKC   CS  +Y      + W PS+     V Q+    N NYT
Sbjct:  343 LSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDV-PVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRP----QNVEYCDYRKHSS----WGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRW-PSVTSQEWVFQMLSRQN-NYT 513          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 56.6102 bits (135), Expect = 1.010e-7
Identity = 53/182 (29.12%), Postives = 78/182 (42.86%), Query Frame = 3
Query:  984 LTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSY--KYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYT 1523
            L+  TG +V++H       +++ G NL+PG    IS      +R       C  N S++  + N Y  KYT   C+ +  Q+S IK CGC    +PRP    QN+ YC     S+      Y    ++    +      TKC   CS  +Y      + W PS+     V Q+    N NYT
Sbjct:  366 LSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDV-PVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRP----QNVEYCDYRKHSS----WGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRW-PSVTSQEWVFQMLSRQN-NYT 536          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 56.6102 bits (135), Expect = 1.249e-7
Identity = 53/182 (29.12%), Postives = 78/182 (42.86%), Query Frame = 3
Query:  984 LTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSY--KYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYT 1523
            L+  TG +V++H       +++ G NL+PG    IS      +R       C  N S++  + N Y  KYT   C+ +  Q+S IK CGC    +PRP    QN+ YC     S+      Y    ++    +      TKC   CS  +Y      + W PS+     V Q+    N NYT
Sbjct:  402 LSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDV-PVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRP----QNVEYCDYRKHSS----WGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRW-PSVTSQEWVFQMLSRQN-NYT 572          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 56.225 bits (134), Expect = 1.365e-7
Identity = 36/108 (33.33%), Postives = 53/108 (49.07%), Query Frame = 3
Query:  984 LTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSY--KYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYC 1301
            L+  TG +V++H       +++ G NL+PG    IS      +R       C  N S++  + N Y  KYT   C+ +  Q+S IK CGC    +PRP    QN+ YC
Sbjct:  343 LSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDV-PVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRP----QNVEYC 445          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 53.9138 bits (128), Expect = 4.236e-7
Identity = 53/182 (29.12%), Postives = 78/182 (42.86%), Query Frame = 3
Query:  984 LTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSY--KYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYT 1523
            L+  TG +V++H       +++ G NL+PG    IS      +R       C  N S++  + N Y  KYT   C+ +  Q+S IK CGC    +PRP    QN+ YC     S+      Y    ++    +      TKC   CS  +Y      + W PS+     V Q+    N NYT
Sbjct:   43 LSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDV-PVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRP----QNVEYCDYRKHSS----WGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRW-PSVTSQEWVFQMLSRQN-NYT 213          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: asic-2 (Degenerin-like protein asic-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22851])

HSP 1 Score: 75.485 bits (184), Expect = 4.231e-14
Identity = 84/392 (21.43%), Postives = 158/392 (40.31%), Query Frame = 3
Query:  327 IARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFS----ENANRMWQENLVMTPKKFEELLTNVSINMVKNNRGGGEILYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVY--IAEQCDLASYVAYR--LRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTL--TRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLY 1472
            +A A N   R  WI   + +  +     Y L   FF+Y    +T   F EK  FP +++C+ NP+     ++ +     N +MT        ++ ++     ++ G  +  D+ E Y  +++  ++  L  +  ++         Y Y  + + C  A          KF +  Y  C++  ED       S +   +RE +   + + +T    +TQ  ++   D+L  T+  G ++ ++  G+SP +++ GI+   G  + +S       R   P   C++ + +  D    + YT+  C     Q+ TI  C C N         +   P   +  C   + LK  + SS  +  L    LV+  C   C   TY   VS+  +  + Y
Sbjct:   25 VANANNKISRIFWIAIFLFVLGMFAYELYILIAKFFSYPATVNTEILF-EKQIFPVVTVCNMNPYKYSVVKSNSAFSSVNTLMT------TYSDATVGTFSTDKWG--LYADNDETY--DLDSRAADALVLEANLISDTAKVPALYTYADLIQDCSFAGIPCSESDFTKFIDPVYGACYSFNEDA------SLNYSVSREGIQFGLKLMLT----VTQTKTNGNTDSLPTTKLAGARIGVNSRGSSPGLDSNGIDAGVGYESAVSVSLTQNVRAKKPYGTCVDREPDSSDYYKDFIYTLETCFNGCKQRDTIAKCQCANPRLALGSTDTACQPIKADLDCL--QTLKGNQTSSTPNIDL----LVECNCNPPCDESTYTPTVSLAQFPSTSY 389          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: del-1 (Degenerin del-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19038])

HSP 1 Score: 55.0694 bits (131), Expect = 1.140e-7
Identity = 59/253 (23.32%), Postives = 96/253 (37.94%), Query Frame = 3
Query:  708 KEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCL---NNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNW 1457
            K E+++ C           +QC++ +     +    +  + NC+T   +PEK       + S+R   S  + + +        +NSS  + T T  TGV++ +H     P  + +G +   G ++       + NR   P   CL   N QS  I  G  YKY    C  +  Q   I  CGC +  +P+P K S          C +         ++   +  TK+     KC   C    Y T  S   W
Sbjct:  364 KSELIKMCSFN-------GQQCNIDTEFKLHI----DPSFGNCYTFNANPEK------KLASSRAGPSYGLRLMMF-------VNSSDYLPT-TEATGVRIAIHGKEECPFPDTFGYSAPTGVISSFGISLRNINRLPQPYGNCLQKDNPQSRSIYKG--YKYEPEGCFRSCYQYRIIAKCGCADPRYPKPWKRSA--------WCDSTNTTTLNCLTTEGAKLSTKENQKHCKCIQPCQQDQYTTTYSAAKW 581          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: del-1 (Degenerin del-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19038])

HSP 1 Score: 55.0694 bits (131), Expect = 1.191e-7
Identity = 59/253 (23.32%), Postives = 96/253 (37.94%), Query Frame = 3
Query:  708 KEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCL---NNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNW 1457
            K E+++ C           +QC++ +     +    +  + NC+T   +PEK       + S+R   S  + + +        +NSS  + T T  TGV++ +H     P  + +G +   G ++       + NR   P   CL   N QS  I  G  YKY    C  +  Q   I  CGC +  +P+P K S          C +         ++   +  TK+     KC   C    Y T  S   W
Sbjct:  339 KSELIKMCSFN-------GQQCNIDTEFKLHI----DPSFGNCYTFNANPEK------KLASSRAGPSYGLRLMMF-------VNSSDYLPT-TEATGVRIAIHGKEECPFPDTFGYSAPTGVISSFGISLRNINRLPQPYGNCLQKDNPQSRSIYKG--YKYEPEGCFRSCYQYRIIAKCGCADPRYPKPWKRSA--------WCDSTNTTTLNCLTTEGAKLSTKENQKHCKCIQPCQQDQYTTTYSAAKW 556          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: del-1 (Degenerin del-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19038])

HSP 1 Score: 55.0694 bits (131), Expect = 1.303e-7
Identity = 59/253 (23.32%), Postives = 96/253 (37.94%), Query Frame = 3
Query:  708 KEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCL---NNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNW 1457
            K E+++ C           +QC++ +     +    +  + NC+T   +PEK       + S+R   S  + + +        +NSS  + T T  TGV++ +H     P  + +G +   G ++       + NR   P   CL   N QS  I  G  YKY    C  +  Q   I  CGC +  +P+P K S          C +         ++   +  TK+     KC   C    Y T  S   W
Sbjct:  319 KSELIKMCSFN-------GQQCNIDTEFKLHI----DPSFGNCYTFNANPEK------KLASSRAGPSYGLRLMMF-------VNSSDYLPT-TEATGVRIAIHGKEECPFPDTFGYSAPTGVISSFGISLRNINRLPQPYGNCLQKDNPQSRSIYKG--YKYEPEGCFRSCYQYRIIAKCGCADPRYPKPWKRSA--------WCDSTNTTTLNCLTTEGAKLSTKENQKHCKCIQPCQQDQYTTTYSAAKW 536          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: mec-4 (Degenerin mec-4 [Source:UniProtKB/Swiss-Prot;Acc:P24612])

HSP 1 Score: 49.2914 bits (116), Expect = 8.698e-6
Identity = 49/235 (20.85%), Postives = 94/235 (40.00%), Query Frame = 3
Query:  948 LTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSL---YKLNRVTQIYKLANENYTETDEGKTERVKKLKEKPQDTISKNLNMLTDESRFTYINVV 1643
            L  +N+S  M T T  TGV++ +H+    P  + +G +   G ++         +R  +P   C+ +      + ++Y+Y++  C  +  Q+  +K C C +  +P P    +N  +C     + D I ++   + + D G         +C   C    Y    S   W PSL    +L          N++Y E         ++L          N  MLT+   + ++N++
Sbjct:  499 LVYVNASDYMPT-TEATGVRLTIHDKEDFPFPDTFGYSAPTGYVSSFGLRLRKMSRLPAPYGDCVPDGKTSDYIYSNYEYSVEGCYRSCFQQLVLKECRCGDPRFPVP----ENARHCD----AADPIARKCLDARMNDLGGLHGSF-RCRCQQPCRQSIYSVTYSPAKW-PSLSLQIQLGSCNGTAVECNKHYKENGAMVEVFYEQL----------NFEMLTESEAYGFVNLL 712          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Match: ppk26 (gene:FBgn0035785 transcript:FBtr0332797)

HSP 1 Score: 50.447 bits (119), Expect = 4.545e-6
Identity = 63/286 (22.03%), Postives = 114/286 (39.86%), Query Frame = 3
Query:  975 MDTLTRGT--GVKVVLHEVGTSPEI----------ENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSC-----STDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGKTERVKKLKEKPQDTISKNLNMLTDESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFC 1781
             D + RG   G K++LH  G   ++          +   I+++P    +I   +     Y   +R C   +   +   N Y  + S C    L   T+  CGC+  + PR V    N+P C + S      + DE+L R     + + G   +   +  C   C+   Y+ ++S  ++             YK      T++ EGK E+ K+     Q      +++   E++F           T +++E  +   + F++  GGL  L +G++     ELI FC
Sbjct:  327 FDDMCRGPVQGFKILLHTPGDVAQVSKQYFRIPFDQEVLISIRP----KIITTSDGLKHYEPNRRQCYFQKERELRYFNIY--SQSNCELECLANFTLTKCGCVKFSMPRNV----NMPVCGDASLKCYNQAEDELLLREFTQGLVNAGENTRGETECNCLPSCTSIAYEAEISQADFD------------YKTVIN--TDSPEGKEEQSKR-----QGMKMSRVSIFFKEAQFL----------TSRRSE--LYGTTDFLANCGGLLGLFMGVSMLSIVELIYFC 571          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: copg2 (coatomer protein complex subunit gamma 2 [Source:Xenbase;Acc:XB-GENE-941264])

HSP 1 Score: 60.8474 bits (146), Expect = 3.970e-9
Identity = 73/337 (21.66%), Postives = 130/337 (38.58%), Query Frame = 3
Query:  771 CDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNI-IDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGKTERVKKLKEKPQDTISKNLNMLTDESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEF 1778
            CD   YV      F +  Y NCFTI    ++   +S+     +  LSI++      ++DL        M  L++  G ++++H     P +E+ G +++PG  N IS +     R       C ++ S++ I +  +  YTM  C+ +  Q   I+ CGC    +P P      + YC N++   D     Y+   + ++ L    +  T+C   C    Y        W   +                       K +++  L+E+         N  +  S  + INV  +        E   +  ++ +S +GGL S   G +    AE+ E 
Sbjct:  248 CDEREYV-----HFHHPIYGNCFTINNHWKENSWYSSRP-GKQYGLSIVV------KTDLHD-----NMPLLSQAAGARIMIHNPNQPPLVEHQGFDIRPGTENSISVKQEEAIRLGGKYSQCTSDGSDLGIKILYNTSYTMQACLNSCFQYKMIEVCGCGYYFYPLP----PGMEYC-NYNKHPDWGYCFYQ---LYEKMLDHTLICFTQCPKQCKQTEYHLSAGTAKWPSPV----------------------SKAKKLLSLQER--------YNSTSKRSDISKINVYYEELSYRSVEETPSVSVTMLLSSMGGLWSWWFGSSVLSVAEIAEL 529          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: copg2 (coatomer protein complex subunit gamma 2 [Source:Xenbase;Acc:XB-GENE-941264])

HSP 1 Score: 58.5362 bits (140), Expect = 2.094e-8
Identity = 76/337 (22.55%), Postives = 135/337 (40.06%), Query Frame = 3
Query:  771 CDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNI-IDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGKTERVKKLKEKPQDTISKNLNMLTDESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEF 1778
            CD   YV      F +  Y NCFTI    ++   +S+     +  LSI++      ++DL        M  L++  G ++++H     P +E+ G +++PG  N IS +     R       C ++ S++ I +  +  YTM  C+ +  Q   I+ CGC    +P P      + YC N++   D     Y+   + ++ L    +  T+C   C    Y        W          + + K++N+  T            +K K    +   +  L+D S+   INV  +        E   +  ++ +S +GGL S   G +    AE+ E 
Sbjct:  248 CDEREYV-----HFHHPIYGNCFTINNHWKENSWYSSRP-GKQYGLSIVV------KTDLHD-----NMPLLSQAAGARIMIHNPNQPPLVEHQGFDIRPGTENSISVKQEEAIRLGGKYSQCTSDGSDLGIKILYNTSYTMQACLNSCFQYKMIEVCGCGYYFYPLP----PGMEYC-NYNKHPDWGYCFYQ---LYEKMLDHTLICFTQCPKQCKQTEYHLSAGTAKWP---------SPVSKVSNDYIT------------IKAK----VYWGVWELSDISK---INVYYEELSYRSVEETPSVSVTMLLSSMGGLWSWWFGSSVLSVAEIAEL 531          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: foxe3 (forkhead box E3 [Source:Xenbase;Acc:XB-GENE-480592])

HSP 1 Score: 53.9138 bits (128), Expect = 6.878e-7
Identity = 46/222 (20.72%), Postives = 95/222 (42.79%), Query Frame = 3
Query:  615 KNNRGGGEILYDSAEYYYGNI--EYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNI-IDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRP 1271
            K+   G + L++  +++Y NI  +    +N+S  +E+ +  + + D   +I + C L  Y     + F +  Y +CFT+    ++   +S        L            S   +++    M  L++  G ++++H     P +E+ G +++PG    I  +            PC ++ +N+ + L  S  YT+  C+ +  Q    + CGC    +P P
Sbjct:  198 KSYWSGVDALHEWYQFHYINIMSKIPPVLNIS-GDELGKNFIFSCD---FIQKPCTLREY-----KFFHHPIYGSCFTVTPQGKENALYSPRAGKKYGL------------SLKMKVDQKHNMPLLSQAAGARIMIHNPNQPPRVEHQGFDIRPGTETSIGVKQDEVRHLGGKYGPCASDGNNLGLKLLYSTSYTLQACLNSCFQYKMTETCGCGYYFYPLP 398          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: lhx1 (LIM homeobox 1 [Source:Xenbase;Acc:XB-GENE-482482])

HSP 1 Score: 50.8322 bits (120), Expect = 3.094e-6
Identity = 62/281 (22.06%), Postives = 115/281 (40.93%), Query Frame = 3
Query:  306 SIRGMQKIARAPNNFLRSVWIGYV--ILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENA--------NRMWQENLVMTPKKFEELLTNVSINMVKNNRGGGEILYDSA----EYYYGNIEYESSVNLSHK-EEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETI 1103
            S  G+  I R+ + F R VW+ +V   L   L   T   L   ++ Y +          K +FPA++IC+ N    ++        N +    L MT ++      NV+ + V  N     +LY SA       +  +  E  + + H+ E++L +C        +  ++C+ + +       F N K+ NC+T           +   V    +     +  +  E  + QI   +V D +T   G+++++H+    P  E+ G+N+ PG   EI    +
Sbjct:   39 SAHGIPNIFRSKHWFRRMVWLVFVSFALCCALWQCTQMVL--TYYTYPSHEKIMLISSAKLKFPAVTICNLNSVRLSSLGRSFSMSNSLQDSGLEMTHRRNRSHHMNVTSDSVDEN-----VLYASAFNKFASEFNQLPDEQKIEMGHQLEDMLIFCN-------FHGQECNSSFFSG-----FINYKFGNCYTFNSQKSVDIRGNQIRVDPLNITKAGFMYGLHLELFIQQI--EYVRD-MTHAAGIRLLVHDQAQMPFPEDEGVNVPPGAETEIGMMKV 297          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Asic5 (acid-sensing (proton-gated) ion channel family member 5 [Source:MGI Symbol;Acc:MGI:1929259])

HSP 1 Score: 58.9214 bits (141), Expect = 1.327e-8
Identity = 109/533 (20.45%), Postives = 196/533 (36.77%), Query Frame = 3
Query:  267 PQPSPLTL------FCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPF-SENANR------MWQENLVMTPKKFEELLTN-----VSINMVKNNRGGGEILYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSS-----IKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGKTERVKKLKEKPQDTISKNLNMLTDESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCYLAFH 1796
            P PSP         F  + S  G+  IA+  N   + +W+  V+   +LL    Y    ++F + T       + EK EFPA+++C+ N F +E  +R      +W  ++V    + +E+  N      +++ V N++      +   E+   N  Y ++  L H E   + C      +V+                    ++Y NCFT     E ++  +   VS R L    +L+ +  E         F         GV  V+H     P+ +  G++   G    ++   +       P   C  N    I L N   Y+   C++    +   + CGC+              P+    +    ++L+ Y C S     I+ +GL      ++ C   C    Y   VS + + PS     R T+                    KKL +  Q+ I +NL  +        IN    N+   ++ + + +     ++ VGG   L  G +     E+IE+ +  F+
Sbjct:   27 PLPSPTDRKKFDQDFAMSTSFHGIHNIAQNQNKVRKVIWLAVVLGSVSLLVWQIYSRLVNYFTWPTTTSIEVQYVEKIEFPAVTLCNLNRFQTEAVSRFGIIFFLW--DIVSKVLRLQEISANNTGSPETLDFVTNHQN-----FSITEFVKNNGFYLNNDTLVHCEFFGKTCSPKDFKHVF--------------------TEYGNCFTFNYG-ENIQNKNKVSVSGRGLK---LLLDVHQEEFTDNPVPGFA------DAGVIFVIHSPKKEPQFDGLGLSSPVGMHARVTIRQLKTVHQEYPWGECNPN----IKLRNFITYSTYGCLKECKARHIQRLCGCL--------------PFLLPGNGVECDLLEYYNCVSPILDHIERKGLCTMGTHNSSCPVSCEETEYPATVSYSTF-PS----QRATRFL-----------------AKKLNQS-QEYIRENLVNIE-------INYSDLNYKITQQQKAVSVPE--LLADVGGQLGLFCGASLITIIEIIEYFFTNFY 472          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Asic5 (acid-sensing (proton-gated) ion channel family member 5 [Source:MGI Symbol;Acc:MGI:1929259])

HSP 1 Score: 55.0694 bits (131), Expect = 1.816e-7
Identity = 104/514 (20.23%), Postives = 190/514 (36.96%), Query Frame = 3
Query:  306 SIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPF-SENANR------MWQENLVMTPKKFEELLTN-----VSINMVKNNRGGGEILYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSS-----IKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGKTERVKKLKEKPQDTISKNLNMLTDESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCYLAFH 1796
            S  G+  IA+  N   + +W+  V+   +LL    Y    ++F + T       + EK EFPA+++C+ N F +E  +R      +W  ++V    + +E+  N      +++ V N++      +   E+   N  Y ++  L H E   + C      +V+                    ++Y NCFT     E ++  +   VS R L    +L+ +  E         F         GV  V+H     P+ +  G++   G    ++   +       P   C  N    I L N   Y+   C++    +   + CGC+              P+    +    ++L+ Y C S     I+ +GL      ++ C   C    Y   VS + + PS     R T+                    KKL +  Q+ I +NL  +        IN    N+   ++ + + +     ++ VGG   L  G +     E+IE+ +  F+
Sbjct:    4 SFHGIHNIAQNQNKVRKVIWLAVVLGSVSLLVWQIYSRLVNYFTWPTTTSIEVQYVEKIEFPAVTLCNLNRFQTEAVSRFGIIFFLW--DIVSKVLRLQEISANNTGSPETLDFVTNHQN-----FSITEFVKNNGFYLNNDTLVHCEFFGKTCSPKDFKHVF--------------------TEYGNCFTFNYG-ENIQNKNKVSVSGRGLK---LLLDVHQEEFTDNPVPGFA------DAGVIFVIHSPKKEPQFDGLGLSSPVGMHARVTIRQLKTVHQEYPWGECNPN----IKLRNFITYSTYGCLKECKARHIQRLCGCL--------------PFLLPGNGVECDLLEYYNCVSPILDHIERKGLCTMGTHNSSCPVSCEETEYPATVSYSTF-PS----QRATRFL-----------------AKKLNQS-QEYIRENLVNIE-------INYSDLNYKITQQQKAVSVPE--LLADVGGQLGLFCGASLITIIEIIEYFFTNFY 430          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.526e-21
Identity = 116/537 (21.60%), Postives = 217/537 (40.41%), Query Frame = 3
Query:  312 RGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFS-ENANRMWQENLVMTPKKFEELLTNVSINMVKNNRGGGEILYDSAEYYYGNIEYESSVNLSHK-EEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDT-LTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYC--------TNFSCSTDEILKRYE-----------CSSIKDQGLTKQKL--VDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYK---LANENYTETDEGKTERVKKLKEKPQDTISKNLNMLTDESRFTY---------------------INVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEF 1778
             G+ KI  + +   + +W   VI   T  T+    L R +  +     +        ++P++SIC+  P S     RM+  N      + + L+T   +  ++  R   +   +S   +Y N+  + +  LSH  E++L +C           E C ++++       F +  YFNCFT     ++L+ H+         LS+I  ++   +  L      +  D  +    GV+VV+H  G+ P   ++GI++ PG  + +  + I   R   P   C N+  N I     YKYT   C++   Q+  I+ CGC +S  P    PS N  +C         N + S ++  +  E           C   + + L   +   +   CF  CS  +Y   VS++ W    Y+L+ V + +K    A +N+    +   E ++KL    Q  +++N + + D    +Y                     +N+  ++   ++  +      +   + +GG   L +G++     ELIE 
Sbjct:   53 HGLAKIVTSRDTKRKVIWALLVIAGFTAATLQLSLLVRKYLQFQVVELSEIKDSMPVQYPSVSICNIEPISLRTIRRMYFNN------ESQNLIT--WLRFIQKFRFEQDSFMNSIRAFYENLG-QDAKKLSHNLEDMLMHCRFNR-------ELCHVSNFST-----FFDGNYFNCFTFNSG-QRLQMHA---TGPENGLSLIFSVE--KDDPLPGTYGVYNFDNNILHSAGVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTRLPYPYGNCTNDMLNGI---KQYKYTFFACLQLCKQRLIIQRCGCKSSALPE--VPSYNATFCGVIKDWQEINRNHSNEDHNQSEEDRAFIPTPYLACEEREQKNLNNDRTYELSCGCFQPCSETSYLKSVSLSYWPLEFYQLSAVERFFKQERQAGQNHFM--KTAYEYLEKLAHPSQKHLARNDSHMDDILSKSYSLSEKEMAKEASDLIRQNMLRLNIYLEDLSVVEYRQLPAYGLADLFADIGGTLGLWMGISVLTIMELIEL 555          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q22851|ASIC2_CAEEL (Degenerin-like protein asic-2 OS=Caenorhabditis elegans OX=6239 GN=asic-2 PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 5.382e-13
Identity = 84/392 (21.43%), Postives = 158/392 (40.31%), Query Frame = 3
Query:  327 IARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFS----ENANRMWQENLVMTPKKFEELLTNVSINMVKNNRGGGEILYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVY--IAEQCDLASYVAYR--LRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTL--TRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLY 1472
            +A A N   R  WI   + +  +     Y L   FF+Y    +T   F EK  FP +++C+ NP+     ++ +     N +MT        ++ ++     ++ G  +  D+ E Y  +++  ++  L  +  ++         Y Y  + + C  A          KF +  Y  C++  ED       S +   +RE +   + + +T    +TQ  ++   D+L  T+  G ++ ++  G+SP +++ GI+   G  + +S       R   P   C++ + +  D    + YT+  C     Q+ TI  C C N         +   P   +  C   + LK  + SS  +  L    LV+  C   C   TY   VS+  +  + Y
Sbjct:   25 VANANNKISRIFWIAIFLFVLGMFAYELYILIAKFFSYPATVNTEILF-EKQIFPVVTVCNMNPYKYSVVKSNSAFSSVNTLMT------TYSDATVGTFSTDKWG--LYADNDETY--DLDSRAADALVLEANLISDTAKVPALYTYADLIQDCSFAGIPCSESDFTKFIDPVYGACYSFNEDA------SLNYSVSREGIQFGLKLMLT----VTQTKTNGNTDSLPTTKLAGARIGVNSRGSSPGLDSNGIDAGVGYESAVSVSLTQNVRAKKPYGTCVDREPDSSDYYKDFIYTLETCFNGCKQRDTIAKCQCANPRLALGSTDTACQPIKADLDCL--QTLKGNQTSSTPNIDL----LVECNCNPPCDESTYTPTVSLAQFPSTSY 389          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q9R0Y1|ASIC5_MOUSE (Acid-sensing ion channel 5 OS=Mus musculus OX=10090 GN=Asic5 PE=2 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 9.283e-8
Identity = 109/533 (20.45%), Postives = 196/533 (36.77%), Query Frame = 3
Query:  267 PQPSPLTL------FCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPF-SENANR------MWQENLVMTPKKFEELLTN-----VSINMVKNNRGGGEILYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSS-----IKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGKTERVKKLKEKPQDTISKNLNMLTDESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCYLAFH 1796
            P PSP         F  + S  G+  IA+  N   + +W+  V+   +LL    Y    ++F + T       + EK EFPA+++C+ N F +E  +R      +W  ++V    + +E+  N      +++ V N++      +   E+   N  Y ++  L H E   + C      +V+                    ++Y NCFT     E ++  +   VS R L    +L+ +  E         F         GV  V+H     P+ +  G++   G    ++   +       P   C  N    I L N   Y+   C++    +   + CGC+              P+    +    ++L+ Y C S     I+ +GL      ++ C   C    Y   VS + + PS     R T+                    KKL +  Q+ I +NL  +        IN    N+   ++ + + +     ++ VGG   L  G +     E+IE+ +  F+
Sbjct:   27 PLPSPTDRKKFDQDFAMSTSFHGIHNIAQNQNKVRKVIWLAVVLGSVSLLVWQIYSRLVNYFTWPTTTSIEVQYVEKIEFPAVTLCNLNRFQTEAVSRFGIIFFLW--DIVSKVLRLQEISANNTGSPETLDFVTNHQN-----FSITEFVKNNGFYLNNDTLVHCEFFGKTCSPKDFKHVF--------------------TEYGNCFTFNYG-ENIQNKNKVSVSGRGLK---LLLDVHQEEFTDNPVPGFA------DAGVIFVIHSPKKEPQFDGLGLSSPVGMHARVTIRQLKTVHQEYPWGECNPN----IKLRNFITYSTYGCLKECKARHIQRLCGCL--------------PFLLPGNGVECDLLEYYNCVSPILDHIERKGLCTMGTHNSSCPVSCEETEYPATVSYSTF-PS----QRATRFL-----------------AKKLNQS-QEYIRENLVNIE-------INYSDLNYKITQQQKAVSVPE--LLADVGGQLGLFCGASLITIIEIIEYFFTNFY 472          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|P55270|SCNNA_BOVIN (Amiloride-sensitive sodium channel subunit alpha OS=Bos taurus OX=9913 GN=SCNN1A PE=1 SV=2)

HSP 1 Score: 58.151 bits (139), Expect = 1.887e-7
Identity = 69/268 (25.75%), Postives = 107/268 (39.93%), Query Frame = 3
Query:  984 LTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSY--KYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGKTERVKKLKEKPQDTISKNLNMLTDESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVG---LTTAVFAELI 1772
            L+  TG +V++HE      +++ G NL+PG    IS      +R       C  N S +  + N Y  KYT   C+ +  Q+S IK CGC    +PRP      + +C     ++      Y    ++D   + +    TKC   CS   Y    S + W PS    + V Q+    N NYT            +K K +D ++K             +N+  K  +    +E   +     +S +G   SL  G   L+    AELI
Sbjct:  324 LSTVTGARVMVHERDEPAFMDDAGFNLRPGVETSISMSKEAVDRLGGDYGDCTKNGSEV-PVENLYNTKYTQQVCIHSCFQESMIKECGCAYIFYPRP----DGVEFCDYRKHNS----WGYCYYKLQDAFSSDRLGCFTKCRKPCSVTIYKLSASYSQW-PSATSQDWVFQMLSRQN-NYT------------IKNK-RDGVAK-------------LNIFFKELNYKSNSESPSVTMVTLLSNLGSQWSLWFGSSVLSVVEMAELI 554          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|P37088|SCNNA_HUMAN (Amiloride-sensitive sodium channel subunit alpha OS=Homo sapiens OX=9606 GN=SCNN1A PE=1 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 4.161e-7
Identity = 53/182 (29.12%), Postives = 78/182 (42.86%), Query Frame = 3
Query:  984 LTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSY--KYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYT 1523
            L+  TG +V++H       +++ G NL+PG    IS      +R       C  N S++  + N Y  KYT   C+ +  Q+S IK CGC    +PRP    QN+ YC     S+      Y    ++    +      TKC   CS  +Y      + W PS+     V Q+    N NYT
Sbjct:  343 LSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDV-PVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRP----QNVEYCDYRKHSS----WGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRW-PSVTSQEWVFQMLSRQN-NYT 513          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4E0RFC3 (FMRFamide-activated amiloride-sensitive sodium channel OS=Fasciola hepatica OX=6192 GN=D915_003846 PE=3 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 4.903e-136
Identity = 216/538 (40.15%), Postives = 322/538 (59.85%), Query Frame = 3
Query:  270 QP-SPLTLFCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENANRMWQENLVMTPKKFEELLTNVSINMVKNNRGGGEI---LYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQN---IPYCTNFS------CSTDEILKRYECSSI--KDQGLTKQKLVDTK-CFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGKTERVKKLKEKPQDTISKNLNMLTDE-------------SRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCYLAFH 1796
            QP S + LF E  SIRG+Q+I RA   F+R++WI +VI MT LLTV+S+ L  D+  Y T+WHT +  D+K+EFPAI++C+HNPFS  AN++W    V++P + +  +  VS+ M+  ++    +   L DS E+YY N+  E S  +SH  EI+ +C+L +  +  +AE+C++ +  A   R FS+ KYFNC TIE    +         ST ++  +++L  + P S + Q  S+F+MDT TRG G+KVV+HE  T P+IE YG N+QP +MNEI +ET+ W R ++P  PC ++Q  I DLG +Y Y  S+C++   Q+  I+ CGCMNS WPRP +       +PYCT+         +   + +R  CS I  ++  + +++++    C   C +FTYDTK+SVT+W+PS  KL+  T  Y++  E  TE  E K    K+L    Q  I   L+   ++               +TYI+++R++FDT  K E+LV DA I +SR+GGLCSL +GLT A F E+IEF Y  FH
Sbjct:   68 QPASKIKLFGEISSIRGVQRIFRAETPFIRTLWILFVISMTCLLTVSSFMLIVDYLQYTTSWHTRSLPDDKSEFPAITLCAHNPFSLKANKLWSTGHVISPNQVKSNMAAVSLEMLNQDKVEDSVIMALSDSFEFYYTNLSPEDSQKISHDFEIIPHCILYSPEHTVVAEKCEMENVTAMVRRTFSHPKYFNCLTIEGGGNE---------STSDISRLVLLAHLVPSSKIVQARSAFIMDTFTRGEGIKVVIHERNTYPQIERYGFNVQPNRMNEIIYETLSWKRLSTPVAPCKDSQPPISDLGVNYTYETSQCLDIATQEEMIRRCGCMNSEWPRPTRAVHGPRLVPYCTSMDRNSSVEVTATVLSERLACSRIFFEELPVIRERIIRAGICIPRCRFFTYDTKLSVTSWEPSPVKLSSYTANYRIVEEYLTEPIESKK---KELSSFLQSIIDPTLDSADEQWNKRIGDYKQFGDGTYTYISLIRRDFDTTLKEEKLVFDAPILLSRIGGLCSLCIGLTMAFFIEIIEFIYAVFH 593          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A0R3UEW8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5596 PE=3 SV=1)

HSP 1 Score: 417.157 bits (1071), Expect = 2.135e-135
Identity = 209/535 (39.07%), Postives = 318/535 (59.44%), Query Frame = 3
Query:  270 QPSPLTLFCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENANRMWQENLVMTPKKFEELLTNVSINMVKNNRG--GGEILYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKP---SQNIPYCTNF------SCSTDEILKRYECSSIKDQGLTKQK---LVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANE---NYTETDEGKTERVKKLKE--KPQDTISKN--------LNMLTDESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCYLAF 1793
            +PS   +FC+  SIRG Q+I RA   F+R +W  +VILMT  L VT  FL RDFF++ T+WH+ T  D+KT+FPAI+IC+HNPFS  ANR+W E  ++TP +F   L+ +++  ++N      G +L DS + Y+ N+  E S  L H+  +  +C++T D    +AE C +     +  ++FS+ KYFNC+TIE         +A   ST++ + + +L+ + P  ++ +   +F+MDT +RG GVK+V+H+ GT PEI+ +GIN+QPG+MNE+SF T  W R  +P  PCL++   I D+G  Y Y M++C+++ LQ  +I  CGC+NS WPRP+ P   +  IPYC+        S + + I++R  C+S     L K K   +++  C   CS+FTY    S+T+W+P   KL   T  +K       NY +  E +   ++ LKE   PQ+ +S          +    ++  +TYI++VR  +DT  K ERL+ D  I +SRVGGLCS+ +GLT A+  ELIEF Y+ F
Sbjct:    4 KPSKFAIFCDLTSIRGFQRIKRAQTPFIRMIWTLFVILMTGALIVTIGFLARDFFSFTTSWHSRTLIDDKTDFPAITICAHNPFSLEANRIWAEASILTPTEFNRQLSAMTLAFIENGNPEYAGLLLQDSTDTYFANLRPEESQRLGHQTTMFPHCMVTADGVNIVAENCMIEGDTGFTKKRFSHPKYFNCWTIE---------TAANQSTKDTVRLTVLLSLIPSKEINESRKNFIMDTFSRGEGVKLVVHQSGTYPEIDKHGINVQPGRMNELSFNTEWWVRLKTPTAPCLDDPPPITDMGRQYSYRMTQCLDSYLQNISINQCGCLNSEWPRPIHPDLVNSKIPYCSALPKNVSDSATLEGIIRRLNCTSNLLHNLKKIKESAILNHICTPRCSFFTYPISASITSWQPIPEKLQHFTDKFKRVERLLNNYDDPLE-RERLIQYLKEVIDPQEKLSTQIISKSSLRIEDFQNQGSYTYISLVRTTYDTTYKEERLIFDIYILISRVGGLCSIFIGLTAAIIVELIEFVYVGF 528          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4Z2DAR5 (FMRFamide-activated amiloride-sensitive sodium channel (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_002806 PE=3 SV=1)

HSP 1 Score: 410.994 bits (1055), Expect = 2.328e-132
Identity = 214/538 (39.78%), Postives = 320/538 (59.48%), Query Frame = 3
Query:  264 NPQPSPLTLFCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENANRMWQENLVMTPKKFEELLTNVSINMVKN---NRGGGEILYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVK---PSQNIPYCTNFSC------STDEILKRYEC--SSIKDQGLTKQKLVDTK-CFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGKTERVKKLKEKPQDTIS--KNLNMLT-------------DESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCYL 1787
            N +   L LFC   SIRG+Q+I  +   F+R +WI +VI MT +L V+S FL  D+  Y+TAW+T +  D+K+EFPAI++C+HNPFS   NR+W+EN+V +P++ +  L  + + M+ N   +  G     DS E+YY N+  E ++ + H +++L +C+L  +    +AE+CDL    + R+R+F++ KYFNC+TIE  P           ST ++  +IIL Q+ P   +   N+SF+MD+ TRG G+KVV+HE GT PEIE +G+N+QPG+MNEI++ET+ W R ++P  PC +   +I DLG  Y Y  S+C+   LQ      CGC+NS WPR +K     +++PYC             +++  R +C  S + D    K+K V  + C   C Y+TYDTK+SVT+W P  YKL   T+ Y+  ++   E ++ K   + +L E    +I   K+ N LT             D+   TYI+++R++FDT  K ERLV D  I +SR+GGLCSL +GLT A   EL+EF YL
Sbjct:   56 NKRKGKLELFCVLSSIRGVQRIYSSEIPFIRLLWIIFVITMTCVLMVSSGFLISDYLRYSTAWNTRSLLDDKSEFPAITLCAHNPFSLAVNRLWKENIVPSPREIKSRLRQLLMTMLDNGITDYTGDLAFSDSIEFYYTNLNSEDTIKVGHDKDMLYHCMLYEEGSTVVAEKCDLEPETSIRIRRFTHPKYFNCWTIESKPN---------ASTADVTRLIILAQLIPLKKIEGANTSFIMDSFTRGEGIKVVIHEKGTYPEIEKHGVNIQPGRMNEINYETLFWKRLHTPVAPCTDENISIEDLGVYYTYKQSQCLNRMLQNELFTRCGCLNSEWPRSIKLLDHQKSLPYCQKLPTNVNDLHGAEQMKTRLDCFGSVLADLKQLKEKAVQQRVCIPRCGYYTYDTKLSVTSWDPDPYKLALYTKGYRHVDKFLNEPNQRK--HIDELLENFDASIDVMKSKNQLTSISTLFSSDYQRFDDGTHTYISLIRQDFDTTLKEERLVFDIYILISRIGGLCSLCIGLTMAFIVELVEFLYL 582          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A3Q0KNT0 (Putative fmrfamide-gated Na+ channel OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 410.223 bits (1053), Expect = 5.086e-131
Identity = 218/546 (39.93%), Postives = 321/546 (58.79%), Query Frame = 3
Query:  237 NEPKQKPLANPQPSPLTLFCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENANRMWQENLVMTPKKFEELLTNVSINMVKN---NRGGGEILYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVK---PSQNIPYCTNFSC------STDEILKRYEC--SSIKDQGLTKQKLVDTK-CFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGK---------TERVKKLKEKPQDTISKNLNMLTDESRF-----TYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCYL 1787
            NEPK K         L LFC   SIRG+Q+I  +   F+R +WI +VI+MT +L V+S FL  D+  Y+TAW+T +  D+K+EFPAI++C+HNPFS N N +W+EN+V +P++ +  L  + + M+ N   +  G     DS E+YY N+  + ++ + H +++L +C+L  +    +AE+CDL    + R+R+F++ KYFNC+TI+  P           ST ++  +IIL  + P   +   N+SF+MD+ TRG G+KVV+HE GT PEIE +G+N+QPG+MNEI++ET+ W R ++P  PC N   +I DLG  Y Y  S+C+   LQ    K CGC+NS WPR +K     + +PYC             +E+  R +C  + + D    K+K V    C   C Y+TYDTK+SVT+W P  YKL   T+ Y+  ++   E ++ K            +  +K K Q T  + L    D  RF     TYI+++R++FDTI K ERLV D  I +SR+GGLCSL +GLT A   EL+EF YL
Sbjct:   55 NEPKGK---------LELFCVLSSIRGVQRIYSSQIPFIRILWILFVIIMTCVLMVSSGFLISDYLCYSTAWNTRSLLDDKSEFPAITLCAHNPFSLNVNGLWKENIVPSPRQIKSRLRQLLVTMLDNGITDYTGDLAFSDSIEFYYTNLNLDDTIKVGHDKDMLYHCMLYEEGSTVVAEKCDLELETSVRIRRFTHPKYFNCWTIDGKPN---------ASTSDVTRLIILAHLIPLKKIEGANTSFIMDSFTRGEGIKVVIHEKGTYPEIEKHGVNIQPGRMNEINYETLFWKRLHTPVAPCTNENISIEDLGVHYTYKQSQCLNRMLQNELYKRCGCLNSEWPRSIKLLDQQKFLPYCQKLPINVNDINGAEEMKTRLDCFGTLLNDLKQLKEKAVQQGVCIPRCGYYTYDTKLSVTSWDPDPYKLALYTKGYRHVDKFLNEPNQRKHIDELLENFDASIDPIKSKSQLTTIRTL-FSNDYQRFDDGTHTYISLIRQDFDTIMKEERLVFDIYILISRIGGLCSLCIGLTMAFIVELVEFIYL 581          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A183QH37 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=3 SV=1)

HSP 1 Score: 409.838 bits (1052), Expect = 8.797e-131
Identity = 219/546 (40.11%), Postives = 322/546 (58.97%), Query Frame = 3
Query:  237 NEPKQKPLANPQPSPLTLFCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENANRMWQENLVMTPKKFEELLTNVSINMVKN---NRGGGEILYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVK---PSQNIPYC------TNFSCSTDEILKRYEC--SSIKDQGLTKQKLVDTK-CFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGK---------TERVKKLKEKPQDTISKNLNMLTDESRF-----TYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCYL 1787
            NEPK K         L LFC   SIRG+Q+I  +   F+R +WI +VI+MT +L V+S FL  D+  Y+TAW+T +  D+K+EFPAI++C+HNPFS N N +W+EN+V +P++ +  L  + + M+ N   +  G     DS E+YY N+  + ++ + H +++L +C+L  +    +AE+CDL    + R+R+F++ KYFNC+TI+  P           ST ++  +IIL  + P   +   N+SF+MD+ TRG G+KVV+HE GT PEIE +G+N+QPG+MNEI++ET+ W R ++P  PC N   +I DLG  Y Y  S+C+   LQ    K CGC+NS WPR +K     + +PYC       N     +E+  R +C  + + D    K+K V    C   C Y+TYDTK+SVT+W P  YKL   T+ Y+  ++   E ++ K            +  +K K Q T  + L    D  RF     TYI+++R++FDTI K ERLV D  I +SR+GGLCSL +GLT A   EL+EF YL
Sbjct:   55 NEPKGK---------LELFCVLSSIRGVQRIYSSQIPFIRILWILFVIIMTCVLMVSSGFLISDYLCYSTAWNTRSLLDDKSEFPAITLCAHNPFSLNVNGLWKENIVPSPRQIKSRLRQLLVTMLDNGITDYTGDLAFSDSIEFYYTNLNLDDTIKVGHDKDMLYHCMLYEEGSTVVAEKCDLELETSVRIRRFTHPKYFNCWTIDGKPN---------ASTSDVTRLIILAHLIPLKKIEGANTSFIMDSFTRGEGIKVVIHEKGTYPEIEKHGVNIQPGRMNEINYETLFWKRLHTPVAPCTNENISIEDLGVHYTYKQSQCLNRMLQNELYKRCGCLNSEWPRSIKLLDQQKFLPYCQKLPNNVNDINGAEEMKTRLDCFGTLLNDLKQLKEKAVQQGVCIPRCGYYTYDTKLSVTSWDPDPYKLALYTKGYRHVDKFLNEPNQRKHIDELLENFDASIDPIKSKSQLTTIRTL-FSNDYQRFDDGTHTYISLIRQDFDTIMKEERLVFDIYILISRIGGLCSLCIGLTMAFIVELVEFIYL 581          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: SCNN1G (sodium channel epithelial 1 gamma subunit [Source:HGNC Symbol;Acc:HGNC:10602])

HSP 1 Score: 50.447 bits (119), Expect = 8.776e-7
Identity = 29/98 (29.59%), Postives = 45/98 (45.92%), Query Frame = 3
Query:  984 LTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYK--YTMSKCVEAELQKSTIKNCGCMNSNWPRP 1271
            L  G G K+ +H   T+P IE  GI++ P   + +        +   P   C  + S+ ID+ + Y   Y++  C  +  Q   IK+CGC N   P P
Sbjct:  315 LAMGAGAKIGIHLQNTTPFIEAVGIDIPPAMESSLGLRVNDVQKLGDPYSDCTMDGSD-IDVKSLYDSPYSVQTCQNSCFQWEMIKSCGCANYEQPLP 411          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: SCNN1B (sodium channel epithelial 1 beta subunit [Source:HGNC Symbol;Acc:HGNC:10600])

HSP 1 Score: 47.7506 bits (112), Expect = 6.040e-6
Identity = 66/310 (21.29%), Postives = 122/310 (39.35%), Query Frame = 3
Query:  684 ESSVNLSHK-EEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIE--EDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSN--IIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGKTERVKKLKEKPQDTISKNL 1598
            E   NLS   +E++R C+ ++D        C   ++       F +  Y NCF     E+   ++  +  V    +L+                I+    +  LT   G  +++H+  T P + + G+ ++ G    +  E     R  +P   C  + ++  I +L N   Y++  C+ +  Q   I+ CGC    +P P  P +   YC N + +      RY    + +Q + +     T C   C    Y   +S+++W PS    + +  I  L+ E        +   V ++  + QD I  NL
Sbjct:  237 EEKSNLSSSGDELIRSCLFSSDT-------CSATNFTT-----FFHPMYGNCFIFNWGENETVMQVSNPGVEYGLKLV--------------LSIDQDEYIPFLTTIAGAVIMVHDQNTYPFLSDLGVFVKTGVETSVGIEVGQLQRQGAPYSDCTMDGTDLPITNLYNGTAYSVQACLRSCFQTKMIEMCGCGYYLYPLP--PGEK--YCQNQNFTG----WRYCYYKLYEQFVEEDMDCYTICKQPCIESEYKMSISMSDW-PSQSSEDWIFHI--LSKE--------RKHNVSRIFNRKQDIIKLNL 501          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO42137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2F2])

HSP 1 Score: 62.3882 bits (150), Expect = 2.771e-10
Identity = 98/535 (18.32%), Postives = 195/535 (36.45%), Query Frame = 3
Query:  240 EPKQKPLANPQPSPLTLFCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENANRMWQENLVMTPK---KFEELLTNVSINMVKNNRGGGEILYDSAEYYY-------------GNIEYESSVNLSHK-EEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIID----LGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEIL-KRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGKTERVKKLKEKPQDTISKNLNMLTDESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEF 1778
            +PK+  L       +  F +  +  G  ++     +  R  W+ + +    +       L   + +      T     +K +FP ++IC+ N     A+R+        PK   KF++++ N +    +N+        D  +  +              + +Y   V+ +H+ E+IL  C          ++   + +Y      +  N  + NC+        +KTH+ + V   +L S  +  +    +    +  +  ++ +T   G+KV + + G  P     GI + PG+   I    +   R +  K     + + + D     G +  Y++  C  + L    I+ CGC N N P   K  +NIP C   + +  + L K Y+  + +D         D +C   CS  ++D  VS   W    +++ +     ++   N   +   K                       +      ++V     D +   E L       +S +GG   + +G++    AELIE 
Sbjct:    6 DPKETALEQ-----INQFLQETTAHGFGRLGATAGSKWRLYWVMFCLAAYCVFVWQLVGLVNQYNSKPIKTRTQLKHAQKLDFPVVTICNMNVL--RASRL-------PPKLRTKFDQIINNTNKTSPRNSSNSRNAFVDPQDLSFEETKKFEILHAVTAHDDYRELVSAAHQLEDILLSCNFN-GVNCRNSKDPTIPTYWT----QTWNDNFGNCYMFNS----VKTHNGEKV---DLYSSSVPGESNGLTLQLNLEQNEYLEGITEVAGMKVTISDQGVLPFPGQQGIRIMPGQSTGIQMTKLQTRRIDPFKNRSCESSNEMSDKNLFFGYNMTYSIMACKYSCLNARKIERCGCTNYNTPEMQK--RNIPLCNRLNSTIIDCLNKAYD--TFEDGS------CDRECPPSCSEVSFDLTVSSARWPARSFEVTKYAYFLRVRVLNKIASSSSK--------------------YFVNSENIAQVHVYYGELDYLLVQETLAYTFMSLLSDIGGQMGMWIGISALTCAELIEL 484          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO30894 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZH6])

HSP 1 Score: 48.9062 bits (115), Expect = 3.435e-6
Identity = 68/298 (22.82%), Postives = 110/298 (36.91%), Query Frame = 3
Query:  363 WIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENANRMWQENLVMTPKKFEELLTNVSINMVKNNRGGGEILYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPE-KLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSY--KYTMSKCVEAELQKSTIKNCGC 1247
            W+  V+         S+     F+++  +    T + ++  FPA++IC+ NP S++       NL     +    + N  I ++      G +L  S   Y  +I+   S+      + L  C        Y  ++C   S+       F + +Y +C T   D +  LK  S   +S  +L              L       V +      G KV++H+    P IE  G  LQPG     S    + N     +  C     NI D    +   YTM+ C +  L    IK CGC
Sbjct:    1 WLFVVLAGFAGFIYQSFLSITSFYSWPVSTVMMTEWHKEMNFPAVTICNFNPISKSRYAQNYGNLFNLSTQDSNNIINGIIFLI------GPMLGKSLRSYAHSIDGILSL------KWLEPC-------KYSGKECGKNSF-----STFEHLRYGSCHTFNSDGQFGLKVDSIGPISGLQL-------------RLNVEEKDHVSNLYGLQAGFKVLVHDPREHPMIEETGFALQPGTHTFCSVRMKYVNLKAPYRTEC---GENITDFNRYFNVNYTMAICSKQCLHDYGIKKCGC 258          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000045131.1 (SMESG000045131.1)

HSP 1 Score: 1210.28 bits (3130), Expect = 0.000e+0
Identity = 592/592 (100.00%), Postives = 592/592 (100.00%), Query Frame = 3
Query:   27 MSLNDDLSNKDSVWILQKNLGKPKDHTDYSFQCVNCQNYDSVRGVISHXXXXXXXXXVYIHEKLTNKSGYNEPKQKPLANPQPSPLTLFCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENANRMWQENLVMTPKKFEELLTNVSINMVKNNRGGGEILYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGKTERVKKLKEKPQDTISKNLNMLTDESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCYLAFHKT 1802
            MSLNDDLSNKDSVWILQKNLGKPKDHTDYSFQCVNCQNYDSVRGVISHNRNNTNNSNVYIHEKLTNKSGYNEPKQKPLANPQPSPLTLFCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENANRMWQENLVMTPKKFEELLTNVSINMVKNNRGGGEILYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGKTERVKKLKEKPQDTISKNLNMLTDESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCYLAFHKT
Sbjct:    1 MSLNDDLSNKDSVWILQKNLGKPKDHTDYSFQCVNCQNYDSVRGVISHNRNNTNNSNVYIHEKLTNKSGYNEPKQKPLANPQPSPLTLFCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENANRMWQENLVMTPKKFEELLTNVSINMVKNNRGGGEILYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGKTERVKKLKEKPQDTISKNLNMLTDESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCYLAFHKT 592          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000016707.1 (SMESG000016707.1)

HSP 1 Score: 488.419 bits (1256), Expect = 8.417e-166
Identity = 243/521 (46.64%), Postives = 341/521 (65.45%), Query Frame = 3
Query:  276 SPLTLFCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENANRMWQENLVMTPKKFEELLTNVSINMVKNNRGGGEILYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYEC---SSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLAN---------ENYTETDEGK-----TERVKKLKEKPQDTISKNLNMLTDESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCYL 1787
            S   +FCEA S+RGMQKI ++   FL+++WI +V  M+ LL + S  L  DF NY+TAWH ST  DEKT FPAISICSHNPFS+ A+R W+E  ++ P+KF E L  V + ++K+    G+ L D AE YYGN++Y SS+ L H  +IL+YCV+  D +  IAE C + +   + + +FS+  YFNCFTIE   EK     +    T E +S+I+LI +   SDL Q N SFVMD+LTRG G+++V+H VG+ P+I+  GIN+QPGKMNE++F+ IHW RY+SPKR C ++Q  I+DL   Y YT ++C++A + K  ++ C CM++ WPRP  PS+++PYC ++S +   I+KR +C      +     K   V TKC+ +C++ TYD+ +S+T WKPSL KL ++T+ Y+  N         +N TET E        E  ++LK KP  +  K+  +  +E +  YIN+VRKNFDT KK E+L ID  IF+SRVGGLCSL +GLTTA F E+IEF YL
Sbjct:   51 SKFAIFCEASSVRGMQKIHKSKTPFLKALWIAFVFFMSILLIIISTNLVIDFRNYHTAWHVSTELDEKTRFPAISICSHNPFSKQASRYWKEGKILPPEKFRERLFEVEMELIKSGNLPGQTLLDKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYKPTLSHHKSEEIF-NEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFVYL 570          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000064696.1 (SMESG000064696.1)

HSP 1 Score: 397.897 bits (1021), Expect = 5.762e-131
Identity = 207/519 (39.88%), Postives = 309/519 (59.54%), Query Frame = 3
Query:  282 LTLFCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENANRMWQENLVMTPKKFEELLTNVSINMVKNNRGGGEI----LYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSC-STDEILKRYECSS--IKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRV------TQIYKLANENYTETDEGKTERVKKLKEKPQDTISKNLNMLTDESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCYLAFHK 1799
              LFCE  SIRGM KI +AP  FL+ +WI +V  MT+LL + +  L +D+ NY TAWH  T FD+ +EFPAI++CSHNPFS  AN +W++     P+ F E L  V I+ V   +   E+     +D  E YY NI+Y+ S+ +SH  E+L+YC + +D  + I   C+           FS+ K+FNC+TI++             S + + S+IIL+ +TP +D+ ++ +SF+MD L RG G+K+V+HE  + PEIE  GI++QPGKMN I +E + W R+++P + C N QS I DL   + Y+ S C+   LQ   I+ CGCMN+ +PRP  P++ I YC N +  ++ +I    +C+     +    K++  +TKC   C+YFTY+T++S+T W PS  KL R+      T+IY L N    E+ E     ++         I+ +   L +E++FTYI++ RK  +T+ K E LV+D +I MSR+GGLCSL +GLT + F EL+EF YL   K
Sbjct:   28 FNLFCEISSIRGMHKITKAPTLFLKVLWIAFVFCMTSLLFLVTGLLIKDYLNYYTAWHVRTKFDDNSEFPAITLCSHNPFSLRANSLWKKPNAPNPEMFRERLKQVVIDEVNTTKDPNELTLMMFHDKIENYYMNIDYDFSLKISHGTEMLKYCAIFSDGLIIITYNCETEKDKVVEKIVFSHQKFFNCYTIQQTSN---------YSQQTITSLIILVSLTPAADIPELKNSFLMDILERGEGLKLVIHEPNSYPEIEEEGIDVQPGKMNNIKYEPVKWARHSTPPQKCKNGQSPIFDLKRQFNYSFSFCMNYNLQLKLIETCGCMNALFPRPFIPNEKIGYCMNLTHRNSSQIFTNLKCAQDFTMNVKTLKKQWENTKCMQKCNYFTYNTELSITKWVPSYEKLFRIADLINKTEIY-LKNHRERESKEDYISYIQ--ANITNSYINSSFLDLENENKFTYISLSRKTRNTVIKDEELVLDLAILMSRIGGLCSLFIGLTVSFFIELVEFGYLICRK 534          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000081715.1 (SMESG000081715.1)

HSP 1 Score: 382.104 bits (980), Expect = 5.556e-125
Identity = 201/522 (38.51%), Postives = 310/522 (59.39%), Query Frame = 3
Query:  288 LFCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENANRMWQENLVMTPKKFEELLTNVSINMVKN-NRGGGEIL--YDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDE--ILKRYEC-SSIKDQGLTKQKLVDTK-CFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTETDEGKTERVKKLKEKPQDTISKNLNMLT----------------DESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCY 1784
            LFC+  SIRG+ KI  A   F R +W G+VILMT +L V   FL +D+  Y TAWHTST  D  + FPAI++C+ NPFS +ANR+W +  +M+P + ++ LT +S+N   + N  G E L  YD    +Y N+ +  ++ L H ++++RYC+L     + IAE+CDL +   + ++ FS+ +YFNC+TIE     L+ ++ DV+       +I+L+QI P   + ++++SF++D L RG G+KV +H+  T P+IEN GIN+ P KMN + +    W R ++ K PC + Q  I DL   +KY  ++CV AE+Q+  IK CGCM SN PRP  P++ IPYC      T    IL+R  C  +I+ Q +  +K +    CF  C + TY+T +S+T W  +  KL  +  +Y+     +       +E + K+K    ++++++ N+                  DE+ FTYI+++R+NFD   KTE+LV+D++   SR+GGL S+ +GLT AVFAE IEF Y
Sbjct:    6 LFCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYTTAWHTSTELDYPSPFPAITLCAQNPFSIDANRLWSKRKIMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHSKDMIRYCILIYKNDIIIAEKCDLKNE-KFNIKLFSHQEYFNCYTIE----GLEQYTTDVIG------LILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCVENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTANELKLKNLENLYR---SYFAYRHNSSSENIVKIKSILLNSLNRSHNLRHQINKNQFNNLINYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLY 513          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000035185.1 (SMESG000035185.1)

HSP 1 Score: 345.51 bits (885), Expect = 1.530e-111
Identity = 184/532 (34.59%), Postives = 304/532 (57.14%), Query Frame = 3
Query:  258 LANPQPSPLTLFCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENANRMWQENLVMTPKKFEELLTNVSINMVKNNRGGGEI---LYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYC--TNFSCSTDEILKRYEC-SSIKDQGLTKQKLVDTK-CFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYK-LANENYTETDEGKTERVKKLKEKPQDT------------ISKNL--NMLTDESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCYL 1787
            L+    S   LF +  SIRG+ KI  A + F +++WI +VI+MT +L +T  FL +++  Y T WHTST F+++  FP I+ C+ NPFS+ +N +W  N +++P + ++ LT +S+N ++N          LYD    +Y N+    SV + H  +I+RYC++     + +AE C   S    ++  FS+  +FNC+TIE + E           T+ ++ +I ++ I P  ++ +++ SF++D L RG G+K+V+HE    P+I+N G NL P KMN I +    W R  +PK  C +NQ N+ DLG S+KYT   C+E++ Q   I  C CM SN PRP  P+ + PYC   N++ +++ + KR+ C   +++     +++++ + C   C Y TY+T +S+T WK S  KL  + ++Y+   +    ++ E     +  LK   +DT            ++K+L  N + D    TY+++ RKNF+   K E+LV+D++  +SR+GGL SL +GLT A  AE+IEF Y+
Sbjct:    4 LSENSKSKTKLFFQTFSIRGVSKIHHAKSQFEKTLWISFVIIMTFILILTMIFLVKNYLQYITTWHTSTKFEDQAAFPGITFCAQNPFSKKSNEIWMRNQILSPTQMQDKLTLLSLNALENLNNSLLSYLRLYDLFSTFYMNLSPNESVKVGHSRDIIRYCIIMKGHDIDVAENCQ-DSISQLKISLFSHQDFFNCYTIEGEQE----------YTKSIVGLIFILDIVPSDEIYELSKSFLIDMLNRGDGMKIVIHEPHNLPDIDNSGFNLHPSKMNSIVYSQTDWYRLRTPKVNCHDNQPNLYDLGRSFKYTHKHCMESQFQTEVINKCQCMLSNHPRPFLPNSSFPYCLKLNYTNNSEILDKRFSCVEKVQEHFSLNREIIENQFCSLRCRYSTYETTMSLTQWKASEQKLEHLQKLYRSYFSLKQKQSKENINNVINILKSSLKDTKDFRENLRKFHKLNKSLVRNKIND---LTYVSITRKNFEISIKKEKLVLDSNTLLSRMGGLSSLCIGLTAAFVAEIIEFIYI 521          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCNN1A8.664e-829.12sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A1.010e-729.12sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A1.249e-729.12sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A1.365e-733.33sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A4.236e-729.12sodium channel epithelial 1 alpha subunit [Source:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asic-24.231e-1421.43Degenerin-like protein asic-2 [Source:UniProtKB/S... [more]
del-11.140e-723.32Degenerin del-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
del-11.191e-723.32Degenerin del-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
del-11.303e-723.32Degenerin del-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
mec-48.698e-620.85Degenerin mec-4 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ppk264.545e-622.03gene:FBgn0035785 transcript:FBtr0332797[more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
copg23.970e-921.66coatomer protein complex subunit gamma 2 [Source:X... [more]
copg22.094e-822.55coatomer protein complex subunit gamma 2 [Source:X... [more]
foxe36.878e-720.72forkhead box E3 [Source:Xenbase;Acc:XB-GENE-480592... [more]
lhx13.094e-622.06LIM homeobox 1 [Source:Xenbase;Acc:XB-GENE-482482][more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Asic51.327e-820.45acid-sensing (proton-gated) ion channel family mem... [more]
Asic51.816e-720.23acid-sensing (proton-gated) ion channel family mem... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25011|FANA_CORAP3.526e-2121.60FMRFamide-activated amiloride-sensitive sodium cha... [more]
sp|Q22851|ASIC2_CAEEL5.382e-1321.43Degenerin-like protein asic-2 OS=Caenorhabditis el... [more]
sp|Q9R0Y1|ASIC5_MOUSE9.283e-820.45Acid-sensing ion channel 5 OS=Mus musculus OX=1009... [more]
sp|P55270|SCNNA_BOVIN1.887e-725.75Amiloride-sensitive sodium channel subunit alpha O... [more]
sp|P37088|SCNNA_HUMAN4.161e-729.12Amiloride-sensitive sodium channel subunit alpha O... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RFC34.903e-13640.15FMRFamide-activated amiloride-sensitive sodium cha... [more]
A0A0R3UEW82.135e-13539.07Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4Z2DAR52.328e-13239.78FMRFamide-activated amiloride-sensitive sodium cha... [more]
A0A3Q0KNT05.086e-13139.93Putative fmrfamide-gated Na+ channel OS=Schistosom... [more]
A0A183QH378.797e-13140.11Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SCNN1G8.776e-729.59sodium channel epithelial 1 gamma subunit [Source:... [more]
SCNN1B6.040e-621.29sodium channel epithelial 1 beta subunit [Source:H... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO421372.771e-1018.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308943.435e-622.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045131.10.000e+0100.00SMESG000045131.1[more]
SMESG000016707.18.417e-16646.64SMESG000016707.1[more]
SMESG000064696.15.762e-13139.88SMESG000064696.1[more]
SMESG000081715.15.556e-12538.51SMESG000081715.1[more]
SMESG000035185.11.530e-11134.59SMESG000035185.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017031 ID=SMED30017031|Name=FMRFamide-activated amiloride-sensitive sodium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=1832bp
GGTCGACGTGATTACTATTTTTCAGTATGTCTTTGAATGATGATTTATCA
AACAAAGATTCGGTTTGGATTCTTCAGAAAAATCTCGGCAAGCCTAAAGA
TCACACTGACTACAGTTTCCAATGTGTCAATTGTCAAAATTACGATTCCG
TCAGAGGAGTTATCAGTCACAATAGAAACAACACCAACAACAGCAATGTA
TATATTCATGAAAAACTCACAAACAAATCCGGATATAATGAACCGAAACA
AAAACCTTTGGCTAACCCTCAACCTAGTCCCTTGACTTTGTTTTGTGAGG
CGATTTCCATTAGGGGAATGCAGAAAATCGCACGAGCTCCAAATAATTTC
CTTCGTAGCGTTTGGATTGGATACGTAATTTTAATGACAACCTTGTTGAC
GGTAACCTCGTATTTTCTATTTAGAGACTTTTTCAATTATAATACCGCCT
GGCACACTTCAACCGCATTTGATGAAAAAACTGAATTTCCCGCGATTTCG
ATTTGTAGTCACAATCCGTTTTCCGAAAACGCCAATCGAATGTGGCAGGA
GAACTTAGTGATGACACCGAAAAAGTTTGAGGAATTACTGACAAATGTTT
CAATAAATATGGTGAAAAACAACCGAGGCGGAGGTGAGATTCTCTATGAT
TCGGCGGAGTATTATTATGGTAACATTGAGTATGAATCTTCTGTCAATTT
GAGTCACAAGGAAGAAATATTGCGATATTGCGTGCTGACTACGGACGCGT
ATGTCTATATTGCGGAACAATGCGATCTTGCTTCATACGTAGCGTATCGG
TTGAGAAAGTTTTCCAACAGTAAATACTTCAATTGTTTCACCATTGAAGA
AGACCCTGAAAAACTGAAAACCCACTCTGCTGACGTCGTGTCAACCAGGG
AATTGTTGTCGATCATTATTCTCATTCAAATTACTCCAGAATCGGACTTA
ACGCAAATTAATTCCAGTTTTGTCATGGATACTTTAACAAGGGGAACTGG
CGTTAAAGTAGTTTTACATGAAGTTGGAACGTCTCCGGAAATCGAAAATT
ACGGAATCAATTTACAACCTGGAAAAATGAACGAAATCAGCTTTGAAACT
ATTCATTGGAATAGATATAATTCTCCGAAAAGGCCATGCCTCAACAACCA
ATCAAACATAATAGATCTCGGAAACAGTTACAAATACACCATGTCAAAAT
GCGTTGAAGCCGAATTACAAAAGAGTACAATTAAAAATTGCGGTTGTATG
AACAGTAATTGGCCAAGGCCAGTAAAACCCTCTCAGAATATTCCATATTG
CACCAATTTCTCATGTTCCACCGACGAGATACTGAAACGGTATGAGTGTT
CATCTATCAAAGACCAGGGTTTGACAAAACAGAAATTAGTCGACACGAAA
TGTTTTGGAGTTTGTTCCTATTTCACCTATGACACAAAGGTATCTGTCAC
GAATTGGAAGCCGTCTTTGTATAAACTAAATAGAGTAACCCAAATTTATA
AGTTAGCCAACGAAAACTATACAGAGACAGATGAAGGGAAAACCGAAAGG
GTTAAAAAGTTAAAAGAGAAACCTCAAGATACAATATCGAAGAATTTGAA
CATGTTGACAGACGAATCAAGATTCACTTATATTAATGTCGTTCGGAAAA
ATTTCGACACAATTAAAAAGACTGAAAGATTAGTTATTGACGCATCTATT
TTTATGTCTCGAGTGGGGGGGCTCTGTTCATTGCTTGTCGGTCTGACGAC
CGCCGTGTTTGCTGAACTCATCGAATTTTGCTATTTGGCGTTTCATAAAA
CTTAATTTATTGGAATTATAAGTCCAGATGAG
back to top

protein sequence of SMED30017031-orf-1

>SMED30017031-orf-1 ID=SMED30017031-orf-1|Name=SMED30017031-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=593bp
MSLNDDLSNKDSVWILQKNLGKPKDHTDYSFQCVNCQNYDSVRGVISHNR
NNTNNSNVYIHEKLTNKSGYNEPKQKPLANPQPSPLTLFCEAISIRGMQK
IARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRDFFNYNTAWHTSTAFDE
KTEFPAISICSHNPFSENANRMWQENLVMTPKKFEELLTNVSINMVKNNR
GGGEILYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCD
LASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILI
QITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGK
MNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKS
TIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYECSSIKDQGLT
KQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLANENYTE
TDEGKTERVKKLKEKPQDTISKNLNMLTDESRFTYINVVRKNFDTIKKTE
RLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCYLAFHKT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 325..343
score: 27.79
coord: 398..415
score: 35.56
coord: 459..479
score: 23.24
coord: 150..166
score: 42.59
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 89..584
e-value: 2.5E-54
score: 184.9
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 85..589
NoneNo IPR availableGENE3DG3DSA:1.10.287.770coord: 110..582
e-value: 1.4E-36
score: 128.3
NoneNo IPR availableGENE3DG3DSA:1.10.287.820coord: 363..463
e-value: 1.4E-36
score: 128.3
NoneNo IPR availableGENE3DG3DSA:1.10.3590.10coord: 163..325
e-value: 1.4E-36
score: 128.3
NoneNo IPR availableGENE3DG3DSA:2.60.470.10coord: 140..552
e-value: 1.4E-36
score: 128.3
NoneNo IPR availablePANTHERPTHR11690:SF222PICKPOCKET 6-RELATEDcoord: 85..589
NoneNo IPR availableTMHMMTMhelixcoord: 108..130