Vesicle-associated membrane protein 3

Overview
NameVesicle-associated membrane protein 3
Smed IDSMED30017013
Length (bp)565
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Vesicle-associated membrane protein 3 (SMED30017013) t-SNE clustered cells

Violin plots show distribution of expression levels for Vesicle-associated membrane protein 3 (SMED30017013) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Vesicle-associated membrane protein 3 (SMED30017013) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Vesicle-associated membrane protein 3 (SMED30017013) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30017013

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30017013SMESG000079659.1 SMESG000079651.1 Contig154GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30017013SMESG000079659.1 SMESG000079651.1 Contig154GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30017013SMESG000079659.1 SMESG000079651.1 Contig154GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30017013SMESG000033382.1 Contig3395GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30017013SMESG000033382.1 Contig3395GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30017013SMESG000033382.1 Contig3395GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30017013SMESG000033382.1 Contig154GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30017013SMESG000033382.1 Contig154GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30017013SMESG000033382.1 Contig154GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30017013SMESG000033382.1 dd_Smed_v4_1311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30017013SMESG000033382.1 dd_Smed_v4_1311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30017013SMESG000033382.1 dd_Smed_v4_1311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30017013SMESG000033382.1 dd_Smed_v4_1311_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Human
Match: VAMP3 (vesicle associated membrane protein 3 [Source:HGNC Symbol;Acc:HGNC:12644])

HSP 1 Score: 68.1662 bits (165), Expect = 1.061e-14
Identity = 32/78 (41.03%), Postives = 48/78 (61.54%), Query Frame = 2
Query:   50 SYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
            S G       N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRK+WWKN KMW
Sbjct:    2 STGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 79          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Human
Match: AC129492.3 (novel protein)

HSP 1 Score: 64.6994 bits (156), Expect = 3.447e-13
Identity = 29/67 (43.28%), Postives = 46/67 (68.66%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRK+WWKN+KM
Sbjct:   29 NRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKM 95          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Human
Match: VAMP2 (vesicle associated membrane protein 2 [Source:HGNC Symbol;Acc:HGNC:12643])

HSP 1 Score: 64.3142 bits (155), Expect = 3.917e-13
Identity = 29/67 (43.28%), Postives = 46/67 (68.66%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRK+WWKN+KM
Sbjct:   29 NRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKM 95          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Human
Match: VAMP2 (vesicle associated membrane protein 2 [Source:HGNC Symbol;Acc:HGNC:12643])

HSP 1 Score: 64.3142 bits (155), Expect = 4.695e-13
Identity = 29/67 (43.28%), Postives = 46/67 (68.66%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRK+WWKN+KM
Sbjct:   31 NRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKM 97          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Human
Match: VAMP2 (vesicle associated membrane protein 2 [Source:HGNC Symbol;Acc:HGNC:12643])

HSP 1 Score: 63.929 bits (154), Expect = 4.772e-13
Identity = 29/67 (43.28%), Postives = 46/67 (68.66%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRK+WWKN+KM
Sbjct:   29 NRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKM 95          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Celegans
Match: snb-1 (Synaptobrevin-1 [Source:UniProtKB/Swiss-Prot;Acc:O02495])

HSP 1 Score: 62.003 bits (149), Expect = 9.232e-13
Identity = 27/67 (40.30%), Postives = 47/67 (70.15%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N++L + Q  VD++   M+ N++KV+ER+  LS + ++A+ L + +S +   AA +KRK+WWKN+KM
Sbjct:   21 NKRLQQTQAQVDEVVGIMKVNVEKVLERDQKLSQLDDRADALQEGASQFEKSAATLKRKYWWKNIKM 87          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Celegans
Match: snb-2 (SyNaptoBrevin related [Source:UniProtKB/TrEMBL;Acc:Q19767])

HSP 1 Score: 51.2174 bits (121), Expect = 1.069e-8
Identity = 23/81 (28.40%), Postives = 48/81 (59.26%), Query Frame = 2
Query:   38 AGNNSYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            AGN         +  +++   Q  V+++   M+ N+ KVMER+  L+++ ++AEVL   +S +   +  +++K+WW+N++M
Sbjct:   13 AGNGEAQPPTGTYNTKRMQMAQAQVNEVIDVMRNNVNKVMERDVQLNSLDHRAEVLQNGASQFQQSSRTLRQKYWWQNIRM 93          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Celegans
Match: snb-2 (SyNaptoBrevin related [Source:UniProtKB/TrEMBL;Acc:Q19767])

HSP 1 Score: 51.2174 bits (121), Expect = 1.069e-8
Identity = 23/81 (28.40%), Postives = 48/81 (59.26%), Query Frame = 2
Query:   38 AGNNSYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            AGN         +  +++   Q  V+++   M+ N+ KVMER+  L+++ ++AEVL   +S +   +  +++K+WW+N++M
Sbjct:   13 AGNGEAQPPTGTYNTKRMQMAQAQVNEVIDVMRNNVNKVMERDVQLNSLDHRAEVLQNGASQFQQSSRTLRQKYWWQNIRM 93          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Celegans
Match: snb-5 (Synaptobrevin-like protein 5 [Source:UniProtKB/Swiss-Prot;Acc:P34351])

HSP 1 Score: 49.6766 bits (117), Expect = 3.039e-8
Identity = 22/63 (34.92%), Postives = 41/63 (65.08%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWK 268
            ++K+ + + ++D +   M+EN+QK+MER   L  +  +A+ L ++S +YV  A K+KR+  WK
Sbjct:   15 DQKIMRTRRELDSVKAIMKENVQKIMERQGKLDDLVERAQRLEEASDVYVKCAVKIKREMSWK 77          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Celegans
Match: snb-7 (SyNaptoBrevin related [Source:UniProtKB/TrEMBL;Acc:G5EBK2])

HSP 1 Score: 49.6766 bits (117), Expect = 3.334e-8
Identity = 22/63 (34.92%), Postives = 41/63 (65.08%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWK 268
            ++K+ + + ++D +   M+EN+QK+MER   L  +  +A+ L ++S +YV  A K+KR+  WK
Sbjct:   15 DQKIMRTRRELDSVKAIMKENVQKIMERQGKLDDLVERAQRLEEASDVYVKCAVKIKREMSWK 77          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Fly
Match: nSyb (gene:FBgn0013342 transcript:FBtr0306578)

HSP 1 Score: 62.3882 bits (150), Expect = 1.540e-12
Identity = 27/65 (41.54%), Postives = 45/65 (69.23%), Query Frame = 2
Query:   86 KLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            +L + Q  VD++   M+ N++KV+ER+  LS + ++A+ L Q +S +  QA K+KRKFW +N+KM
Sbjct:   50 RLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKM 114          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Fly
Match: nSyb (gene:FBgn0013342 transcript:FBtr0302310)

HSP 1 Score: 62.3882 bits (150), Expect = 1.540e-12
Identity = 27/65 (41.54%), Postives = 45/65 (69.23%), Query Frame = 2
Query:   86 KLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            +L + Q  VD++   M+ N++KV+ER+  LS + ++A+ L Q +S +  QA K+KRKFW +N+KM
Sbjct:   50 RLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKM 114          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Fly
Match: nSyb (gene:FBgn0013342 transcript:FBtr0331462)

HSP 1 Score: 62.003 bits (149), Expect = 1.729e-12
Identity = 27/65 (41.54%), Postives = 45/65 (69.23%), Query Frame = 2
Query:   86 KLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            +L + Q  VD++   M+ N++KV+ER+  LS + ++A+ L Q +S +  QA K+KRKFW +N+KM
Sbjct:   41 RLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKM 105          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Fly
Match: Syb (gene:FBgn0003660 transcript:FBtr0088363)

HSP 1 Score: 61.2326 bits (147), Expect = 3.509e-12
Identity = 34/83 (40.96%), Postives = 50/83 (60.24%), Query Frame = 2
Query:   47 NSYGSIDQPFRN-----EKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N +G  D   RN     +KL + Q  VD++   M+ N++KV+ER+  LS +  +A+ L Q +S +  QA K+KRK WW NMKM
Sbjct:   31 NQFG--DHQIRNNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQFEQQAGKLKRKQWWANMKM 111          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Fly
Match: nSyb (gene:FBgn0013342 transcript:FBtr0072815)

HSP 1 Score: 62.3882 bits (150), Expect = 4.075e-12
Identity = 27/65 (41.54%), Postives = 45/65 (69.23%), Query Frame = 2
Query:   86 KLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            +L + Q  VD++   M+ N++KV+ER+  LS + ++A+ L Q +S +  QA K+KRKFW +N+KM
Sbjct:   41 RLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKM 105          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Zebrafish
Match: vamp3 (vesicle-associated membrane protein 3 (cellubrevin) [Source:ZFIN;Acc:ZDB-GENE-040625-45])

HSP 1 Score: 69.3218 bits (168), Expect = 2.185e-15
Identity = 34/81 (41.98%), Postives = 52/81 (64.20%), Query Frame = 2
Query:   41 GNNSYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
            G ++ GS      N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRKFWWKN+KMW
Sbjct:    5 GADASGS---SGSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKFWWKNVKMW 82          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Zebrafish
Match: vamp3 (vesicle-associated membrane protein 3 (cellubrevin) [Source:ZFIN;Acc:ZDB-GENE-040625-45])

HSP 1 Score: 69.3218 bits (168), Expect = 2.185e-15
Identity = 34/81 (41.98%), Postives = 52/81 (64.20%), Query Frame = 2
Query:   41 GNNSYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
            G ++ GS      N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRKFWWKN+KMW
Sbjct:    5 GADASGS---SGSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKFWWKNVKMW 82          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Zebrafish
Match: vamp3 (vesicle-associated membrane protein 3 (cellubrevin) [Source:ZFIN;Acc:ZDB-GENE-040625-45])

HSP 1 Score: 69.3218 bits (168), Expect = 2.401e-15
Identity = 34/81 (41.98%), Postives = 52/81 (64.20%), Query Frame = 2
Query:   41 GNNSYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
            G ++ GS      N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRKFWWKN+KMW
Sbjct:    5 GADASGSSGS---NRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKFWWKNVKMW 82          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Zebrafish
Match: vamp2 (vesicle-associated membrane protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-8225])

HSP 1 Score: 60.8474 bits (146), Expect = 4.275e-12
Identity = 28/67 (41.79%), Postives = 44/67 (65.67%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+K K+WWKN KM
Sbjct:   23 NRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKNKYWWKNAKM 89          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Zebrafish
Match: vamp1 (vesicle-associated membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2725])

HSP 1 Score: 60.077 bits (144), Expect = 9.956e-12
Identity = 30/77 (38.96%), Postives = 48/77 (62.34%), Query Frame = 2
Query:   56 GSIDQPF---RNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMK 277
            G+  QP     N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + + AAK+K K+WWKNMK
Sbjct:   21 GAPAQPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKNKYWWKNMK 97          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Xenopus
Match: vamp8 (putative ferric-chelate reductase 1 [Source:Xenbase;Acc:XB-GENE-5813499])

HSP 1 Score: 65.4698 bits (158), Expect = 1.081e-13
Identity = 29/75 (38.67%), Postives = 46/75 (61.33%), Query Frame = 2
Query:   56 GSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            G  + P   E++  LQ+ VDD+   M +N+++++ R +NL  + N+ E L  SS  + T + KV RK+WWKN KM
Sbjct:    8 GGANAPAAPERVRDLQSQVDDVKGIMSQNVERILARGENLDHLRNKTEDLEASSEHFKTTSQKVARKYWWKNAKM 82          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Xenopus
Match: vamp8 (putative ferric-chelate reductase 1 [Source:Xenbase;Acc:XB-GENE-5813499])

HSP 1 Score: 65.4698 bits (158), Expect = 1.164e-13
Identity = 29/75 (38.67%), Postives = 46/75 (61.33%), Query Frame = 2
Query:   56 GSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            G  + P   E++  LQ+ VDD+   M +N+++++ R +NL  + N+ E L  SS  + T + KV RK+WWKN KM
Sbjct:    8 GGANAPAAPERVRDLQSQVDDVKGIMSQNVERILARGENLDHLRNKTEDLEASSEHFKTTSQKVARKYWWKNAKM 82          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Xenopus
Match: vamp3 (vesicle associated membrane protein 3 [Source:NCBI gene;Acc:549726])

HSP 1 Score: 65.0846 bits (157), Expect = 1.336e-13
Identity = 29/68 (42.65%), Postives = 46/68 (67.65%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
            N +L + Q  V+++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRK+WWKN KMW
Sbjct:   14 NRRLQQTQAQVNEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 81          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Xenopus
Match: vamp3 (vesicle associated membrane protein 3 [Source:NCBI gene;Acc:549726])

HSP 1 Score: 65.0846 bits (157), Expect = 1.739e-13
Identity = 29/68 (42.65%), Postives = 46/68 (67.65%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
            N +L + Q  V+++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRK+WWKN KMW
Sbjct:   14 NRRLQQTQAQVNEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 81          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Xenopus
Match: idh1 (isocitrate dehydrogenase 1 (NADP+) [Source:Xenbase;Acc:XB-GENE-1004994])

HSP 1 Score: 59.3066 bits (142), Expect = 2.699e-11
Identity = 28/76 (36.84%), Postives = 48/76 (63.16%), Query Frame = 2
Query:   56 GSIDQPFR-NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            GS   P   N +L + Q  V+++   M+ N+ KV++R+  L+ + ++A+ L   +S + T AAK+KRK+WW+N KM
Sbjct:   14 GSGGPPASSNRRLLQTQAQVNEVVDIMRVNVDKVLDRDQKLAELDDRADALQAGASQFETSAAKLKRKYWWRNCKM 89          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Mouse
Match: Vamp3 (vesicle-associated membrane protein 3 [Source:MGI Symbol;Acc:MGI:1321389])

HSP 1 Score: 67.781 bits (164), Expect = 8.735e-15
Identity = 33/83 (39.76%), Postives = 50/83 (60.24%), Query Frame = 2
Query:   35 MAGNNSYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
            M+     GS      N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRK+WWKN KMW
Sbjct:    1 MSTGVPSGSSAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 83          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Mouse
Match: Vamp2 (vesicle-associated membrane protein 2 [Source:MGI Symbol;Acc:MGI:1313277])

HSP 1 Score: 63.929 bits (154), Expect = 3.276e-13
Identity = 29/67 (43.28%), Postives = 46/67 (68.66%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRK+WWKN+KM
Sbjct:   29 NRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKM 95          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Mouse
Match: Vamp2 (vesicle-associated membrane protein 2 [Source:MGI Symbol;Acc:MGI:1313277])

HSP 1 Score: 64.6994 bits (156), Expect = 5.223e-13
Identity = 29/67 (43.28%), Postives = 46/67 (68.66%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRK+WWKN+KM
Sbjct:   29 NRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKM 95          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Mouse
Match: Vamp1 (vesicle-associated membrane protein 1 [Source:MGI Symbol;Acc:MGI:1313276])

HSP 1 Score: 60.4622 bits (145), Expect = 6.605e-12
Identity = 27/67 (40.30%), Postives = 45/67 (67.16%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N +L + Q  V+++   M+ N+ KV+ER+  LS + ++A+ L   +S + + AAK+KRK+WWKN KM
Sbjct:   31 NRRLQQTQAQVEEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKM 97          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Mouse
Match: Vamp1 (vesicle-associated membrane protein 1 [Source:MGI Symbol;Acc:MGI:1313276])

HSP 1 Score: 60.4622 bits (145), Expect = 7.438e-12
Identity = 27/67 (40.30%), Postives = 45/67 (67.16%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N +L + Q  V+++   M+ N+ KV+ER+  LS + ++A+ L   +S + + AAK+KRK+WWKN KM
Sbjct:   31 NRRLQQTQAQVEEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKM 97          
BLAST of Vesicle-associated membrane protein 3 vs. UniProt/SwissProt
Match: sp|Q4R8T0|VAMP3_MACFA (Vesicle-associated membrane protein 3 OS=Macaca fascicularis OX=9541 GN=VAMP3 PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.314e-15
Identity = 33/78 (42.31%), Postives = 49/78 (62.82%), Query Frame = 2
Query:   50 SYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
            S G    P  N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRK+WWKN KMW
Sbjct:    2 STGPTAAPGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 79          
BLAST of Vesicle-associated membrane protein 3 vs. UniProt/SwissProt
Match: sp|Q15836|VAMP3_HUMAN (Vesicle-associated membrane protein 3 OS=Homo sapiens OX=9606 GN=VAMP3 PE=1 SV=3)

HSP 1 Score: 68.1662 bits (165), Expect = 5.096e-14
Identity = 32/78 (41.03%), Postives = 48/78 (61.54%), Query Frame = 2
Query:   50 SYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
            S G       N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRK+WWKN KMW
Sbjct:    2 STGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 79          
BLAST of Vesicle-associated membrane protein 3 vs. UniProt/SwissProt
Match: sp|P63025|VAMP3_RAT (Vesicle-associated membrane protein 3 OS=Rattus norvegicus OX=10116 GN=Vamp3 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.110e-14
Identity = 33/83 (39.76%), Postives = 50/83 (60.24%), Query Frame = 2
Query:   35 MAGNNSYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
            M+     GS      N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRK+WWKN KMW
Sbjct:    1 MSTGVPSGSSAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 83          
BLAST of Vesicle-associated membrane protein 3 vs. UniProt/SwissProt
Match: sp|P63024|VAMP3_MOUSE (Vesicle-associated membrane protein 3 OS=Mus musculus OX=10090 GN=Vamp3 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 6.110e-14
Identity = 33/83 (39.76%), Postives = 50/83 (60.24%), Query Frame = 2
Query:   35 MAGNNSYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
            M+     GS      N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRK+WWKN KMW
Sbjct:    1 MSTGVPSGSSAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMW 83          
BLAST of Vesicle-associated membrane protein 3 vs. UniProt/SwissProt
Match: sp|P47193|VAMP2_XENLA (Vesicle-associated membrane protein 2 OS=Xenopus laevis OX=8355 GN=vamp2 PE=3 SV=3)

HSP 1 Score: 65.4698 bits (158), Expect = 6.233e-13
Identity = 30/67 (44.78%), Postives = 46/67 (68.66%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRK+WWKNMKM
Sbjct:   27 NRRLQQTQAQVDEVVDIMRVNVDKVLERDTKLSELDDRADALQAGASQFETSAAKLKRKYWWKNMKM 93          
BLAST of Vesicle-associated membrane protein 3 vs. TrEMBL
Match: A0A1W3JUS4 (vesicle-associated membrane protein 3 isoform X8 OS=Ciona intestinalis OX=7719 GN=LOC100183031 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 6.188e-15
Identity = 37/87 (42.53%), Postives = 55/87 (63.22%), Query Frame = 2
Query:   38 AGNNSYGSIDQPF-----RNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
             G ++YG    P       ++KL + Q  VDD+   M+ N+ KV+ER+  LS + ++A+ L Q +S + TQAAK+KRK+WWKN KMW
Sbjct:    4 GGTSNYGGPAAPTGGSSQASKKLQQTQAQVDDVVDIMRTNVDKVLERDQKLSELDDRADALQQGASQFETQAAKLKRKYWWKNCKMW 90          
BLAST of Vesicle-associated membrane protein 3 vs. TrEMBL
Match: A0A1W3JIL8 (vesicle-associated membrane protein 3 isoform X4 OS=Ciona intestinalis OX=7719 GN=LOC100183031 PE=4 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 7.332e-15
Identity = 37/87 (42.53%), Postives = 55/87 (63.22%), Query Frame = 2
Query:   38 AGNNSYGSIDQPF-----RNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
             G ++YG    P       ++KL + Q  VDD+   M+ N+ KV+ER+  LS + ++A+ L Q +S + TQAAK+KRK+WWKN KMW
Sbjct:   14 GGTSNYGGPAAPTGGSSQASKKLQQTQAQVDDVVDIMRTNVDKVLERDQKLSELDDRADALQQGASQFETQAAKLKRKYWWKNCKMW 100          
BLAST of Vesicle-associated membrane protein 3 vs. TrEMBL
Match: A0A1W3JJ63 (vesicle-associated membrane protein 3 isoform X6 OS=Ciona intestinalis OX=7719 GN=LOC100183031 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 7.341e-15
Identity = 37/87 (42.53%), Postives = 55/87 (63.22%), Query Frame = 2
Query:   38 AGNNSYGSIDQPF-----RNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
             G ++YG    P       ++KL + Q  VDD+   M+ N+ KV+ER+  LS + ++A+ L Q +S + TQAAK+KRK+WWKN KMW
Sbjct:   14 GGTSNYGGPAAPTGGSSQASKKLQQTQAQVDDVVDIMRTNVDKVLERDQKLSELDDRADALQQGASQFETQAAKLKRKYWWKNCKMW 100          
BLAST of Vesicle-associated membrane protein 3 vs. TrEMBL
Match: F7A7Z6 (V-SNARE coiled-coil homology domain-containing protein OS=Ciona intestinalis OX=7719 PE=4 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 7.628e-15
Identity = 37/86 (43.02%), Postives = 55/86 (63.95%), Query Frame = 2
Query:   41 GNNSYGSIDQPF-----RNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
            G ++YG    P       ++KL + Q  VDD+   M+ N+ KV+ER+  LS + ++A+ L Q +S + TQAAK+KRK+WWKN KMW
Sbjct:    1 GTSNYGGPAAPTGGSSQASKKLQQTQAQVDDVVDIMRTNVDKVLERDQKLSELDDRADALQQGASQFETQAAKLKRKYWWKNCKMW 86          
BLAST of Vesicle-associated membrane protein 3 vs. TrEMBL
Match: Q8T897 (Similar to vesicle associated menbrane protein, cellubrevin OS=Halocynthia roretzi OX=7729 GN=HrCellubrevin PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.447e-13
Identity = 33/82 (40.24%), Postives = 54/82 (65.85%), Query Frame = 2
Query:   38 AGNNSYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
             G ++ G+      +++L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L Q +S + TQAAK+KRK+WWKN KMW
Sbjct:    4 GGTDNSGAPAGGTSSKRLQQTQAQVDEVVDIMRTNVDKVLERDQKLSELDDRADALQQGASQFETQAAKLKRKYWWKNCKMW 85          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Cavefish
Match: vamp3 (vesicle associated membrane protein 3 [Source:NCBI gene;Acc:103022570])

HSP 1 Score: 67.781 bits (164), Expect = 6.480e-15
Identity = 31/68 (45.59%), Postives = 46/68 (67.65%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
            N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRKFWWKN KMW
Sbjct:   15 NRRLQQTQAQVDEVVDIMRVNVDKVLERDSKLSELDDRADALQAGASQFETNAAKLKRKFWWKNCKMW 82          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Cavefish
Match: vamp4 (vesicle associated membrane protein 4 [Source:NCBI gene;Acc:103022620])

HSP 1 Score: 62.7734 bits (151), Expect = 1.485e-12
Identity = 29/84 (34.52%), Postives = 54/84 (64.29%), Query Frame = 2
Query:   29 YFMAGNNSYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            +F+ G        QP  N+K+ ++Q+ VD++   MQENI KV+ER + L  + +++E L  ++S + ++A ++ R+ WW++MKM
Sbjct:   36 FFLRGPTG-PRFGQP--NDKIRQVQSQVDEVIDVMQENISKVIERGERLDDLQDKSESLSDNASAFSSRAKQLHRRMWWRDMKM 116          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Cavefish
Match: vamp4 (vesicle associated membrane protein 4 [Source:NCBI gene;Acc:103022620])

HSP 1 Score: 62.7734 bits (151), Expect = 1.605e-12
Identity = 29/84 (34.52%), Postives = 54/84 (64.29%), Query Frame = 2
Query:   29 YFMAGNNSYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            +F+ G        QP  N+K+ ++Q+ VD++   MQENI KV+ER + L  + +++E L  ++S + ++A ++ R+ WW++MKM
Sbjct:   49 FFLRGPTG-PRFGQP--NDKIRQVQSQVDEVIDVMQENISKVIERGERLDDLQDKSESLSDNASAFSSRAKQLHRRMWWRDMKM 129          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Cavefish
Match: vamp2 (vesicle associated membrane protein 2 [Source:NCBI gene;Acc:103027046])

HSP 1 Score: 60.077 bits (144), Expect = 7.469e-12
Identity = 28/67 (41.79%), Postives = 44/67 (65.67%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+K K+WWKN KM
Sbjct:   25 NRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKNKYWWKNAKM 91          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Cavefish
Match: vamp2 (vesicle associated membrane protein 2 [Source:NCBI gene;Acc:103027046])

HSP 1 Score: 60.077 bits (144), Expect = 8.811e-12
Identity = 28/67 (41.79%), Postives = 44/67 (65.67%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+K K+WWKN KM
Sbjct:   30 NRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKNKYWWKNAKM 96          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008529.1 (pep scaffold:Pmarinus_7.0:GL484641:5659:9131:-1 gene:ENSPMAG00000007726.1 transcript:ENSPMAT00000008529.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 4.659e-14
Identity = 29/67 (43.28%), Postives = 46/67 (68.66%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L Q +S + + AAK+KRK+WWKN KM
Sbjct:   30 NRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQQGASQFESSAAKLKRKYWWKNCKM 96          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Yeast
Match: SNC2 (Vesicle membrane receptor protein (v-SNARE); involved in the fusion between Golgi-derived secretory vesicles with the plasma membrane; Snc2p levels regulated by Vps45p; member of the synaptobrevin/VAMP family of R-type v-SNARE proteins; SNC2 has a paralog, SNC1, that arose from the whole genome duplication [Source:SGD;Acc:S000005854])

HSP 1 Score: 51.6026 bits (122), Expect = 1.714e-9
Identity = 24/70 (34.29%), Postives = 43/70 (61.43%), Query Frame = 2
Query:   71 PFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            P    K   L+ ++DD    M++NI KV ER + L++I ++A+ L  S+  +   A +V+++ WWK++KM
Sbjct:   22 PNSQNKTAALRQEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWWKDLKM 91          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Yeast
Match: SNC1 (Vesicle membrane receptor protein (v-SNARE); involved in the fusion between Golgi-derived secretory vesicles with the plasma membrane; proposed to be involved in endocytosis; member of the synaptobrevin/VAMP family of R-type v-SNARE proteins; SNC1 has a paralog, SNC2, that arose from the whole genome duplication [Source:SGD;Acc:S000000028])

HSP 1 Score: 50.0618 bits (118), Expect = 6.993e-9
Identity = 22/65 (33.85%), Postives = 42/65 (64.62%), Query Frame = 2
Query:   86 KLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            +  +LQ ++DD    M++NI KV ER + L++I ++A+ L  S+  +   A +V++  W+K++KM
Sbjct:   28 RTAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMWYKDLKM 92          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Nematostella
Match: EDO42383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1M0])

HSP 1 Score: 55.8398 bits (133), Expect = 4.657e-11
Identity = 25/67 (37.31%), Postives = 45/67 (67.16%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            +++L + Q  VD++   M+ N+ KV+ER+  LS + N+A+ L   +S + T A+++KRK WW+N K+
Sbjct:    3 SKRLQQTQAQVDEVVDIMKVNVDKVLERDAKLSELDNRADALQAGASQFETSASRLKRKMWWQNCKV 69          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Nematostella
Match: EDO43738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXX6])

HSP 1 Score: 51.6026 bits (122), Expect = 2.314e-8
Identity = 22/72 (30.56%), Postives = 46/72 (63.89%), Query Frame = 2
Query:   71 PFR--NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            P R   + + K+Q +VD++   M +NI+KV+ER + +  + ++AE L  S+  +   ++++++K WW+N +M
Sbjct:  121 PGRAGGDAINKVQREVDEVKDVMTKNIEKVLERGERIDILMDKAETLDNSAQTFQRHSSRLRKKMWWQNTRM 192          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Nematostella
Match: EDO44396 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVJ7])

HSP 1 Score: 45.8246 bits (107), Expect = 8.798e-7
Identity = 19/75 (25.33%), Postives = 46/75 (61.33%), Query Frame = 2
Query:   56 GSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            GS ++P  +  +++++ ++  +   MQ NI KV++R   L  + +++E L  ++  + + + K++RK WW+N ++
Sbjct:   42 GSTNKPPSDNNISRVKNEIKGVVDVMQTNIAKVLDRGAKLDDLQDKSENLDMNAFQFRSGSRKLQRKLWWQNCRL 116          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Medaka
Match: vamp3 (vesicle-associated membrane protein 3 (cellubrevin) [Source:ZFIN;Acc:ZDB-GENE-040625-45])

HSP 1 Score: 62.3882 bits (150), Expect = 8.435e-13
Identity = 28/67 (41.79%), Postives = 46/67 (68.66%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N++L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRK+WWKN K+
Sbjct:   15 NKRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKV 81          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Medaka
Match: vamp3 (vesicle-associated membrane protein 3 (cellubrevin) [Source:ZFIN;Acc:ZDB-GENE-040625-45])

HSP 1 Score: 62.3882 bits (150), Expect = 8.435e-13
Identity = 28/67 (41.79%), Postives = 46/67 (68.66%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N++L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+KRK+WWKN K+
Sbjct:   15 NKRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKV 81          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Medaka
Match: vamp2 (vesicle associated membrane protein 2 [Source:NCBI gene;Acc:101159693])

HSP 1 Score: 60.8474 bits (146), Expect = 4.137e-12
Identity = 28/67 (41.79%), Postives = 44/67 (65.67%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + T AAK+K K+WWKN KM
Sbjct:   28 NRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKNKYWWKNAKM 94          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Medaka
Match: vamp4 (vesicle associated membrane protein 4 [Source:NCBI gene;Acc:101170506])

HSP 1 Score: 60.077 bits (144), Expect = 1.664e-11
Identity = 28/86 (32.56%), Postives = 54/86 (62.79%), Query Frame = 2
Query:   29 YFMAGNNS--YGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            +F+ G +   +G+      N K+  +Q+ VD++   MQENI KV+ER + L  + +++E L  ++S + ++A ++ R+ WW++MKM
Sbjct:   49 FFLRGPSGPRFGAP-----NNKIKHVQSQVDEVIDVMQENISKVIERGERLDDLQDKSESLSDNASAFSSRAKQLHRRMWWRDMKM 129          
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Medaka
Match: vamp1 (vesicle-associated membrane protein 2-like [Source:NCBI gene;Acc:101164413])

HSP 1 Score: 58.9214 bits (141), Expect = 2.409e-11
Identity = 27/67 (40.30%), Postives = 44/67 (65.67%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N +L + Q  VD++   M+ N+ KV+ER+  LS + ++A+ L   +S + + AAK+K K+WWKN KM
Sbjct:   32 NRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKNKYWWKNCKM 98          
BLAST of Vesicle-associated membrane protein 3 vs. Planmine SMEST
Match: SMESG000033382.1 (SMESG000033382.1)

HSP 1 Score: 193.356 bits (490), Expect = 5.542e-64
Identity = 114/114 (100.00%), Postives = 114/114 (100.00%), Query Frame = 2
Query:   35 MAGNNSYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMWXXXXXXXXXXXXXXXXXXYTQTKGSGEKPKP 376
            MAGNNSYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMWIIIIIVTVVILTILGIIIYTQTKGSGEKPKP
Sbjct:    1 MAGNNSYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMWIIIIIVTVVILTILGIIIYTQTKGSGEKPKP 114          
BLAST of Vesicle-associated membrane protein 3 vs. Planmine SMEST
Match: SMESG000033386.1 (SMESG000033386.1)

HSP 1 Score: 71.633 bits (174), Expect = 7.383e-17
Identity = 34/51 (66.67%), Postives = 40/51 (78.43%), Query Frame = 2
Query:  131 MQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
            M+ENIQK ++RNDNL     QAE LH +SSL+V Q  KVKRKFWWKN+KMW
Sbjct:    1 MKENIQKALKRNDNLFDAVKQAEDLHNNSSLFVAQTIKVKRKFWWKNVKMW 51          
BLAST of Vesicle-associated membrane protein 3 vs. Planmine SMEST
Match: SMESG000010550.1 (SMESG000010550.1)

HSP 1 Score: 65.855 bits (159), Expect = 8.507e-14
Identity = 34/90 (37.78%), Postives = 51/90 (56.67%), Query Frame = 2
Query:   47 NSYGSIDQPF-----------RNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMW 283
            N+YG  +QP+            + +L + Q  VD +T  M+EN+ K +ER+  LS +  +A  L   +  + T A KV+RKFWWKN+KMW
Sbjct:   10 NTYGVYNQPYTISGGQSLSSSGSTRLQQTQMQVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIKMW 99          
BLAST of Vesicle-associated membrane protein 3 vs. Planmine SMEST
Match: SMESG000057424.1 (SMESG000057424.1)

HSP 1 Score: 63.929 bits (154), Expect = 1.991e-13
Identity = 29/67 (43.28%), Postives = 44/67 (65.67%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N++L + Q  VD++   M+ N+ KV+ER+  LS + N+AE L   +S +   A K+KRKFW KN+KM
Sbjct:   28 NKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLKM 94          
BLAST of Vesicle-associated membrane protein 3 vs. Planmine SMEST
Match: SMESG000066166.1 (SMESG000066166.1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.945e-12
Identity = 28/67 (41.79%), Postives = 44/67 (65.67%), Query Frame = 2
Query:   80 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKM 280
            N++L + Q  VD++   M+ N+ KV+ER+  LS + N+A+ L   +S +   A K+KRKFWW+N KM
Sbjct:   29 NKRLQQTQAQVDEVVDIMRVNVDKVLERDHKLSELDNRADALQAGASQFEASAGKLKRKFWWRNCKM 95          
The following BLAST results are available for this feature:
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VAMP31.061e-1441.03vesicle associated membrane protein 3 [Source:HGNC... [more]
AC129492.33.447e-1343.28novel protein[more]
VAMP23.917e-1343.28vesicle associated membrane protein 2 [Source:HGNC... [more]
VAMP24.695e-1343.28vesicle associated membrane protein 2 [Source:HGNC... [more]
VAMP24.772e-1343.28vesicle associated membrane protein 2 [Source:HGNC... [more]
back to top
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snb-19.232e-1340.30Synaptobrevin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snb-21.069e-828.40SyNaptoBrevin related [Source:UniProtKB/TrEMBL;Ac... [more]
snb-21.069e-828.40SyNaptoBrevin related [Source:UniProtKB/TrEMBL;Ac... [more]
snb-53.039e-834.92Synaptobrevin-like protein 5 [Source:UniProtKB/Sw... [more]
snb-73.334e-834.92SyNaptoBrevin related [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nSyb1.540e-1241.54gene:FBgn0013342 transcript:FBtr0306578[more]
nSyb1.540e-1241.54gene:FBgn0013342 transcript:FBtr0302310[more]
nSyb1.729e-1241.54gene:FBgn0013342 transcript:FBtr0331462[more]
Syb3.509e-1240.96gene:FBgn0003660 transcript:FBtr0088363[more]
nSyb4.075e-1241.54gene:FBgn0013342 transcript:FBtr0072815[more]
back to top
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vamp32.185e-1541.98vesicle-associated membrane protein 3 (cellubrevin... [more]
vamp32.185e-1541.98vesicle-associated membrane protein 3 (cellubrevin... [more]
vamp32.401e-1541.98vesicle-associated membrane protein 3 (cellubrevin... [more]
vamp24.275e-1241.79vesicle-associated membrane protein 2 [Source:ZFIN... [more]
vamp19.956e-1238.96vesicle-associated membrane protein 1 [Source:ZFIN... [more]
back to top
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vamp81.081e-1338.67putative ferric-chelate reductase 1 [Source:Xenbas... [more]
vamp81.164e-1338.67putative ferric-chelate reductase 1 [Source:Xenbas... [more]
vamp31.336e-1342.65vesicle associated membrane protein 3 [Source:NCBI... [more]
vamp31.739e-1342.65vesicle associated membrane protein 3 [Source:NCBI... [more]
idh12.699e-1136.84isocitrate dehydrogenase 1 (NADP+) [Source:Xenbase... [more]
back to top
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vamp38.735e-1539.76vesicle-associated membrane protein 3 [Source:MGI ... [more]
Vamp23.276e-1343.28vesicle-associated membrane protein 2 [Source:MGI ... [more]
Vamp25.223e-1343.28vesicle-associated membrane protein 2 [Source:MGI ... [more]
Vamp16.605e-1240.30vesicle-associated membrane protein 1 [Source:MGI ... [more]
Vamp17.438e-1240.30vesicle-associated membrane protein 1 [Source:MGI ... [more]
back to top
BLAST of Vesicle-associated membrane protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4R8T0|VAMP3_MACFA1.314e-1542.31Vesicle-associated membrane protein 3 OS=Macaca fa... [more]
sp|Q15836|VAMP3_HUMAN5.096e-1441.03Vesicle-associated membrane protein 3 OS=Homo sapi... [more]
sp|P63025|VAMP3_RAT6.110e-1439.76Vesicle-associated membrane protein 3 OS=Rattus no... [more]
sp|P63024|VAMP3_MOUSE6.110e-1439.76Vesicle-associated membrane protein 3 OS=Mus muscu... [more]
sp|P47193|VAMP2_XENLA6.233e-1344.78Vesicle-associated membrane protein 2 OS=Xenopus l... [more]
back to top
BLAST of Vesicle-associated membrane protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W3JUS46.188e-1542.53vesicle-associated membrane protein 3 isoform X8 O... [more]
A0A1W3JIL87.332e-1542.53vesicle-associated membrane protein 3 isoform X4 O... [more]
A0A1W3JJ637.341e-1542.53vesicle-associated membrane protein 3 isoform X6 O... [more]
F7A7Z67.628e-1543.02V-SNARE coiled-coil homology domain-containing pro... [more]
Q8T8971.447e-1340.24Similar to vesicle associated menbrane protein, ce... [more]
back to top
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vamp36.480e-1545.59vesicle associated membrane protein 3 [Source:NCBI... [more]
vamp41.485e-1234.52vesicle associated membrane protein 4 [Source:NCBI... [more]
vamp41.605e-1234.52vesicle associated membrane protein 4 [Source:NCBI... [more]
vamp27.469e-1241.79vesicle associated membrane protein 2 [Source:NCBI... [more]
vamp28.811e-1241.79vesicle associated membrane protein 2 [Source:NCBI... [more]
back to top
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008529.14.659e-1443.28pep scaffold:Pmarinus_7.0:GL484641:5659:9131:-1 ge... [more]
back to top
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SNC21.714e-934.29Vesicle membrane receptor protein (v-SNARE); invol... [more]
SNC16.993e-933.85Vesicle membrane receptor protein (v-SNARE); invol... [more]
back to top
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO423834.657e-1137.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437382.314e-830.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443968.798e-725.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Vesicle-associated membrane protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vamp38.435e-1341.79vesicle-associated membrane protein 3 (cellubrevin... [more]
vamp38.435e-1341.79vesicle-associated membrane protein 3 (cellubrevin... [more]
vamp24.137e-1241.79vesicle associated membrane protein 2 [Source:NCBI... [more]
vamp41.664e-1132.56vesicle associated membrane protein 4 [Source:NCBI... [more]
vamp12.409e-1140.30vesicle-associated membrane protein 2-like [Source... [more]
back to top
BLAST of Vesicle-associated membrane protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033382.15.542e-64100.00SMESG000033382.1[more]
SMESG000033386.17.383e-1766.67SMESG000033386.1[more]
SMESG000010550.18.507e-1437.78SMESG000010550.1[more]
SMESG000057424.11.991e-1343.28SMESG000057424.1[more]
SMESG000066166.11.945e-1241.79SMESG000066166.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30017013 ID=SMED30017013|Name=Vesicle-associated membrane protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=565bp
TCTATATAAATCTTATATGTTTTAATAATATTTTATGGCTGGAAATAATA
GCTATGGATCAATTGATCAACCATTTCGAAATGAAAAACTTACCAAGTTG
CAAACTGATGTGGACGATTTGACAAAAAGTATGCAAGAAAACATTCAAAA
AGTAATGGAGCGAAATGATAATTTGAGTGCAATATCAAATCAAGCTGAAG
TCCTACACCAAAGCTCGAGTTTATACGTGACACAAGCAGCCAAAGTTAAA
CGAAAATTTTGGTGGAAAAATATGAAAATGTGGATTATAATTATTATCGT
CACTGTTGTTATATTAACAATACTTGGAATAATTATTTATACTCAAACGA
AGGGCTCTGGTGAAAAGCCCAAGCCTTAAAGAAGAAGTTCATACAAAGGA
TATCATTGAATTACAAACTTGTATTTTTTTAACTTGTGATTTCATCTTTT
AAAAAATTTAATAATTTTGTATTTTTAACCCCAGAAATTGATTCCATTTT
TTCTAAACCGAAATCGTATCTAAACAAATTATTTTTTTCTACGAGAAATT
TCAAAAAAATACATT
back to top

protein sequence of SMED30017013-orf-1

>SMED30017013-orf-1 ID=SMED30017013-orf-1|Name=SMED30017013-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=115bp
MAGNNSYGSIDQPFRNEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAI
SNQAEVLHQSSSLYVTQAAKVKRKFWWKNMKMWIIIIIVTVVILTILGII
IYTQTKGSGEKPKP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0009986cell surface
GO:0030136clathrin-coated vesicle
GO:0030141secretory granule
GO:0031201SNARE complex
GO:0031410cytoplasmic vesicle
GO:0043231intracellular membrane-bounded organelle
GO:0045335phagocytic vesicle
GO:0048471perinuclear region of cytoplasm
GO:0055037recycling endosome
GO:0016021integral component of membrane
GO:0005829cytosol
GO:0005886plasma membrane
GO:0016020membrane
GO:0030054cell junction
GO:0043005neuron projection
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0017156calcium ion regulated exocytosis
GO:0035493SNARE complex assembly
GO:0043001Golgi to plasma membrane protein transport
GO:0071346cellular response to interferon-gamma
GO:1903531negative regulation of secretion by cell
GO:0016192vesicle-mediated transport
GO:0001921positive regulation of receptor recycling
GO:0006810transport
GO:0015031protein transport
GO:0034446substrate adhesion-dependent cell spreading
GO:0042147retrograde transport, endosome to Golgi
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR016444Synaptobrevin/VAMP
IPR042855V_SNARE_CC
IPR001388Synaptobrevin
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001388SynaptobrevinPRINTSPR00219SYNAPTOBREVNcoord: 43..62
score: 26.76
coord: 79..98
score: 29.46
coord: 23..42
score: 36.89
IPR001388SynaptobrevinPFAMPF00957Synaptobrevincoord: 16..101
e-value: 1.1E-25
score: 89.2
NoneNo IPR availableGENE3DG3DSA:1.20.5.110coord: 2..104
e-value: 3.4E-29
score: 103.0
NoneNo IPR availableSUPERFAMILYSSF58038SNARE fusion complexcoord: 13..80
NoneNo IPR availableTMHMMTMhelixcoord: 82..104
IPR016444Synaptobrevin/Vesicle-associated membrane proteinPIRSFPIRSF005409VAMP-5_synaptobrevincoord: 2..107
e-value: 2.0E-28
score: 96.2
IPR016444Synaptobrevin/Vesicle-associated membrane proteinPANTHERPTHR45701FAMILY NOT NAMEDcoord: 13..102
IPR042855v-SNARE, coiled-coil homology domainPROSITEPS50892V_SNAREcoord: 18..78
score: 14.646