Phosphodiesterase
Overview
Neoblast Clusters
Zeng et. al., 2018
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny AppEmbryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Homology
BLAST of Phosphodiesterase vs. TrEMBL
Match: C3Y1E6 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_83680 PE=4 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 9.777e-9 Identity = 22/42 (52.38%), Postives = 33/42 (78.57%), Query Frame = 3 Query: 6 FWPWTVPNDSQPVYVLYMFKDLFGLE*FDAEILMRFVLTVKK 131 + PW++P+D +P+YV+ MFKDLF + FD E L+RF +TV+K Sbjct: 551 YSPWSIPDDVKPLYVILMFKDLFCMSKFDMEQLIRFTMTVRK 592
BLAST of Phosphodiesterase vs. TrEMBL
Match: R7UJM9 (Phosphodiesterase OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_155235 PE=3 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 1.300e-8 Identity = 24/42 (57.14%), Postives = 31/42 (73.81%), Query Frame = 3 Query: 6 FWPWTVPNDSQPVYVLYMFKDLFGLE*FDAEILMRFVLTVKK 131 F PW+V ND +P+YV+YMF+DLF FD L+RF LTV+K Sbjct: 281 FSPWSVTNDEKPLYVIYMFRDLFSTARFDMGSLIRFTLTVRK 322
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A1W0WNA2 (Phosphodiesterase OS=Hypsibius dujardini OX=232323 GN=BV898_09205 PE=3 SV=1) HSP 1 Score: 52.7582 bits (125), Expect = 1.102e-6 Identity = 22/42 (52.38%), Postives = 30/42 (71.43%), Query Frame = 3 Query: 6 FWPWTVPNDSQPVYVLYMFKDLFGLE*FDAEILMRFVLTVKK 131 F PW + +P+ V+YMF+DLFGL FD + L+RF LTV+K Sbjct: 497 FSPWKLTEFQKPLSVIYMFRDLFGLTRFDLDTLIRFSLTVRK 538
BLAST of Phosphodiesterase vs. TrEMBL
Match: A0A2T7NR97 (Phosphodiesterase OS=Pomacea canaliculata OX=400727 GN=C0Q70_16967 PE=3 SV=1) HSP 1 Score: 51.9878 bits (123), Expect = 2.003e-6 Identity = 22/43 (51.16%), Postives = 30/43 (69.77%), Query Frame = 3 Query: 3 SFWPWTVPNDSQPVYVLYMFKDLFGLE*FDAEILMRFVLTVKK 131 +F PW+V ++ +P+ VLYM +DLF FD LMRF LTV+K Sbjct: 629 TFSPWSVEDNKKPLQVLYMLRDLFSPMRFDTTDLMRFTLTVRK 671
BLAST of Phosphodiesterase vs. TrEMBL
Match: V4BHX7 (PDEase domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_228057 PE=3 SV=1) HSP 1 Score: 51.6026 bits (122), Expect = 2.637e-6 Identity = 22/42 (52.38%), Postives = 29/42 (69.05%), Query Frame = 3 Query: 6 FWPWTVPNDSQPVYVLYMFKDLFGLE*FDAEILMRFVLTVKK 131 + PW++ + +P+YVL MFKDLF FD LMRF LTV+K Sbjct: 140 YSPWSINDTEKPMYVLDMFKDLFSYTRFDINDLMRFTLTVRK 181
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000044149.1 (SMESG000044149.1) HSP 1 Score: 95.5153 bits (236), Expect = 2.495e-25 Identity = 42/43 (97.67%), Postives = 42/43 (97.67%), Query Frame = 3 Query: 3 SFWPWTVPNDSQPVYVLYMFKDLFGLE*FDAEILMRFVLTVKK 131 SFWPWTVPNDSQPVYVLYMFKDLFGLE FDAEILMRFVLTVKK Sbjct: 590 SFWPWTVPNDSQPVYVLYMFKDLFGLELFDAEILMRFVLTVKK 632
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000044149.1 (SMESG000044149.1) HSP 1 Score: 84.3445 bits (207), Expect = 1.974e-21 Identity = 42/61 (68.85%), Postives = 42/61 (68.85%), Query Frame = 3 Query: 3 SFWPWTVPNDSQPVYVLYMFKDLFGLE------------------*FDAEILMRFVLTVKK 131 SFWPWTVPNDSQPVYVLYMFKDLFGLE FDAEILMRFVLTVKK Sbjct: 590 SFWPWTVPNDSQPVYVLYMFKDLFGLELINVERRTGSESYIEFDDRFDAEILMRFVLTVKK 650
BLAST of Phosphodiesterase vs. Planmine SMEST
Match: SMESG000044149.1 (SMESG000044149.1) HSP 1 Score: 84.3445 bits (207), Expect = 2.352e-21 Identity = 42/61 (68.85%), Postives = 42/61 (68.85%), Query Frame = 3 Query: 3 SFWPWTVPNDSQPVYVLYMFKDLFGLE------------------*FDAEILMRFVLTVKK 131 SFWPWTVPNDSQPVYVLYMFKDLFGLE FDAEILMRFVLTVKK Sbjct: 572 SFWPWTVPNDSQPVYVLYMFKDLFGLELINVERRTGSESYIEFDDRFDAEILMRFVLTVKK 632 The following BLAST results are available for this feature:
BLAST of Phosphodiesterase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of Phosphodiesterase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of Phosphodiesterase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of Phosphodiesterase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of Phosphodiesterase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of Phosphodiesterase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of Phosphodiesterase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of Phosphodiesterase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of Phosphodiesterase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of Phosphodiesterase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of Phosphodiesterase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of Phosphodiesterase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of Phosphodiesterase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of Phosphodiesterase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 3
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30017021 ID=SMED30017021|Name=Phosphodiesterase|organism=Schmidtea mediterranea sexual|type=transcript|length=133bpback to top Annotated Terms
The following terms have been associated with this transcript:
|