Transformer-2-related

Overview
NameTransformer-2-related
Smed IDSMED30016995
Length (bp)943
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transformer-2-related (SMED30016995) t-SNE clustered cells

Violin plots show distribution of expression levels for Transformer-2-related (SMED30016995) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transformer-2-related (SMED30016995) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transformer-2-related (SMED30016995) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016995

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 26

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30016995SMESG000031644.1 SMESG000031639.1 SmedASXL_074369SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30016995SMESG000031644.1 SMESG000031639.1 SmedASXL_074369SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30016995SMESG000031644.1 SMESG000031639.1 dd_Smed_v4_1618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016995SMESG000031644.1 SMESG000031639.1 dd_Smed_v4_1618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30016995SMESG000031644.1 SMESG000031639.1 dd_Smed_v4_1618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016995SMESG000031644.1 SMESG000031639.1 dd_Smed_v4_1618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016995SMESG000031644.1 SMESG000031639.1 dd_Smed_v4_1618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016995SMESG000031644.1 SMESG000031639.1 dd_Smed_v4_1618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016995SMESG000031644.1 SMESG000031639.1 dd_Smed_v4_1618_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016995SMESG000031644.1 SMESG000031639.1 Contig3902uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016995SMESG000031644.1 SMESG000031639.1 Contig3902newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016995SMESG000031644.1 SMESG000031639.1 Contig745uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016995SMESG000031644.1 SMESG000031639.1 Contig745newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016995SMESG000031644.1 SMESG000031639.1 Contig27136uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016995SMESG000031644.1 SMESG000031639.1 Contig27136newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016995SMESG000051736.1 Contig3902uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016995SMESG000051736.1 Contig3902newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016995SMESG000016993.1 SMESG000016992.1 SMESG000016991.1 Contig745uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016995SMESG000016993.1 SMESG000016992.1 SMESG000016991.1 Contig745newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016995SMESG000031644.1 SMESG000031639.1 Contig746uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016995SMESG000031644.1 SMESG000031639.1 Contig746newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016995SMESG000059422.1 Contig746uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016995SMESG000059422.1 Contig746newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30016995SMESG000031644.1 SMESG000031639.1 dd_Smed_v6_1618_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30016995SMESG000031644.1 SMESG000031639.1 H.112.11hsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult cDNA to DNA expression microarray evidence
Category 4 cellSMED30016995SMESG000031644.1 SMESG000031639.1 H.112.11hsmed_ncbi_20200123PMID:18786419
Eisenhoffer et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transformer-2-related vs. Ensembl Human
Match: TRA2B (transformer 2 beta homolog [Source:HGNC Symbol;Acc:HGNC:10781])

HSP 1 Score: 134.806 bits (338), Expect = 4.838e-38
Identity = 58/104 (55.77%), Postives = 81/104 (77.88%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKS 570
            G+R NP P+ C+GVFGLSL T E+DL  VF KYG I DV +V D  + RSRGF F+Y+E V+ A+ AK+ A+G+E+DGR +R+D+SIT++ HTPTPG+Y+G+ +
Sbjct:    9 GNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGRPT 112          
BLAST of Transformer-2-related vs. Ensembl Human
Match: TRA2A (transformer 2 alpha homolog [Source:HGNC Symbol;Acc:HGNC:16645])

HSP 1 Score: 134.42 bits (337), Expect = 6.485e-38
Identity = 57/104 (54.81%), Postives = 81/104 (77.88%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKS 570
            G R NP P+TC+GVFGLSL T E+DL  VF +YG +  V +V D  TGRSRGF F+Y+E ++ ++ A + A+G+E+DGR +R+DYSIT++AHTPTPG+Y+G+ +
Sbjct:    9 GSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGIYMGRPT 112          
BLAST of Transformer-2-related vs. Ensembl Human
Match: TRA2A (transformer 2 alpha homolog [Source:HGNC Symbol;Acc:HGNC:16645])

HSP 1 Score: 134.42 bits (337), Expect = 6.675e-38
Identity = 57/104 (54.81%), Postives = 81/104 (77.88%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKS 570
            G R NP P+TC+GVFGLSL T E+DL  VF +YG +  V +V D  TGRSRGF F+Y+E ++ ++ A + A+G+E+DGR +R+DYSIT++AHTPTPG+Y+G+ +
Sbjct:    9 GSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGIYMGRPT 112          
BLAST of Transformer-2-related vs. Ensembl Human
Match: TRA2A (transformer 2 alpha homolog [Source:HGNC Symbol;Acc:HGNC:16645])

HSP 1 Score: 134.42 bits (337), Expect = 6.675e-38
Identity = 57/104 (54.81%), Postives = 81/104 (77.88%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKS 570
            G R NP P+TC+GVFGLSL T E+DL  VF +YG +  V +V D  TGRSRGF F+Y+E ++ ++ A + A+G+E+DGR +R+DYSIT++AHTPTPG+Y+G+ +
Sbjct:    9 GSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGIYMGRPT 112          
BLAST of Transformer-2-related vs. Ensembl Human
Match: TRA2B (transformer 2 beta homolog [Source:HGNC Symbol;Acc:HGNC:10781])

HSP 1 Score: 135.191 bits (339), Expect = 4.734e-37
Identity = 58/102 (56.86%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGK 564
            G+R NP P+ C+GVFGLSL T E+DL  VF KYG I DV +V D  + RSRGF F+Y+E V+ A+ AK+ A+G+E+DGR +R+D+SIT++ HTPTPG+Y+G+
Sbjct:  109 GNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGR 210          
BLAST of Transformer-2-related vs. Ensembl Celegans
Match: rsp-8 (SR Protein (Splicing factor) [Source:UniProtKB/TrEMBL;Acc:G3MU77])

HSP 1 Score: 111.694 bits (278), Expect = 1.955e-28
Identity = 50/99 (50.51%), Postives = 69/99 (69.70%), Query Frame = 1
Query:  262 DRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYL 558
            DR+NP+PS C+GVF LS  T EKDL  VF ++GEI    LV D  +G SRGFGFIY+  +E A  A+D     ++DG  +R+D+S+T++ H+PTPG Y+
Sbjct:   68 DRENPQPSKCLGVFNLSSYTTEKDLRDVFGEFGEINKCDLVYDRPSGNSRGFGFIYFNLIEDATAARDKLCNTDLDGHKIRVDFSLTKRGHSPTPGQYM 166          
BLAST of Transformer-2-related vs. Ensembl Celegans
Match: rsp-8 (SR Protein (Splicing factor) [Source:UniProtKB/TrEMBL;Acc:G3MU77])

HSP 1 Score: 111.694 bits (278), Expect = 1.955e-28
Identity = 50/99 (50.51%), Postives = 69/99 (69.70%), Query Frame = 1
Query:  262 DRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYL 558
            DR+NP+PS C+GVF LS  T EKDL  VF ++GEI    LV D  +G SRGFGFIY+  +E A  A+D     ++DG  +R+D+S+T++ H+PTPG Y+
Sbjct:   68 DRENPQPSKCLGVFNLSSYTTEKDLRDVFGEFGEINKCDLVYDRPSGNSRGFGFIYFNLIEDATAARDKLCNTDLDGHKIRVDFSLTKRGHSPTPGQYM 166          
BLAST of Transformer-2-related vs. Ensembl Celegans
Match: rsp-4 (Probable splicing factor, arginine/serine-rich 4 [Source:UniProtKB/Swiss-Prot;Acc:Q09511])

HSP 1 Score: 59.6918 bits (143), Expect = 4.346e-11
Identity = 29/74 (39.19%), Postives = 45/74 (60.81%), Query Frame = 1
Query:  286 TCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRI 507
            T + +  LS +T   DL R F++YG+I DV +  D Y+ +S+GFGF+ + E   A +A D   G  +DGR +R+
Sbjct:   19 TSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYERRDAEHALDRTDGKLVDGRELRV 92          
BLAST of Transformer-2-related vs. Ensembl Celegans
Match: rbmx-2 (RBMX2 ortholog [Source:UniProtKB/TrEMBL;Acc:Q18318])

HSP 1 Score: 61.2326 bits (147), Expect = 1.585e-10
Identity = 30/79 (37.97%), Postives = 49/79 (62.03%), Query Frame = 1
Query:  277 KPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDY 513
            K S  I + GLS    E D+  VF +YGE+ ++ L+ D  TG+S+GF F+ Y++  S   A D+ +GI +  R++R+D+
Sbjct:   35 KDSAWIYIGGLSYALSEGDVIAVFSQYGEVMNINLIRDKDTGKSKGFAFLCYKDQRSTILAVDNFNGISLHKRMIRVDH 113          
BLAST of Transformer-2-related vs. Ensembl Celegans
Match: rsp-4 (Probable splicing factor, arginine/serine-rich 4 [Source:UniProtKB/Swiss-Prot;Acc:Q09511])

HSP 1 Score: 59.6918 bits (143), Expect = 1.587e-10
Identity = 29/74 (39.19%), Postives = 45/74 (60.81%), Query Frame = 1
Query:  286 TCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRI 507
            T + +  LS +T   DL R F++YG+I DV +  D Y+ +S+GFGF+ + E   A +A D   G  +DGR +R+
Sbjct:   19 TSLKIDNLSYQTTPNDLRRTFERYGDIGDVHIPRDKYSRQSKGFGFVRFYERRDAEHALDRTDGKLVDGRELRV 92          
BLAST of Transformer-2-related vs. Ensembl Fly
Match: tra2 (gene:FBgn0003742 transcript:FBtr0089616)

HSP 1 Score: 130.183 bits (326), Expect = 1.018e-36
Identity = 57/101 (56.44%), Postives = 79/101 (78.22%), Query Frame = 1
Query:  265 RDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKK 567
            R++P+ S CIGVFGL+  T +  +  +F KYG I+ +Q+V+D  T RSRGF FIY+E++  AR AKDS  GIE+DGR +R+D+SIT++AHTPTPGVYLG++
Sbjct:    5 REHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQ 105          
BLAST of Transformer-2-related vs. Ensembl Fly
Match: tra2 (gene:FBgn0003742 transcript:FBtr0089615)

HSP 1 Score: 130.183 bits (326), Expect = 4.167e-36
Identity = 57/101 (56.44%), Postives = 79/101 (78.22%), Query Frame = 1
Query:  265 RDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKK 567
            R++P+ S CIGVFGL+  T +  +  +F KYG I+ +Q+V+D  T RSRGF FIY+E++  AR AKDS  GIE+DGR +R+D+SIT++AHTPTPGVYLG++
Sbjct:   52 REHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQ 152          
BLAST of Transformer-2-related vs. Ensembl Fly
Match: tra2 (gene:FBgn0003742 transcript:FBtr0089619)

HSP 1 Score: 130.183 bits (326), Expect = 4.167e-36
Identity = 57/101 (56.44%), Postives = 79/101 (78.22%), Query Frame = 1
Query:  265 RDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKK 567
            R++P+ S CIGVFGL+  T +  +  +F KYG I+ +Q+V+D  T RSRGF FIY+E++  AR AKDS  GIE+DGR +R+D+SIT++AHTPTPGVYLG++
Sbjct:   52 REHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQ 152          
BLAST of Transformer-2-related vs. Ensembl Fly
Match: tra2 (gene:FBgn0003742 transcript:FBtr0089620)

HSP 1 Score: 130.568 bits (327), Expect = 8.744e-36
Identity = 57/101 (56.44%), Postives = 79/101 (78.22%), Query Frame = 1
Query:  265 RDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKK 567
            R++P+ S CIGVFGL+  T +  +  +F KYG I+ +Q+V+D  T RSRGF FIY+E++  AR AKDS  GIE+DGR +R+D+SIT++AHTPTPGVYLG++
Sbjct:   90 REHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQ 190          
BLAST of Transformer-2-related vs. Ensembl Fly
Match: tra2 (gene:FBgn0003742 transcript:FBtr0089621)

HSP 1 Score: 130.568 bits (327), Expect = 8.744e-36
Identity = 57/101 (56.44%), Postives = 79/101 (78.22%), Query Frame = 1
Query:  265 RDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKK 567
            R++P+ S CIGVFGL+  T +  +  +F KYG I+ +Q+V+D  T RSRGF FIY+E++  AR AKDS  GIE+DGR +R+D+SIT++AHTPTPGVYLG++
Sbjct:   90 REHPQASRCIGVFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQ 190          
BLAST of Transformer-2-related vs. Ensembl Zebrafish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 133.265 bits (334), Expect = 1.708e-37
Identity = 56/100 (56.00%), Postives = 78/100 (78.00%), Query Frame = 1
Query:  265 RDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGK 564
            R NP P+TC+GVFGLSL T E+DL  VF +YG +  V +V D  TGRSRGF F+Y+E ++ A+ A + A+G+E+DGR +R+DYSIT++ HTPTPG+Y+G+
Sbjct:   99 RANPDPNTCLGVFGLSLYTTERDLREVFSRYGSLAGVNVVYDQRTGRSRGFAFVYFEHIDDAKEAMERANGMELDGRRIRVDYSITKRPHTPTPGIYMGR 198          
BLAST of Transformer-2-related vs. Ensembl Zebrafish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 133.265 bits (334), Expect = 1.708e-37
Identity = 56/100 (56.00%), Postives = 78/100 (78.00%), Query Frame = 1
Query:  265 RDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGK 564
            R NP P+TC+GVFGLSL T E+DL  VF +YG +  V +V D  TGRSRGF F+Y+E ++ A+ A + A+G+E+DGR +R+DYSIT++ HTPTPG+Y+G+
Sbjct:   99 RANPDPNTCLGVFGLSLYTTERDLREVFSRYGSLAGVNVVYDQRTGRSRGFAFVYFEHIDDAKEAMERANGMELDGRRIRVDYSITKRPHTPTPGIYMGR 198          
BLAST of Transformer-2-related vs. Ensembl Zebrafish
Match: tra2b (transformer 2 beta homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1094])

HSP 1 Score: 134.035 bits (336), Expect = 6.670e-37
Identity = 58/102 (56.86%), Postives = 79/102 (77.45%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGK 564
            GDR NP P+ C+GVFGLSL T E+DL  VF KYG + DV +V D  + RSRGF F+Y+E  E ++ AK+ A+G+E+DGR +R+DYSIT++ HTPTPG+Y+G+
Sbjct:  114 GDRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPLSDVCIVYDQQSRRSRGFAFVYFENREDSKEAKERANGMELDGRRIRVDYSITKRPHTPTPGIYMGR 215          
BLAST of Transformer-2-related vs. Ensembl Zebrafish
Match: tra2b (transformer 2 beta homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1094])

HSP 1 Score: 134.035 bits (336), Expect = 6.670e-37
Identity = 58/102 (56.86%), Postives = 79/102 (77.45%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGK 564
            GDR NP P+ C+GVFGLSL T E+DL  VF KYG + DV +V D  + RSRGF F+Y+E  E ++ AK+ A+G+E+DGR +R+DYSIT++ HTPTPG+Y+G+
Sbjct:  114 GDRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPLSDVCIVYDQQSRRSRGFAFVYFENREDSKEAKERANGMELDGRRIRVDYSITKRPHTPTPGIYMGR 215          
BLAST of Transformer-2-related vs. Ensembl Zebrafish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 133.265 bits (334), Expect = 2.042e-36
Identity = 56/100 (56.00%), Postives = 78/100 (78.00%), Query Frame = 1
Query:  265 RDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGK 564
            R NP P+TC+GVFGLSL T E+DL  VF +YG +  V +V D  TGRSRGF F+Y+E ++ A+ A + A+G+E+DGR +R+DYSIT++ HTPTPG+Y+G+
Sbjct:  128 RANPDPNTCLGVFGLSLYTTERDLREVFSRYGSLAGVNVVYDQRTGRSRGFAFVYFEHIDDAKEAMERANGMELDGRRIRVDYSITKRPHTPTPGIYMGR 227          
BLAST of Transformer-2-related vs. Ensembl Xenopus
Match: plekhg5 (pleckstrin homology and RhoGEF domain containing G5 [Source:Xenbase;Acc:XB-GENE-6039487])

HSP 1 Score: 136.732 bits (343), Expect = 1.101e-37
Identity = 59/104 (56.73%), Postives = 80/104 (76.92%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKS 570
            G R NP P+ CIGVFGLSL T E+DL  VF +YG +  V +V D  TGRSRGF F+Y+E +E +R A + A+G+E+DGR +R+DYSIT++AHTPTPG+Y+G+ +
Sbjct:  105 GSRANPDPNICIGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIEDSREAMEHANGMELDGRRIRVDYSITKRAHTPTPGIYMGRPT 208          
BLAST of Transformer-2-related vs. Ensembl Xenopus
Match: rit1 (Ras-like without CAAX 1 [Source:Xenbase;Acc:XB-GENE-5777077])

HSP 1 Score: 135.576 bits (340), Expect = 6.993e-37
Identity = 58/102 (56.86%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGK 564
            G+R NP P+ C+GVFGLSL T E+DL  VF KYG I DV +V D  + RSRGF F+Y+E V+ A+ AK+ A+G+E+DGR +R+D+SIT++ HTPTPG+Y+G+
Sbjct:  144 GNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPISDVSIVYDQQSRRSRGFSFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGR 245          
BLAST of Transformer-2-related vs. Ensembl Xenopus
Match: cirbp (cold inducible RNA binding protein [Source:NCBI gene;Acc:549982])

HSP 1 Score: 65.855 bits (159), Expect = 1.971e-12
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 1
Query:  298 VFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRID 510
            V GL+ +T E+ L +VF KYG++ +V +V D  + RSRGFGF+ +E  E A++A  + +G  +DGR +R+D
Sbjct:   22 VGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMMAMNGKSVDGRQIRVD 92          
BLAST of Transformer-2-related vs. Ensembl Xenopus
Match: cirbp (cold inducible RNA binding protein [Source:NCBI gene;Acc:549982])

HSP 1 Score: 65.855 bits (159), Expect = 1.996e-12
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 1
Query:  298 VFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRID 510
            V GL+ +T E+ L +VF KYG++ +V +V D  + RSRGFGF+ +E  E A++A  + +G  +DGR +R+D
Sbjct:   22 VGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMMAMNGKSVDGRQIRVD 92          
BLAST of Transformer-2-related vs. Ensembl Xenopus
Match: cirbp (cold inducible RNA binding protein [Source:NCBI gene;Acc:549982])

HSP 1 Score: 65.855 bits (159), Expect = 2.893e-12
Identity = 31/71 (43.66%), Postives = 49/71 (69.01%), Query Frame = 1
Query:  298 VFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRID 510
            V GL+ +T E+ L +VF KYG++ +V +V D  + RSRGFGF+ +E  E A++A  + +G  +DGR +R+D
Sbjct:   22 VGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDAMMAMNGKSVDGRQIRVD 92          
BLAST of Transformer-2-related vs. Ensembl Mouse
Match: Tra2b (transformer 2 beta [Source:MGI Symbol;Acc:MGI:106016])

HSP 1 Score: 134.806 bits (338), Expect = 3.322e-38
Identity = 58/104 (55.77%), Postives = 81/104 (77.88%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKS 570
            G+R NP P+ C+GVFGLSL T E+DL  VF KYG I DV +V D  + RSRGF F+Y+E V+ A+ AK+ A+G+E+DGR +R+D+SIT++ HTPTPG+Y+G+ +
Sbjct:    9 GNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGRPT 112          
BLAST of Transformer-2-related vs. Ensembl Mouse
Match: Tra2b (transformer 2 beta [Source:MGI Symbol;Acc:MGI:106016])

HSP 1 Score: 135.191 bits (339), Expect = 3.250e-37
Identity = 58/102 (56.86%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGK 564
            G+R NP P+ C+GVFGLSL T E+DL  VF KYG I DV +V D  + RSRGF F+Y+E V+ A+ AK+ A+G+E+DGR +R+D+SIT++ HTPTPG+Y+G+
Sbjct:  109 GNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGR 210          
BLAST of Transformer-2-related vs. Ensembl Mouse
Match: Tra2a (transformer 2 alpha [Source:MGI Symbol;Acc:MGI:1933972])

HSP 1 Score: 134.806 bits (338), Expect = 3.647e-37
Identity = 57/104 (54.81%), Postives = 81/104 (77.88%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKS 570
            G R NP P+TC+GVFGLSL T E+DL  VF +YG +  V +V D  TGRSRGF F+Y+E ++ ++ A + A+G+E+DGR +R+DYSIT++AHTPTPG+Y+G+ +
Sbjct:  108 GSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGIYMGRPT 211          
BLAST of Transformer-2-related vs. Ensembl Mouse
Match: Tra2a (transformer 2 alpha [Source:MGI Symbol;Acc:MGI:1933972])

HSP 1 Score: 134.806 bits (338), Expect = 3.826e-37
Identity = 57/104 (54.81%), Postives = 81/104 (77.88%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKS 570
            G R NP P+TC+GVFGLSL T E+DL  VF +YG +  V +V D  TGRSRGF F+Y+E ++ ++ A + A+G+E+DGR +R+DYSIT++AHTPTPG+Y+G+ +
Sbjct:  108 GSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGIYMGRPT 211          
BLAST of Transformer-2-related vs. Ensembl Mouse
Match: Cirbp (cold inducible RNA binding protein [Source:MGI Symbol;Acc:MGI:893588])

HSP 1 Score: 70.8626 bits (172), Expect = 5.754e-15
Identity = 33/73 (45.21%), Postives = 51/73 (69.86%), Query Frame = 1
Query:  298 VFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYS 516
            V GLS  T+E+ L +VF KYG+I +V +V D  T RSRGFGF+ +E ++ A++A  + +G  +DGR +R+D +
Sbjct:   10 VGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQA 82          
BLAST of Transformer-2-related vs. UniProt/SwissProt
Match: sp|P62997|TRA2B_RAT (Transformer-2 protein homolog beta OS=Rattus norvegicus OX=10116 GN=Tra2b PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.273e-36
Identity = 58/102 (56.86%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGK 564
            G+R NP P+ C+GVFGLSL T E+DL  VF KYG I DV +V D  + RSRGF F+Y+E V+ A+ AK+ A+G+E+DGR +R+D+SIT++ HTPTPG+Y+G+
Sbjct:  109 GNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGR 210          
BLAST of Transformer-2-related vs. UniProt/SwissProt
Match: sp|P62996|TRA2B_MOUSE (Transformer-2 protein homolog beta OS=Mus musculus OX=10090 GN=Tra2b PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.273e-36
Identity = 58/102 (56.86%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGK 564
            G+R NP P+ C+GVFGLSL T E+DL  VF KYG I DV +V D  + RSRGF F+Y+E V+ A+ AK+ A+G+E+DGR +R+D+SIT++ HTPTPG+Y+G+
Sbjct:  109 GNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGR 210          
BLAST of Transformer-2-related vs. UniProt/SwissProt
Match: sp|P62995|TRA2B_HUMAN (Transformer-2 protein homolog beta OS=Homo sapiens OX=9606 GN=TRA2B PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.273e-36
Identity = 58/102 (56.86%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGK 564
            G+R NP P+ C+GVFGLSL T E+DL  VF KYG I DV +V D  + RSRGF F+Y+E V+ A+ AK+ A+G+E+DGR +R+D+SIT++ HTPTPG+Y+G+
Sbjct:  109 GNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGR 210          
BLAST of Transformer-2-related vs. UniProt/SwissProt
Match: sp|Q3ZBT6|TRA2B_BOVIN (Transformer-2 protein homolog beta OS=Bos taurus OX=9913 GN=TRA2B PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.273e-36
Identity = 58/102 (56.86%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGK 564
            G+R NP P+ C+GVFGLSL T E+DL  VF KYG I DV +V D  + RSRGF F+Y+E V+ A+ AK+ A+G+E+DGR +R+D+SIT++ HTPTPG+Y+G+
Sbjct:  109 GNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGR 210          
BLAST of Transformer-2-related vs. UniProt/SwissProt
Match: sp|Q6PFR5|TRA2A_MOUSE (Transformer-2 protein homolog alpha OS=Mus musculus OX=10090 GN=Tra2a PE=1 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.613e-36
Identity = 57/104 (54.81%), Postives = 81/104 (77.88%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKS 570
            G R NP P+TC+GVFGLSL T E+DL  VF +YG +  V +V D  TGRSRGF F+Y+E ++ ++ A + A+G+E+DGR +R+DYSIT++AHTPTPG+Y+G+ +
Sbjct:  108 GSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRAHTPTPGIYMGRPT 211          
BLAST of Transformer-2-related vs. TrEMBL
Match: A0A0X3P603 (RRM domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR166019 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 1.195e-39
Identity = 63/98 (64.29%), Postives = 82/98 (83.67%), Query Frame = 1
Query:  265 RDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYL 558
            RDNP PS C+GVFGLSL T E+D+Y VF +YGE++DV +V DNYTGRSRGFGF+Y+  +  A+ AK+ AHG+EIDGR +R+DYS+T +AH+PTPGVY+
Sbjct:   90 RDNPTPSRCLGVFGLSLNTQERDIYDVFSRYGEVEDVCIVYDNYTGRSRGFGFLYFRHLSDAKEAKNDAHGLEIDGRPIRVDYSVTERAHSPTPGVYM 187          
BLAST of Transformer-2-related vs. TrEMBL
Match: A0A4S2L5X9 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010251 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.511e-39
Identity = 62/105 (59.05%), Postives = 83/105 (79.05%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKST 573
            G R+N KPS C+GVFGLSL T E+DLY +F +YG I DVQLV DNYTGRSRGFGF+Y+  +  A+ AK  AHG+E+DGR +R D+S+T + H+PTPG+Y+G+ ++
Sbjct:   66 GPRENAKPSRCLGVFGLSLHTQERDLYDIFSRYGPIDDVQLVYDNYTGRSRGFGFVYFNHLSDAKVAKSEAHGMEVDGRPIRCDFSVTDRPHSPTPGIYMGRPTS 170          
BLAST of Transformer-2-related vs. TrEMBL
Match: A7RUS7 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g94276 PE=4 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.992e-39
Identity = 65/104 (62.50%), Postives = 85/104 (81.73%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKS 570
            G+RDNP PS C+GVFGLSL T E+DL  VF+KYG ++ +Q+V D+ TGRSRGFGF+YYE+ + A  AK+   GIE+DGR +R+DYS+T++AHTPTPGVY+GK S
Sbjct:   86 GNRDNPSPSRCLGVFGLSLYTTERDLRPVFEKYGPVEAIQIVYDHQTGRSRGFGFVYYEDTKDAEVAKERTTGIELDGRRIRVDYSVTKRAHTPTPGVYMGKAS 189          
BLAST of Transformer-2-related vs. TrEMBL
Match: A0A183VLB5 (RRM domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS799 PE=4 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 4.819e-39
Identity = 66/105 (62.86%), Postives = 83/105 (79.05%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKST 573
            G R+NP PS C+GVFGLSL T E++LY +F +YG I+DVQLV DNYTGRSRGFGF+Y+  V  A+ AK  AHG+EIDGR +R D+SIT + H+PTPG+Y+GK  T
Sbjct:   38 GPRENPNPSRCLGVFGLSLHTQERNLYDIFSQYGNIEDVQLVFDNYTGRSRGFGFVYFTHVADAKAAKADAHGMEIDGRPIRCDFSITERPHSPTPGIYMGKSDT 142          
BLAST of Transformer-2-related vs. TrEMBL
Match: A0A023FVY6 (RRM domain-containing protein (Fragment) OS=Amblyomma parvum OX=251391 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 1.077e-38
Identity = 66/104 (63.46%), Postives = 83/104 (79.81%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKS 570
            G RDNP  S C+GVFGLSL T E+DL  VF KYG ++DVQ+V D  +GRSRGF F+Y+E VE A+ AKD  +G+EIDGR +R+DYSIT++AHTPTPG+Y+GK S
Sbjct:  116 GSRDNPNTSRCLGVFGLSLYTQERDLKEVFSKYGPLEDVQVVYDAQSGRSRGFAFVYFESVEDAKAAKDRCNGLEIDGRKIRVDYSITQRAHTPTPGIYMGKPS 219          
BLAST of Transformer-2-related vs. Ensembl Cavefish
Match: ENSAMXT00000034164.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:6544829:6548035:1 gene:ENSAMXG00000039469.1 transcript:ENSAMXT00000034164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.724 bits (330), Expect = 2.610e-37
Identity = 57/102 (55.88%), Postives = 78/102 (76.47%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGK 564
            G+R NP P+ C+GVFGLSL T E+DL  VF KYG +  V +V D  + RSRGF F+Y+E  E +R AK+ A+G+E+DGR +R+DYSIT++ HTPTPG+Y+G+
Sbjct:    9 GNRANPDPNCCLGVFGLSLYTTERDLREVFSKYGPLSSVSIVYDQQSRRSRGFAFVYFENREDSREAKERANGMELDGRRIRVDYSITQRPHTPTPGIYMGR 110          
BLAST of Transformer-2-related vs. Ensembl Cavefish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 132.88 bits (333), Expect = 7.820e-37
Identity = 56/104 (53.85%), Postives = 80/104 (76.92%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKS 570
            G R NP P+TC+GVFGLSL T E+DL  VF +YG +  V +V D  TGRSRGF F+Y+E ++ ++ A + A+G+E+DGR +R+DYSIT++ HTPTPG+Y+G+ +
Sbjct:   98 GSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLAGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRPHTPTPGIYMGRPT 201          
BLAST of Transformer-2-related vs. Ensembl Cavefish
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 132.494 bits (332), Expect = 8.067e-37
Identity = 55/100 (55.00%), Postives = 78/100 (78.00%), Query Frame = 1
Query:  265 RDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGK 564
            R NP P+TC+GVFGLSL T E+DL  VF +YG +  V +V D  TGRSRGF F+Y+E ++ ++ A + A+G+E+DGR +R+DYSIT++ HTPTPG+Y+G+
Sbjct:  128 RANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLAGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITKRPHTPTPGIYMGR 227          
BLAST of Transformer-2-related vs. Ensembl Cavefish
Match: tra2b (transformer-2 protein homolog alpha-like [Source:NCBI gene;Acc:103029311])

HSP 1 Score: 130.954 bits (328), Expect = 1.191e-35
Identity = 56/104 (53.85%), Postives = 80/104 (76.92%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKS 570
            G+R NP P+ C+GVFGLSL T E+DL  VF KYG + DV +V D  + RSRGF F+Y+E  E ++ AK+ A+G+E+DGR +R+D+SIT++ HTPTPG+Y+G+ +
Sbjct:  109 GNRANPDPTCCLGVFGLSLYTTERDLREVFSKYGPLADVCIVYDQQSRRSRGFAFVYFENREDSQEAKERANGMELDGRRIRVDFSITKRPHTPTPGIYMGRPT 212          
BLAST of Transformer-2-related vs. Ensembl Cavefish
Match: cirbpa (cold inducible RNA binding protein a [Source:ZFIN;Acc:ZDB-GENE-050417-329])

HSP 1 Score: 62.7734 bits (151), Expect = 1.081e-11
Identity = 29/69 (42.03%), Postives = 43/69 (62.32%), Query Frame = 1
Query:  304 GLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRID 510
            GLS  T E+ L   F KYG I +V +  +  T RSRGFGF+ +E  + A++A +  +G  +DGR +R+D
Sbjct:   11 GLSFDTTEQSLEEAFSKYGVITNVHVARNRETNRSRGFGFVTFENPDDAKDALEGMNGKSVDGRAIRVD 79          
BLAST of Transformer-2-related vs. Ensembl Sea Lamprey
Match: tra2a (transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1391])

HSP 1 Score: 136.732 bits (343), Expect = 8.698e-39
Identity = 58/102 (56.86%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGK 564
            G R NP PS C+GVFGLSL T EKDL  VF +YG ++ V +V D  +GRSRGF F+Y++  E A+ AK+ A+G+E+DGR +R+D+SIT++AHTPTPG+Y+G+
Sbjct:  103 GSRVNPDPSCCLGVFGLSLHTGEKDLKEVFSRYGPVQSVNVVYDQQSGRSRGFAFVYFDNSEDAKEAKERANGMELDGRYIRVDFSITKRAHTPTPGIYMGR 204          
BLAST of Transformer-2-related vs. Ensembl Sea Lamprey
Match: tra2b (transformer 2 beta homolog [Source:ZFIN;Acc:ZDB-GENE-040426-1094])

HSP 1 Score: 134.035 bits (336), Expect = 1.472e-37
Identity = 57/104 (54.81%), Postives = 81/104 (77.88%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKS 570
            GDR NP+P+TC+GVFGLSL T E DL  VF +YG + DV +V D  +GR RGF F+Y + +E ++ AK+  +G+E+DGR +R+D+SIT++AHTPTPG+Y+G+ S
Sbjct:   97 GDRGNPEPNTCLGVFGLSLYTTEHDLREVFGRYGPVADVNVVYDQQSGRPRGFAFVYMQNMEDSKEAKERVNGMELDGRNIRVDFSITKRAHTPTPGIYMGRPS 200          
BLAST of Transformer-2-related vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 63.1586 bits (152), Expect = 2.058e-11
Identity = 26/72 (36.11%), Postives = 45/72 (62.50%), Query Frame = 1
Query:  298 VFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDY 513
            V  L     E  L  +F+ +G+I ++QL++D  TGRS+GFGFI +   + A+ A +  +G E+ GR ++++Y
Sbjct:  276 VGSLHFNITEAMLMGIFEPFGKIDNIQLMMDPETGRSKGFGFITFSSADCAKKALEQLNGFELAGRPMKVNY 347          
BLAST of Transformer-2-related vs. Ensembl Sea Lamprey
Match: rbmx (RNA binding motif protein X-linked [Source:NCBI gene;Acc:321860])

HSP 1 Score: 61.2326 bits (147), Expect = 7.305e-11
Identity = 30/71 (42.25%), Postives = 43/71 (60.56%), Query Frame = 1
Query:  298 VFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRID 510
            V GL++ T EK L   F KYG + DV L+ D  T  SRGF F+ +   E A+ A+  A+G  ++GR +R+D
Sbjct:   11 VGGLNIDTTEKALEATFSKYGRVADVLLMKDRETNLSRGFAFVTFANPEDAKEAERDANGKVLEGRAMRVD 81          
BLAST of Transformer-2-related vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 61.2326 bits (147), Expect = 7.477e-11
Identity = 27/76 (35.53%), Postives = 47/76 (61.84%), Query Frame = 1
Query:  298 VFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITR 525
            V  L     E  L  +F+ +G+I++ QL++D+ TGRSRG+GF+ + + E AR A +  +G E+ GR +++ +   R
Sbjct:  263 VGSLHFNITEDMLKGIFEPFGKIENCQLMMDSDTGRSRGYGFVTFADAECARKALEQLNGFELAGRPMKVGHVTER 338          
BLAST of Transformer-2-related vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 57.3806 bits (137), Expect = 8.351e-10
Identity = 29/87 (33.33%), Postives = 49/87 (56.32%), Query Frame = 1
Query:  268 DNP-KPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITR 525
            D P +PS  + +  LS   D   ++ +F K+GE+  V++     T + +GFG++ +  +E A+ A D+  G  ID R VR+D+S  R
Sbjct:  260 DTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRLDFSSPR 346          

HSP 2 Score: 46.595 bits (109), Expect = 2.509e-6
Identity = 28/85 (32.94%), Postives = 46/85 (54.12%), Query Frame = 1
Query:  277 KPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKA 531
            +P+T I V  LS   D++ L + F+  G +   +++ +  T RSRG+G++ +E    A  A     G EIDGR +  D S ++ A
Sbjct:  166 EPAT-IFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPA 249          
BLAST of Transformer-2-related vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 56.6102 bits (135), Expect = 1.641e-9
Identity = 32/95 (33.68%), Postives = 52/95 (54.74%), Query Frame = 1
Query:  277 KPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLG 561
            K S  + + GL+  T E +L   F KYG + D++++ D  TGRSRGFGF+ +E+  S      + H   +DG+V+    +I R     T  +++G
Sbjct:  156 KESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQH--ILDGKVIDPKRAIPRDEQDKTGKIFVG 248          

HSP 2 Score: 45.4394 bits (106), Expect = 6.194e-6
Identity = 23/61 (37.70%), Postives = 34/61 (55.74%), Query Frame = 1
Query:  265 RDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVES 447
            RD    +  I V G+      K+    F ++G I D QL+LD  TG+SRGFGF+ Y+  ++
Sbjct:  236 RDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADA 296          
BLAST of Transformer-2-related vs. Ensembl Yeast
Match: IST3 (Component of the U2 snRNP; required for the first catalytic step of splicing and for spliceosomal assembly; interacts with Rds3p and is required for Mer1p-activated splicing; diploid mutants have a specific defect in MATa1 pre-mRNA splicing which leads to haploid gene expression in diploids [Source:SGD;Acc:S000001444])

HSP 1 Score: 51.6026 bits (122), Expect = 1.144e-8
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  277 KPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITR 525
            K +  I +  L+ +  E D+  VF +YG   DV L  D  TG S+GF ++ YE+  S   A D+ +G +I GR ++ID++  R
Sbjct:   28 KDNAYIYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNLNGFKIGGRALKIDHTFYR 110          
BLAST of Transformer-2-related vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 52.7582 bits (125), Expect = 2.659e-8
Identity = 23/73 (31.51%), Postives = 43/73 (58.90%), Query Frame = 1
Query:  307 LSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITR 525
            L++  D++ L   F+ +       ++ D  TG SRG+GF+ +   + A+NA DS  G +++GR +RI+++  R
Sbjct:  169 LNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAAKR 241          
BLAST of Transformer-2-related vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 50.8322 bits (120), Expect = 1.335e-7
Identity = 27/84 (32.14%), Postives = 49/84 (58.33%), Query Frame = 1
Query:  277 KPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRK 528
            K S  I +  L    D K LY  F  +G+I   ++  D   G+S+GFGF+++EE  +A+ A D+ +G+ ++G+ + +   ++RK
Sbjct:  123 KGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAPHLSRK 205          
BLAST of Transformer-2-related vs. Ensembl Nematostella
Match: EDO44802 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUS7])

HSP 1 Score: 146.362 bits (368), Expect = 4.006e-43
Identity = 65/104 (62.50%), Postives = 85/104 (81.73%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKS 570
            G+RDNP PS C+GVFGLSL T E+DL  VF+KYG ++ +Q+V D+ TGRSRGFGF+YYE+ + A  AK+   GIE+DGR +R+DYS+T++AHTPTPGVY+GK S
Sbjct:   86 GNRDNPSPSRCLGVFGLSLYTTERDLRPVFEKYGPVEAIQIVYDHQTGRSRGFGFVYYEDTKDAEVAKERTTGIELDGRRIRVDYSVTKRAHTPTPGVYMGKAS 189          
BLAST of Transformer-2-related vs. Ensembl Nematostella
Match: EDO30149 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1M0])

HSP 1 Score: 53.5286 bits (127), Expect = 1.437e-9
Identity = 22/70 (31.43%), Postives = 44/70 (62.86%), Query Frame = 1
Query:  316 KTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITR 525
            +  E D++ +F  YGEIK++ + LD  TG  +G+  + YE  + A++A ++ +G E+ G+ + +D++  R
Sbjct:   15 EAQEDDIHELFSDYGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEALNGAEMLGQNISVDWAFIR 84          
BLAST of Transformer-2-related vs. Ensembl Nematostella
Match: EDO38777 (Peptidyl-prolyl cis-trans isomerase E [Source:UniProtKB/TrEMBL;Acc:A7SBW4])

HSP 1 Score: 57.3806 bits (137), Expect = 1.575e-9
Identity = 28/73 (38.36%), Postives = 45/73 (61.64%), Query Frame = 1
Query:  298 VFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYS 516
            V GL+ + DEK L+  F  +G+I DVQ+ +D  T + RGFGF+ +E  E    A D+ +  E+ GR +R++ +
Sbjct:    9 VGGLAEEVDEKVLHAAFIPFGDITDVQIPMDYTTSKHRGFGFVEFEFAEDTAAAIDNMNESELFGRTIRVNLA 81          
BLAST of Transformer-2-related vs. Ensembl Nematostella
Match: EDO29715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2V2])

HSP 1 Score: 53.1434 bits (126), Expect = 2.033e-9
Identity = 26/75 (34.67%), Postives = 43/75 (57.33%), Query Frame = 1
Query:  292 IGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYS 516
            I V  L    +E DL   F++YG +  V+++ D +TGRS+GFGF+       A+ A D  +G  ++GR + ++ S
Sbjct:    3 IFVGSLPFSIEEADLRGFFEEYGAVDSVKIISDKFTGRSKGFGFVEMPNDAEAQKAIDELNGGTVEGRTIVVNKS 77          
BLAST of Transformer-2-related vs. Ensembl Nematostella
Match: EDO33926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQW0])

HSP 1 Score: 57.7658 bits (138), Expect = 2.088e-9
Identity = 27/79 (34.18%), Postives = 45/79 (56.96%), Query Frame = 1
Query:  271 NPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRI 507
             P   T + V  L     E  +  VF+ +G +  VQL+ D+ T RS+G+GF+ + E E+A+ A +  +G E+ GR ++I
Sbjct:  210 QPLGPTRLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRAMEQMNGFELAGRPLKI 288          
BLAST of Transformer-2-related vs. Ensembl Medaka
Match: tra2a (transformer 2a [Source:NCBI gene;Acc:100049284])

HSP 1 Score: 136.346 bits (342), Expect = 9.685e-38
Identity = 57/102 (55.88%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGK 564
            G+R NP PS C+GVFGLSL T E+DL  VF KYG + +V +V D  + RSRGF F+Y+E  E ++ AK+ A+G+E+DGR +R+D+SIT++AHTPTPG+Y+G+
Sbjct:  106 GNRGNPDPSCCLGVFGLSLYTTERDLREVFSKYGPLSEVNIVYDQQSRRSRGFAFVYFENSEDSKEAKEQANGMELDGRRIRVDFSITKRAHTPTPGIYMGR 207          
BLAST of Transformer-2-related vs. Ensembl Medaka
Match: tra2a (transformer-2 protein homolog alpha [Source:NCBI gene;Acc:101157868])

HSP 1 Score: 132.88 bits (333), Expect = 1.240e-36
Identity = 56/102 (54.90%), Postives = 77/102 (75.49%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGK 564
            G R+NP PSTC+GVFGL+L T E+DL  VF +YG +  + +V D  TGRSRGF FIY+E +  AR A +  +G+ +DGR +R+DYSIT++ HTPTPG+Y+G+
Sbjct:  100 GTRENPDPSTCLGVFGLNLSTTERDLREVFSRYGRLTGINMVHDQRTGRSRGFAFIYFERLCDAREAIEHTNGMNMDGRQIRVDYSITKRPHTPTPGIYMGR 201          
BLAST of Transformer-2-related vs. Ensembl Medaka
Match: tra2b (transformer 2 beta homolog [Source:NCBI gene;Acc:100049285])

HSP 1 Score: 129.413 bits (324), Expect = 4.611e-35
Identity = 55/100 (55.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYL 558
            G+R NP P+ C+GVFGLSL T E+DL  VF KYG + DV +V D  + RSRGF F+Y+E    A+ AK+ A+G+E+DGR +R+D+SIT++ HTPTPG+Y+
Sbjct:  113 GNRANPDPNACLGVFGLSLYTTERDLKDVFSKYGPLADVSIVYDQQSRRSRGFAFVYFENTPDAKEAKEKANGMELDGRRIRVDFSITKRPHTPTPGIYM 212          
BLAST of Transformer-2-related vs. Ensembl Medaka
Match: tra2b (transformer 2 beta homolog [Source:NCBI gene;Acc:100049285])

HSP 1 Score: 129.028 bits (323), Expect = 6.478e-35
Identity = 55/100 (55.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYL 558
            G+R NP P+ C+GVFGLSL T E+DL  VF KYG + DV +V D  + RSRGF F+Y+E    A+ AK+ A+G+E+DGR +R+D+SIT++ HTPTPG+Y+
Sbjct:  122 GNRANPDPNACLGVFGLSLYTTERDLKDVFSKYGPLADVSIVYDQQSRRSRGFAFVYFENTPDAKEAKEKANGMELDGRRIRVDFSITKRPHTPTPGIYM 221          
BLAST of Transformer-2-related vs. Ensembl Medaka
Match: tra2b (transformer 2 beta homolog [Source:NCBI gene;Acc:100049285])

HSP 1 Score: 128.257 bits (321), Expect = 1.356e-34
Identity = 55/100 (55.00%), Postives = 76/100 (76.00%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYL 558
            G+R NP P+ C+GVFGLSL T E+DL  VF KYG + DV +V D  + RSRGF F+Y+E    A+ AK+ A+G+E+DGR +R+D+SIT++ HTPTPG+Y+
Sbjct:  108 GNRANPDPNACLGVFGLSLYTTERDLKDVFSKYGPLADVSIVYDQQSRRSRGFAFVYFENTPDAKEAKEKANGMELDGRRIRVDFSITKRPHTPTPGIYM 207          
BLAST of Transformer-2-related vs. Planmine SMEST
Match: SMESG000031644.1 (SMESG000031644.1)

HSP 1 Score: 220.32 bits (560), Expect = 8.610e-80
Identity = 105/105 (100.00%), Postives = 105/105 (100.00%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKST 573
            GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKST
Sbjct:   79 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKST 183          

HSP 2 Score: 96.2857 bits (238), Expect = 8.610e-80
Identity = 48/53 (90.57%), Postives = 48/53 (90.57%), Query Frame = 2
Query:  563 KNLQDEGVMDTVIMMTEIHIVEGRLMIGESIDHEVHMVDQDQGAIQDVMNIDF 721
            K     GVMDTVIMMTEIHIVEGRLMIGESIDHEVHMVDQDQGAIQDVMNIDF
Sbjct:  180 KKSTRRGVMDTVIMMTEIHIVEGRLMIGESIDHEVHMVDQDQGAIQDVMNIDF 232          
BLAST of Transformer-2-related vs. Planmine SMEST
Match: SMESG000031644.1 (SMESG000031644.1)

HSP 1 Score: 219.935 bits (559), Expect = 1.151e-79
Identity = 105/105 (100.00%), Postives = 105/105 (100.00%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKST 573
            GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKST
Sbjct:   78 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKST 182          

HSP 2 Score: 96.2857 bits (238), Expect = 1.151e-79
Identity = 48/53 (90.57%), Postives = 48/53 (90.57%), Query Frame = 2
Query:  563 KNLQDEGVMDTVIMMTEIHIVEGRLMIGESIDHEVHMVDQDQGAIQDVMNIDF 721
            K     GVMDTVIMMTEIHIVEGRLMIGESIDHEVHMVDQDQGAIQDVMNIDF
Sbjct:  179 KKSTRRGVMDTVIMMTEIHIVEGRLMIGESIDHEVHMVDQDQGAIQDVMNIDF 231          
BLAST of Transformer-2-related vs. Planmine SMEST
Match: SMESG000031639.1 (SMESG000031639.1)

HSP 1 Score: 224.942 bits (572), Expect = 6.185e-73
Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKSTXXXXXXXXXXXXXXTYSRRSPDD 642
            GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKSTRRGGYGYGNYDDRDTYSRRSPDD
Sbjct:   79 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKSTRRGGYGYGNYDDRDTYSRRSPDD 206          
BLAST of Transformer-2-related vs. Planmine SMEST
Match: SMESG000031639.1 (SMESG000031639.1)

HSP 1 Score: 224.557 bits (571), Expect = 7.688e-73
Identity = 128/128 (100.00%), Postives = 128/128 (100.00%), Query Frame = 1
Query:  259 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKSTXXXXXXXXXXXXXXTYSRRSPDD 642
            GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKSTRRGGYGYGNYDDRDTYSRRSPDD
Sbjct:   78 GDRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKSTRRGGYGYGNYDDRDTYSRRSPDD 205          
BLAST of Transformer-2-related vs. Planmine SMEST
Match: SMESG000022369.1 (SMESG000022369.1)

HSP 1 Score: 134.42 bits (337), Expect = 2.563e-38
Identity = 59/103 (57.28%), Postives = 80/103 (77.67%), Query Frame = 1
Query:  262 DRDNPKPSTCIGVFGLSLKTDEKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAHGIEIDGRVVRIDYSITRKAHTPTPGVYLGKKS 570
            DRDNP PS C+G+F LSL+T EKDL+ +F +YGEI+DV LV+D  T RSRGFGF+Y++ ++ A  AK+  HG  + G+ +R+DYS+T +AHTPTPGVY G K+
Sbjct:   10 DRDNPLPSKCLGIFNLSLETTEKDLHEMFFRYGEIEDVSLVIDKVTKRSRGFGFVYFKNIDDAEIAKEKVHGTIVQGKQIRVDYSVTLRAHTPTPGVYKGTKT 112          
The following BLAST results are available for this feature:
BLAST of Transformer-2-related vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRA2B4.838e-3855.77transformer 2 beta homolog [Source:HGNC Symbol;Acc... [more]
TRA2A6.485e-3854.81transformer 2 alpha homolog [Source:HGNC Symbol;Ac... [more]
TRA2A6.675e-3854.81transformer 2 alpha homolog [Source:HGNC Symbol;Ac... [more]
TRA2A6.675e-3854.81transformer 2 alpha homolog [Source:HGNC Symbol;Ac... [more]
TRA2B4.734e-3756.86transformer 2 beta homolog [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Transformer-2-related vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsp-81.955e-2850.51SR Protein (Splicing factor) [Source:UniProtKB/Tr... [more]
rsp-81.955e-2850.51SR Protein (Splicing factor) [Source:UniProtKB/Tr... [more]
rsp-44.346e-1139.19Probable splicing factor, arginine/serine-rich 4 ... [more]
rbmx-21.585e-1037.97RBMX2 ortholog [Source:UniProtKB/TrEMBL;Acc:Q1831... [more]
rsp-41.587e-1039.19Probable splicing factor, arginine/serine-rich 4 ... [more]
back to top
BLAST of Transformer-2-related vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tra21.018e-3656.44gene:FBgn0003742 transcript:FBtr0089616[more]
tra24.167e-3656.44gene:FBgn0003742 transcript:FBtr0089615[more]
tra24.167e-3656.44gene:FBgn0003742 transcript:FBtr0089619[more]
tra28.744e-3656.44gene:FBgn0003742 transcript:FBtr0089620[more]
tra28.744e-3656.44gene:FBgn0003742 transcript:FBtr0089621[more]
back to top
BLAST of Transformer-2-related vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tra2a1.708e-3756.00transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2a1.708e-3756.00transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2b6.670e-3756.86transformer 2 beta homolog [Source:ZFIN;Acc:ZDB-GE... [more]
tra2b6.670e-3756.86transformer 2 beta homolog [Source:ZFIN;Acc:ZDB-GE... [more]
tra2a2.042e-3656.00transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Transformer-2-related vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhg51.101e-3756.73pleckstrin homology and RhoGEF domain containing G... [more]
rit16.993e-3756.86Ras-like without CAAX 1 [Source:Xenbase;Acc:XB-GEN... [more]
cirbp1.971e-1243.66cold inducible RNA binding protein [Source:NCBI ge... [more]
cirbp1.996e-1243.66cold inducible RNA binding protein [Source:NCBI ge... [more]
cirbp2.893e-1243.66cold inducible RNA binding protein [Source:NCBI ge... [more]
back to top
BLAST of Transformer-2-related vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tra2b3.322e-3855.77transformer 2 beta [Source:MGI Symbol;Acc:MGI:1060... [more]
Tra2b3.250e-3756.86transformer 2 beta [Source:MGI Symbol;Acc:MGI:1060... [more]
Tra2a3.647e-3754.81transformer 2 alpha [Source:MGI Symbol;Acc:MGI:193... [more]
Tra2a3.826e-3754.81transformer 2 alpha [Source:MGI Symbol;Acc:MGI:193... [more]
Cirbp5.754e-1545.21cold inducible RNA binding protein [Source:MGI Sym... [more]
back to top
BLAST of Transformer-2-related vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P62997|TRA2B_RAT2.273e-3656.86Transformer-2 protein homolog beta OS=Rattus norve... [more]
sp|P62996|TRA2B_MOUSE2.273e-3656.86Transformer-2 protein homolog beta OS=Mus musculus... [more]
sp|P62995|TRA2B_HUMAN2.273e-3656.86Transformer-2 protein homolog beta OS=Homo sapiens... [more]
sp|Q3ZBT6|TRA2B_BOVIN2.273e-3656.86Transformer-2 protein homolog beta OS=Bos taurus O... [more]
sp|Q6PFR5|TRA2A_MOUSE2.613e-3654.81Transformer-2 protein homolog alpha OS=Mus musculu... [more]
back to top
BLAST of Transformer-2-related vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P6031.195e-3964.29RRM domain-containing protein (Fragment) OS=Schist... [more]
A0A4S2L5X92.511e-3959.05RRM domain-containing protein OS=Opisthorchis feli... [more]
A7RUS72.992e-3962.50Predicted protein (Fragment) OS=Nematostella vecte... [more]
A0A183VLB54.819e-3962.86RRM domain-containing protein OS=Trichobilharzia r... [more]
A0A023FVY61.077e-3863.46RRM domain-containing protein (Fragment) OS=Amblyo... [more]
back to top
BLAST of Transformer-2-related vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000034164.12.610e-3755.88pep primary_assembly:Astyanax_mexicanus-2.0:12:654... [more]
tra2a7.820e-3753.85transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2a8.067e-3755.00transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2b1.191e-3553.85transformer-2 protein homolog alpha-like [Source:N... [more]
cirbpa1.081e-1142.03cold inducible RNA binding protein a [Source:ZFIN;... [more]
back to top
BLAST of Transformer-2-related vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tra2a8.698e-3956.86transformer 2 alpha homolog [Source:ZFIN;Acc:ZDB-G... [more]
tra2b1.472e-3754.81transformer 2 beta homolog [Source:ZFIN;Acc:ZDB-GE... [more]
RBM392.058e-1136.11RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
rbmx7.305e-1142.25RNA binding motif protein X-linked [Source:NCBI ge... [more]
RBM397.477e-1135.53RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Transformer-2-related vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NSR18.351e-1033.33Nucleolar protein that binds nuclear localization ... [more]
HRP11.641e-933.68Subunit of cleavage factor I; cleavage factor I is... [more]
IST31.144e-836.14Component of the U2 snRNP; required for the first ... [more]
PUB12.659e-831.51Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
PAB11.335e-732.14Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
back to top
BLAST of Transformer-2-related vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448024.006e-4362.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301491.437e-931.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387771.575e-938.36Peptidyl-prolyl cis-trans isomerase E [Source:Uni... [more]
EDO297152.033e-934.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339262.088e-934.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transformer-2-related vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tra2a9.685e-3855.88transformer 2a [Source:NCBI gene;Acc:100049284][more]
tra2a1.240e-3654.90transformer-2 protein homolog alpha [Source:NCBI g... [more]
tra2b4.611e-3555.00transformer 2 beta homolog [Source:NCBI gene;Acc:1... [more]
tra2b6.478e-3555.00transformer 2 beta homolog [Source:NCBI gene;Acc:1... [more]
tra2b1.356e-3455.00transformer 2 beta homolog [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Transformer-2-related vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031644.18.610e-80100.00SMESG000031644.1[more]
SMESG000031644.11.151e-79100.00SMESG000031644.1[more]
SMESG000031639.16.185e-73100.00SMESG000031639.1[more]
SMESG000031639.17.688e-73100.00SMESG000031639.1[more]
SMESG000022369.12.563e-3857.28SMESG000022369.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016995 ID=SMED30016995|Name=Transformer-2-related|organism=Schmidtea mediterranea sexual|type=transcript|length=943bp
CTTCCGATCTAAAGAAGCCATTTTATGATGAGTCGAAGACGTTCAAGGAG
TTACAGTTCTCCAAATAGAAGTCGTTTTATTTCTAGATCGCGGTCTAGAA
GTATTTCTTATTCACCGCGCAGAAGTCGTTCTAGATCTCGAACACCTCGA
CGTGTTAATAGGAGTTATTCAAGAAGTTTTAGTAGAAGTTACAGCAAAAG
TCCACGTTATAAAAGATCTGTATCAAGATCTTCCAATAGGTATAGACGAA
GATATTCTGGAGATCGTGACAATCCCAAGCCATCAACTTGCATAGGTGTT
TTCGGACTGTCATTGAAAACAGATGAAAAGGATCTTTATCGTGTATTTCA
AAAATATGGCGAGATTAAAGATGTGCAACTTGTATTAGATAATTATACAG
GCAGGTCGAGGGGATTTGGATTTATTTATTATGAAGAAGTTGAATCAGCT
AGAAATGCCAAAGACAGTGCACATGGAATAGAAATTGATGGAAGAGTAGT
GAGAATTGATTATAGTATTACTAGAAAAGCTCATACTCCTACTCCCGGAG
TTTATTTAGGAAAAAAATCTACAAGACGAGGGGGTTATGGATACGGTAAT
TATGATGACAGAGATACATATAGTCGAAGGTCGCCTGATGATAGGCGAAA
GTATCGATCACGAAGTCCATATGGTAGATCAAGATCAAGGAGCTATACAA
GACGTAATGAATATTGATTTTTAATATATAGGATGTTTTTGTAAATTAAA
ATTTCATTAGTACTATAAGTGAAAAAAATGCATTGTTATTTATAATTTTA
TTTTGAAGGTTGAAAGAAGATAAGAAAACTTTATTTAAAGAATATAGAAA
ATCTGAAATTAAAGAAATATTATAAAAGCTTATTTGAGAAAACCTTTTAA
GGAATGAAAATTAGAAAAATTAAAATAGAAGATGCCATCATAC
back to top

protein sequence of SMED30016995-orf-1

>SMED30016995-orf-1 ID=SMED30016995-orf-1|Name=SMED30016995-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=231bp
MMSRRRSRSYSSPNRSRFISRSRSRSISYSPRRSRSRSRTPRRVNRSYSR
SFSRSYSKSPRYKRSVSRSSNRYRRRYSGDRDNPKPSTCIGVFGLSLKTD
EKDLYRVFQKYGEIKDVQLVLDNYTGRSRGFGFIYYEEVESARNAKDSAH
GIEIDGRVVRIDYSITRKAHTPTPGVYLGKKSTRRGGYGYGNYDDRDTYS
RRSPDDRRKYRSRSPYGRSRSRSYTRRNEY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 93..166
e-value: 2.5E-23
score: 93.5
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 96..164
e-value: 1.8E-18
score: 66.1
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 92..170
score: 17.421
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 6..177
e-value: 1.0E-28
score: 102.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 192..234
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..86
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 32..48
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 49..68
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 9..31
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 199..216
NoneNo IPR availablePANTHERPTHR15241:SF182TRANSFORMER-2 PROTEIN HOMOLOG BETAcoord: 9..198
NoneNo IPR availablePANTHERPTHR15241TRANSFORMER-2-RELATEDcoord: 9..198
NoneNo IPR availableCDDcd12363RRM_TRA2coord: 93..170
e-value: 4.96898E-35
score: 117.726
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 85..199