SMED30016984

Overview
NameSMED30016984
Smed IDSMED30016984
Length (bp)1846
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30016984 (SMED30016984) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30016984 (SMED30016984) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30016984 (SMED30016984) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30016984 (SMED30016984) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016984

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30016984SMESG000026850.1 dd_Smed_v4_8097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30016984SMESG000026850.1 dd_Smed_v4_8097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016984SMESG000026850.1 dd_Smed_v4_8097_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30016984SMESG000026850.1 dd_Smed_v4_8097_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30016984 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001254:39422..59565 +8882
Homology
BLAST of SMED30016984 vs. Ensembl Human
Match: PATJ (PATJ crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:28881])

HSP 1 Score: 53.5286 bits (127), Expect = 1.089e-6
Identity = 62/322 (19.25%), Postives = 140/322 (43.48%), Query Frame = 2
Query:  353 LVKDVVKNSDVSQNTKIAVDDILLEVNGVNVTQLDYSELTILLSALPKYVQFVYAKKENEYEKLDASVEDRNLSSVKLEGGWMYPITIIVQGSRKEVDGLDFIKYPPSLKNISKCVIQRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGKYQTSKSLPLVEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSLDYS------SERDLLEDCEMFSIDI--DINDDLGIYLIDVENKK----SVICGFVEKSKLKS---KFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKM 1273
            ++ +V +    +++ ++   D +LEVNGV++    + E    L   P+ V+ V  + E  Y       ++ NL         ++P+ +  +  R    GL  +      +N S   I  I   G    D R+   D I+ +   +++N S+  +  +++     ++ + IG+ +           +++ +++ +  +  S  S   +   S + +IT  Q+L  +      S+++   D E  +++I  +++D LGI +            V    ++ S + +   K +VGD I+ +N   + G S  ++  L+KN + ++
Sbjct:  247 VIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEEAITALRQTPQKVRLVVYRDEAHYR------DEENLE--------IFPVDLQKKAGRGL--GLSIVGK----RNGSGVFISDIVKGGAADLDGRLIQGDQILSVNGEDMRNASQETVATILKCA-QGLVQLEIGRLRA---------GSWTSARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKRVSDPSQKNSGTDMEPRTVEINRELSDALGISIAGGRGSPLGDIPVFIAMIQASGVAARTQKLKVGDRIVSINGQPLDGLSHADVVNLLKNAYGRI 538          
BLAST of SMED30016984 vs. Ensembl Human
Match: PATJ (PATJ crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:28881])

HSP 1 Score: 52.7582 bits (125), Expect = 1.582e-6
Identity = 62/322 (19.25%), Postives = 140/322 (43.48%), Query Frame = 2
Query:  353 LVKDVVKNSDVSQNTKIAVDDILLEVNGVNVTQLDYSELTILLSALPKYVQFVYAKKENEYEKLDASVEDRNLSSVKLEGGWMYPITIIVQGSRKEVDGLDFIKYPPSLKNISKCVIQRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGKYQTSKSLPLVEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSLDYS------SERDLLEDCEMFSIDI--DINDDLGIYLIDVENKK----SVICGFVEKSKLKS---KFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKM 1273
            ++ +V +    +++ ++   D +LEVNGV++    + E    L   P+ V+ V  + E  Y       ++ NL         ++P+ +  +  R    GL  +      +N S   I  I   G    D R+   D I+ +   +++N S+  +  +++     ++ + IG+ +           +++ +++ +  +  S  S   +   S + +IT  Q+L  +      S+++   D E  +++I  +++D LGI +            V    ++ S + +   K +VGD I+ +N   + G S  ++  L+KN + ++
Sbjct:  247 VIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEEAITALRQTPQKVRLVVYRDEAHYR------DEENLE--------IFPVDLQKKAGRGL--GLSIVGK----RNGSGVFISDIVKGGAADLDGRLIQGDQILSVNGEDMRNASQETVATILKCA-QGLVQLEIGRLRA---------GSWTSARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKRVSDPSQKNSGTDMEPRTVEINRELSDALGISIAGGRGSPLGDIPVFIAMIQASGVAARTQKLKVGDRIVSINGQPLDGLSHADVVNLLKNAYGRI 538          
BLAST of SMED30016984 vs. Ensembl Human
Match: PATJ (PATJ crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:28881])

HSP 1 Score: 53.1434 bits (126), Expect = 1.754e-6
Identity = 62/322 (19.25%), Postives = 139/322 (43.17%), Query Frame = 2
Query:  353 LVKDVVKNSDVSQNTKIAVDDILLEVNGVNVTQLDYSELTILLSALPKYVQFVYAKKENEYEKLDASVEDRNLSSVKLEGGWMYPITIIVQGSRKEVDGLDFIKYPPSLKNISKCVIQRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGKYQTSKSLPLVEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSL------DYSSERDLLEDCEMFSIDI--DINDDLGIYLIDVENKK----SVICGFVEKSKLKS---KFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKM 1273
            ++ +V +    +++ ++   D +LEVNGV++    + E    L   P+ V+ V  + E  Y       ++ NL         ++P+ +  +  R    GL  +      +N S   I  I   G    D R+   D I+ +   +++N S+  +  +++     ++ + IG+ +           +++ +++ +  +  S  S   +   S + +IT  Q+L         S+++   D E  +++I  +++D LGI +            V    ++ S + +   K +VGD I+ +N   + G S  ++  L+KN + ++
Sbjct: 1463 VIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEEAITALRQTPQKVRLVVYRDEAHYR------DEENLE--------IFPVDLQKKAGRGL--GLSIVGK----RNGSGVFISDIVKGGAADLDGRLIQGDQILSVNGEDMRNASQETVATILKCA-QGLVQLEIGRLRA---------GSWTSARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKRVSDPSQKNSGTDMEPRTVEINRELSDALGISIAGGRGSPLGDIPVFIAMIQASGVAARTQKLKVGDRIVSINGQPLDGLSHADVVNLLKNAYGRI 1754          
BLAST of SMED30016984 vs. Ensembl Celegans
Match: magi-1 (MAGI (Membrane Associated Guanylate kinase Inverted) homolog [Source:UniProtKB/TrEMBL;Acc:D3YT29])

HSP 1 Score: 52.373 bits (124), Expect = 1.049e-6
Identity = 48/190 (25.26%), Postives = 87/190 (45.79%), Query Frame = 2
Query: 1130 VICGFVEKSKLKSKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKMEVVTVTVSRGSK--PCKFNHPIIMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHK-VNNSFGLFI---QDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRTNELG 1681
            VI G  E+     + + GDEI++++ ++V G S  E   L++   ++ + V + V R S+  P +          +NS   S +                   Y+V +H+  N+ FG  +   Q  NG T+ ++QP S   +   +  GD++I +NGI +    H   ++LI+  G S+ L ++  N  G
Sbjct:  749 VIGGAAEED---GRLQEGDEIVEIDGHNVEGASHSEAVVLLEAA-AQNKHVKLIVRRPSRTDPARRG-------SLNSAGPSGS-------------------YDVLLHRNENDGFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKDSGLSVRLTIAPPNTAG 908          
BLAST of SMED30016984 vs. Ensembl Celegans
Match: magi-1 (MAGI (Membrane Associated Guanylate kinase Inverted) homolog [Source:UniProtKB/TrEMBL;Acc:D3YT29])

HSP 1 Score: 51.9878 bits (123), Expect = 1.206e-6
Identity = 48/190 (25.26%), Postives = 87/190 (45.79%), Query Frame = 2
Query: 1130 VICGFVEKSKLKSKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKMEVVTVTVSRGSK--PCKFNHPIIMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHK-VNNSFGLFI---QDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRTNELG 1681
            VI G  E+     + + GDEI++++ ++V G S  E   L++   ++ + V + V R S+  P +          +NS   S +                   Y+V +H+  N+ FG  +   Q  NG T+ ++QP S   +   +  GD++I +NGI +    H   ++LI+  G S+ L ++  N  G
Sbjct:  749 VIGGAAEED---GRLQEGDEIVEIDGHNVEGASHSEAVVLLEAA-AQNKHVKLIVRRPSRTDPARRG-------SLNSAGPSGS-------------------YDVLLHRNENDGFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKDSGLSVRLTIAPPNTAG 908          
BLAST of SMED30016984 vs. Ensembl Celegans
Match: magi-1 (MAGI (Membrane Associated Guanylate kinase Inverted) homolog [Source:UniProtKB/TrEMBL;Acc:D3YT29])

HSP 1 Score: 51.6026 bits (122), Expect = 1.527e-6
Identity = 48/190 (25.26%), Postives = 87/190 (45.79%), Query Frame = 2
Query: 1130 VICGFVEKSKLKSKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKMEVVTVTVSRGSK--PCKFNHPIIMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHK-VNNSFGLFI---QDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRTNELG 1681
            VI G  E+     + + GDEI++++ ++V G S  E   L++   ++ + V + V R S+  P +          +NS   S +                   Y+V +H+  N+ FG  +   Q  NG T+ ++QP S   +   +  GD++I +NGI +    H   ++LI+  G S+ L ++  N  G
Sbjct:  524 VIGGAAEE---DGRLQEGDEIVEIDGHNVEGASHSEAVVLLE-AAAQNKHVKLIVRRPSRTDPARRG-------SLNSAGPSGS-------------------YDVLLHRNENDGFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKDSGLSVRLTIAPPNTAG 683          
BLAST of SMED30016984 vs. Ensembl Celegans
Match: magi-1 (MAGI (Membrane Associated Guanylate kinase Inverted) homolog [Source:UniProtKB/TrEMBL;Acc:D3YT29])

HSP 1 Score: 51.6026 bits (122), Expect = 1.651e-6
Identity = 48/190 (25.26%), Postives = 87/190 (45.79%), Query Frame = 2
Query: 1130 VICGFVEKSKLKSKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKMEVVTVTVSRGSK--PCKFNHPIIMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHK-VNNSFGLFI---QDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRTNELG 1681
            VI G  E+     + + GDEI++++ ++V G S  E   L++   ++ + V + V R S+  P +          +NS   S +                   Y+V +H+  N+ FG  +   Q  NG T+ ++QP S   +   +  GD++I +NGI +    H   ++LI+  G S+ L ++  N  G
Sbjct:  550 VIGGAAEED---GRLQEGDEIVEIDGHNVEGASHSEAVVLLE-AAAQNKHVKLIVRRPSRTDPARRG-------SLNSAGPSGS-------------------YDVLLHRNENDGFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKDSGLSVRLTIAPPNTAG 709          
BLAST of SMED30016984 vs. Ensembl Celegans
Match: magi-1 (MAGI (Membrane Associated Guanylate kinase Inverted) homolog [Source:UniProtKB/TrEMBL;Acc:D3YT29])

HSP 1 Score: 51.6026 bits (122), Expect = 1.704e-6
Identity = 48/190 (25.26%), Postives = 87/190 (45.79%), Query Frame = 2
Query: 1130 VICGFVEKSKLKSKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKMEVVTVTVSRGSK--PCKFNHPIIMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHK-VNNSFGLFI---QDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRTNELG 1681
            VI G  E+     + + GDEI++++ ++V G S  E   L++   ++ + V + V R S+  P +          +NS   S +                   Y+V +H+  N+ FG  +   Q  NG T+ ++QP S   +   +  GD++I +NGI +    H   ++LI+  G S+ L ++  N  G
Sbjct:  497 VIGGAAEED---GRLQEGDEIVEIDGHNVEGASHSEAVVLLE-AAAQNKHVKLIVRRPSRTDPARRG-------SLNSAGPSGS-------------------YDVLLHRNENDGFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKDSGLSVRLTIAPPNTAG 656          
BLAST of SMED30016984 vs. Ensembl Xenopus
Match: nphp3 (nephronophthisis 3 (adolescent) [Source:Xenbase;Acc:XB-GENE-487873])

HSP 1 Score: 70.8626 bits (172), Expect = 5.385e-12
Identity = 100/404 (24.75%), Postives = 168/404 (41.58%), Query Frame = 2
Query:  506 FVYAKKENEY-EKLDASVEDRNLSSVKLEGGWMYPITIIVQGSRKEVDGLDFIKYPPSLKNI----SKCVIQRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGKYQTSKSLPLVEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSLDYSSERDLLEDCEMFSIDIDINDDLGIYLIDVENKKS-VICGFVEKSKLK---SKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHS--KMEVVTVTVSRGSK-PCKFNHPI-IMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHKVNNSFGLFIQDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRTNEL 1678
             V    E+E+  KL    E R +  + +E              +  V GL F     +LKN     +   I+ ++P     KD R+  ND I+ I      NY   DM    Q    S+ M+     Q+S S+ LV   A           P+ N+  +L K          F   D   +   +ED E+      IND  G+    V  K S VI   +    L     + + GD I+++ D +V G +S ++ ++++NC +  KM V    + R SK P     P+  +PP+    +N  T+  +D   ++K   +      +T   V    G F    +G  +  + P S   Q   ++  D+II ++G+ + D  +  V+  +R+ G ++ L +SR+ EL
Sbjct:  112 LVSPYSEDEFNRKLQQMAEGRQIEYIDIE--------------KPSVGGLGFSVV--ALKNPTVGEAGVFIREVQPGSIADKDGRLKENDQILAI------NYIPLDMSVSHQE---SIAML----QQSSGSIRLVVAKA-----------PVLNNFQALMK---------FFSFYDLQIQWGHVEDIEL------INDGSGLGFGIVGGKASGVIVRTIVSGGLADRDGRLKTGDHILQIGDTNVQGMASDQVAQVLRNCGNSVKMVVARDPIERPSKPPAPATLPVGALPPKDVKGDNVSTKENTDNVYDIKLTKKEGQSLGIT---VVGYTGAFNGGSSGIYVKSIIPGSAADQSGCIQVQDRIIAVDGVNIQDYSNQDVVAALRNTGQTVHLTLSRSKEL 457          
BLAST of SMED30016984 vs. Ensembl Xenopus
Match: nphp3 (nephronophthisis 3 (adolescent) [Source:Xenbase;Acc:XB-GENE-487873])

HSP 1 Score: 68.9366 bits (167), Expect = 2.005e-11
Identity = 108/442 (24.43%), Postives = 182/442 (41.18%), Query Frame = 2
Query:  506 FVYAKKENEY-EKLDASVEDRNLSSVKLEGGWMYPITIIVQGSRKEVDGLDFIKYPPSLKNI----SKCVIQRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGKYQTSKSLPLVEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSLDYSSERDLLEDCEMFSIDIDINDDLGIYLIDVENKKS-VICGFVEKSKLK---SKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHS--KMEVVTVTVSRGSK-PCKFNHPI-IMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHKVNNSFGLFIQDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRTNELGKQIECTKNPIYYSDNL--NDPDTGICCSSNNSTNQKE 1786
             V    E+E+  KL    E R +  + +E              +  V GL F     +LKN     +   I+ ++P     KD R+  ND I+ I      NY   DM    Q    S+ M+     Q+S S+ LV   A           P+ N+  +L+             +LD   +   +ED E+      IND  G+    V  K S VI   +    L     + + GD I+++ D +V G +S ++ ++++NC +  KM V    + R SK P     P+  +PP+    +N  T    D++   KE     I        V    G F    +G  +  + P S   Q   ++  D+II ++G+ + D  +  V+  +R+ G ++ L +SR+ EL + +   ++ +     L  + P   I  SS N  NQ++
Sbjct:  117 LVSPYSEDEFNRKLQQMAEGRQIEYIDIE--------------KPSVGGLGFSVV--ALKNPTVGEAGVFIREVQPGSIADKDGRLKENDQILAI------NYIPLDMSVSHQE---SIAML----QQSSGSIRLVVAKA-----------PVLNNFQALSN------------NLDNQIQWGHVEDIEL------INDGSGLGFGIVGGKASGVIVRTIVSGGLADRDGRLKTGDHILQIGDTNVQGMASDQVAQVLRNCGNSVKMVVARDPIERPSKPPAPATLPVGALPPKDVKGDNENTDNVYDIKLTKKEGQSLGIT-------VVGYTGAFNGGSSGIYVKSIIPGSAADQSGCIQVQDRIIAVDGVNIQDYSNQDVVAALRNTGQTVHLTLSRSKELLELVATERSLVRAVPGLPSDPPVPEINKSSANEENQEQ 493          
BLAST of SMED30016984 vs. Ensembl Xenopus
Match: nphp3 (nephronophthisis 3 (adolescent) [Source:Xenbase;Acc:XB-GENE-487873])

HSP 1 Score: 67.781 bits (164), Expect = 3.465e-11
Identity = 99/398 (24.87%), Postives = 165/398 (41.46%), Query Frame = 2
Query:  524 ENEY-EKLDASVEDRNLSSVKLEGGWMYPITIIVQGSRKEVDGLDFIKYPPSLKNI----SKCVIQRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGKYQTSKSLPLVEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSLDYSSERDLLEDCEMFSIDIDINDDLGIYLIDVENKKS-VICGFVEKSKLK---SKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHS--KMEVVTVTVSRGSK-PCKFNHPI-IMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHKVNNSFGLFIQDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRTNEL 1678
            E+E+  KL    E R +  + +E              +  V GL F     +LKN     +   I+ ++P     KD R+  ND I+ I      NY   DM    Q    S+ M+     Q+S S+ LV   A           P+ N+  +L+             +LD   +   +ED E+      IND  G+    V  K S VI   +    L     + + GD I+++ D +V G +S ++ ++++NC +  KM V    + R SK P     P+  +PP+    +N  T    D++   KE     I        V    G F    +G  +  + P S   Q   ++  D+II ++G+ + D  +  V+  +R+ G ++ L +SR+ EL
Sbjct:  118 EDEFNRKLQQMAEGRQIEYIDIE--------------KPSVGGLGFSVV--ALKNPTVGEAGVFIREVQPGSIADKDGRLKENDQILAI------NYIPLDMSVSHQE---SIAML----QQSSGSIRLVVAKA-----------PVLNNFQALSN------------NLDNQIQWGHVEDIEL------INDGSGLGFGIVGGKASGVIVRTIVSGGLADRDGRLKTGDHILQIGDTNVQGMASDQVAQVLRNCGNSVKMVVARDPIERPSKPPAPATLPVGALPPKDVKGDNENTDNVYDIKLTKKEGQSLGIT-------VVGYTGAFNGGSSGIYVKSIIPGSAADQSGCIQVQDRIIAVDGVNIQDYSNQDVVAALRNTGQTVHLTLSRSKEL 450          
BLAST of SMED30016984 vs. Ensembl Xenopus
Match: nphp3 (nephronophthisis 3 (adolescent) [Source:Xenbase;Acc:XB-GENE-487873])

HSP 1 Score: 67.781 bits (164), Expect = 5.098e-11
Identity = 100/404 (24.75%), Postives = 166/404 (41.09%), Query Frame = 2
Query:  506 FVYAKKENEY-EKLDASVEDRNLSSVKLEGGWMYPITIIVQGSRKEVDGLDFIKYPPSLKNI----SKCVIQRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGKYQTSKSLPLVEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSLDYSSERDLLEDCEMFSIDIDINDDLGIYLIDVENKKS-VICGFVEKSKLK---SKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHS--KMEVVTVTVSRGSK-PCKFNHPI-IMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHKVNNSFGLFIQDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRTNEL 1678
             V    E+E+  KL    E R +  + +E              +  V GL F     +LKN     +   I+ ++P     KD R+  ND I+ I      NY   DM    Q    S+ M+     Q+S S+ LV   A           P+ N+  +L+             +LD   +   +ED E+      IND  G+    V  K S VI   +    L     + + GD I+++ D +V G +S ++ ++++NC +  KM V    + R SK P     P+  +PP+    +N  T    D++   KE     I        V    G F    +G  +  + P S   Q   ++  D+II ++G+ + D  +  V+  +R+ G ++ L +SR+ EL
Sbjct:  112 LVSPYSEDEFNRKLQQMAEGRQIEYIDIE--------------KPSVGGLGFSVV--ALKNPTVGEAGVFIREVQPGSIADKDGRLKENDQILAI------NYIPLDMSVSHQE---SIAML----QQSSGSIRLVVAKA-----------PVLNNFQALSN------------NLDNQIQWGHVEDIEL------INDGSGLGFGIVGGKASGVIVRTIVSGGLADRDGRLKTGDHILQIGDTNVQGMASDQVAQVLRNCGNSVKMVVARDPIERPSKPPAPATLPVGALPPKDVKGDNENTDNVYDIKLTKKEGQSLGIT-------VVGYTGAFNGGSSGIYVKSIIPGSAADQSGCIQVQDRIIAVDGVNIQDYSNQDVVAALRNTGQTVHLTLSRSKEL 450          
BLAST of SMED30016984 vs. Ensembl Xenopus
Match: nphp3 (nephronophthisis 3 (adolescent) [Source:Xenbase;Acc:XB-GENE-487873])

HSP 1 Score: 66.2402 bits (160), Expect = 1.385e-10
Identity = 98/402 (24.38%), Postives = 161/402 (40.05%), Query Frame = 2
Query:  506 FVYAKKENEY-EKLDASVEDRNLSSVKLEGGWMYPITIIVQGSRKEVDGLDFIKYPPSLKNI----SKCVIQRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGKYQTSKSLPLVEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSLDYSSERDLLEDCEMFSIDIDINDDLGIYLIDVENKKS-VICGFVEKSKLK---SKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHS--KMEVVTVTVSRGSKPCKFNHPIIMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHKVNNSFGLFIQDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRTNEL 1678
             V    E+E+  KL    E R +  + +E              +  V GL F     +LKN     +   I+ ++P     KD R+  ND I+ I      NY   DM    Q    S+ M+     Q+S S+ LV   A           P+ N+  +L+             +LD   +   +ED E+      IND  G+    V  K S VI   +    L     + + GD I+++ D +V G +S ++ ++++NC +  KM V    + R SKP         P  +      P  +K D   N+K       V   T        G F    +G  +  + P S   Q   ++  D+II ++G+ + D  +  V+  +R+ G ++ L +SR+ EL
Sbjct:  112 LVSPYSEDEFNRKLQQMAEGRQIEYIDIE--------------KPSVGGLGFSVV--ALKNPTVGEAGVFIREVQPGSIADKDGRLKENDQILAI------NYIPLDMSVSHQE---SIAML----QQSSGSIRLVVAKA-----------PVLNNFQALSN------------NLDNQIQWGHVEDIEL------INDGSGLGFGIVGGKASGVIVRTIVSGGLADRDGRLKTGDHILQIGDTNVQGMASDQVAQVLRNCGNSVKMVVARDPIERPSKPPA-------PATLPVGALPPKDVKGD---NVKGQSLGITVVGYT--------GAFNGGSSGIYVKSIIPGSAADQSGCIQVQDRIIAVDGVNIQDYSNQDVVAALRNTGQTVHLTLSRSKEL 437          
BLAST of SMED30016984 vs. UniProt/SwissProt
Match: sp|Q8NI35|INADL_HUMAN (InaD-like protein OS=Homo sapiens OX=9606 GN=PATJ PE=1 SV=3)

HSP 1 Score: 53.1434 bits (126), Expect = 8.425e-6
Identity = 62/322 (19.25%), Postives = 139/322 (43.17%), Query Frame = 2
Query:  353 LVKDVVKNSDVSQNTKIAVDDILLEVNGVNVTQLDYSELTILLSALPKYVQFVYAKKENEYEKLDASVEDRNLSSVKLEGGWMYPITIIVQGSRKEVDGLDFIKYPPSLKNISKCVIQRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGKYQTSKSLPLVEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSL------DYSSERDLLEDCEMFSIDI--DINDDLGIYLIDVENKK----SVICGFVEKSKLKS---KFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKM 1273
            ++ +V +    +++ ++   D +LEVNGV++    + E    L   P+ V+ V  + E  Y       ++ NL         ++P+ +  +  R    GL  +      +N S   I  I   G    D R+   D I+ +   +++N S+  +  +++     ++ + IG+ +           +++ +++ +  +  S  S   +   S + +IT  Q+L         S+++   D E  +++I  +++D LGI +            V    ++ S + +   K +VGD I+ +N   + G S  ++  L+KN + ++
Sbjct: 1463 VIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEEAITALRQTPQKVRLVVYRDEAHYR------DEENLE--------IFPVDLQKKAGRGL--GLSIVGK----RNGSGVFISDIVKGGAADLDGRLIQGDQILSVNGEDMRNASQETVATILKCA-QGLVQLEIGRLRA---------GSWTSARTTSQNSQGSQQSAHSSCHPSFAPVITGLQNLVGTKRVSDPSQKNSGTDMEPRTVEINRELSDALGISIAGGRGSPLGDIPVFIAMIQASGVAARTQKLKVGDRIVSINGQPLDGLSHADVVNLLKNAYGRI 1754          
BLAST of SMED30016984 vs. TrEMBL
Match: F6ZDU0 (Nephrocystin-3 OS=Xenopus tropicalis OX=8364 GN=nphp3 PE=4 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 8.455e-9
Identity = 100/404 (24.75%), Postives = 168/404 (41.58%), Query Frame = 2
Query:  506 FVYAKKENEY-EKLDASVEDRNLSSVKLEGGWMYPITIIVQGSRKEVDGLDFIKYPPSLKNI----SKCVIQRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGKYQTSKSLPLVEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSLDYSSERDLLEDCEMFSIDIDINDDLGIYLIDVENKKS-VICGFVEKSKLK---SKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHS--KMEVVTVTVSRGSK-PCKFNHPI-IMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHKVNNSFGLFIQDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRTNEL 1678
             V    E+E+  KL    E R +  + +E              +  V GL F     +LKN     +   I+ ++P     KD R+  ND I+ I      NY   DM    Q    S+ M+     Q+S S+ LV   A           P+ N+  +L K          F   D   +   +ED E+      IND  G+    V  K S VI   +    L     + + GD I+++ D +V G +S ++ ++++NC +  KM V    + R SK P     P+  +PP+    +N  T+  +D   ++K   +      +T   V    G F    +G  +  + P S   Q   ++  D+II ++G+ + D  +  V+  +R+ G ++ L +SR+ EL
Sbjct:  112 LVSPYSEDEFNRKLQQMAEGRQIEYIDIE--------------KPSVGGLGFSVV--ALKNPTVGEAGVFIREVQPGSIADKDGRLKENDQILAI------NYIPLDMSVSHQE---SIAML----QQSSGSIRLVVAKA-----------PVLNNFQALMK---------FFSFYDLQIQWGHVEDIEL------INDGSGLGFGIVGGKASGVIVRTIVSGGLADRDGRLKTGDHILQIGDTNVQGMASDQVAQVLRNCGNSVKMVVARDPIERPSKPPAPATLPVGALPPKDVKGDNVSTKENTDNVYDIKLTKKEGQSLGIT---VVGYTGAFNGGSSGIYVKSIIPGSAADQSGCIQVQDRIIAVDGVNIQDYSNQDVVAALRNTGQTVHLTLSRSKEL 457          
BLAST of SMED30016984 vs. TrEMBL
Match: A1L0Y3 (LOC100036704 protein (Fragment) OS=Xenopus tropicalis OX=8364 GN=LOC100036704 PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 2.054e-8
Identity = 93/375 (24.80%), Postives = 160/375 (42.67%), Query Frame = 2
Query:  689 SKCVIQRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGKYQTSKSLPLVEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSLDYSSERDLLEDCEMFSIDIDINDDLGIYLIDVENKKS-VICGFVEKSKLK---SKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHS--KMEVVTVTVSRGSK-PCKFNHPI-IMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHKVNNSFGLFIQDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRTNELGKQIECTKNPIYYSDNLNDPDTG-ICCSSNNSTNQKE 1786
            +   I+ ++P     KD R+  ND I+ I      NY   DM    Q    S+ M+     Q+S S+ LV   A           P+ N+  +L+             +LD   +   +ED E+      IND  G+    V  K S VI   +    L     + + GD I+++ D +V G +S ++ ++++NC +  KM V    + R SK P     P+  +PP+    +N  T    D++   KE     I        V    G F    +G  +  + P S   Q   ++  D+II ++G+ + D  +  V+  +R+ G ++ L +SR+ EL + +   ++ +      +DP    I  SS N  NQ++
Sbjct:   14 AGVFIREVQPGSIADKDGRLKENDQILAI------NYIPLDMSVSHQE---SIAML----QQSSGSIRLVVAKA-----------PVLNNFQALSN------------NLDNQIQWGHVEDIEL------INDGSGLGFGIVGGKASGVIVRTIVSGGLADRDGRLKTGDHILQIGDTNVQGMASDQVAQVLRNCGNSVKMVVARDPIERPSKPPAPATLPVGALPPKDVKGDNENTDNVYDIKLTKKEGQSLGIT-------VVGYTGAFNGGSSGIYVKSIIPGSAADQSGCIQVQDRIIAVDGVNIQDYSNQDVVAALRNTGQTVHLTLSRSKELLELVATERSLVRVPGLPSDPPVPEINKSSANEENQEQ 339          
BLAST of SMED30016984 vs. TrEMBL
Match: A0A5G3JA15 (Nephrocystin-3 OS=Xenopus tropicalis OX=8364 GN=nphp3 PE=4 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.149e-8
Identity = 108/442 (24.43%), Postives = 182/442 (41.18%), Query Frame = 2
Query:  506 FVYAKKENEY-EKLDASVEDRNLSSVKLEGGWMYPITIIVQGSRKEVDGLDFIKYPPSLKNI----SKCVIQRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGKYQTSKSLPLVEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSLDYSSERDLLEDCEMFSIDIDINDDLGIYLIDVENKKS-VICGFVEKSKLK---SKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHS--KMEVVTVTVSRGSK-PCKFNHPI-IMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHKVNNSFGLFIQDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRTNELGKQIECTKNPIYYSDNL--NDPDTGICCSSNNSTNQKE 1786
             V    E+E+  KL    E R +  + +E              +  V GL F     +LKN     +   I+ ++P     KD R+  ND I+ I      NY   DM    Q    S+ M+     Q+S S+ LV   A           P+ N+  +L+             +LD   +   +ED E+      IND  G+    V  K S VI   +    L     + + GD I+++ D +V G +S ++ ++++NC +  KM V    + R SK P     P+  +PP+    +N  T    D++   KE     I        V    G F    +G  +  + P S   Q   ++  D+II ++G+ + D  +  V+  +R+ G ++ L +SR+ EL + +   ++ +     L  + P   I  SS N  NQ++
Sbjct:  117 LVSPYSEDEFNRKLQQMAEGRQIEYIDIE--------------KPSVGGLGFSVV--ALKNPTVGEAGVFIREVQPGSIADKDGRLKENDQILAI------NYIPLDMSVSHQE---SIAML----QQSSGSIRLVVAKA-----------PVLNNFQALSN------------NLDNQIQWGHVEDIEL------INDGSGLGFGIVGGKASGVIVRTIVSGGLADRDGRLKTGDHILQIGDTNVQGMASDQVAQVLRNCGNSVKMVVARDPIERPSKPPAPATLPVGALPPKDVKGDNENTDNVYDIKLTKKEGQSLGIT-------VVGYTGAFNGGSSGIYVKSIIPGSAADQSGCIQVQDRIIAVDGVNIQDYSNQDVVAALRNTGQTVHLTLSRSKELLELVATERSLVRAVPGLPSDPPVPEINKSSANEENQEQ 493          
BLAST of SMED30016984 vs. TrEMBL
Match: A0A3Q0RW96 (Membrane associated guanylate kinase, WW and PDZ domain containing 3b OS=Amphilophus citrinellus OX=61819 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 5.090e-8
Identity = 106/511 (20.74%), Postives = 202/511 (39.53%), Query Frame = 2
Query:  284 FQKQGNCFGFRISTNFKGDKYEHLVKDVVKNSDVSQNTKIAVDDILLEVNGVNVTQLDYSELTILLSALP--KYVQFVYAKKENEYEKLDASVEDRNLSSVKLEGGWMYPITIIVQGS----RKEVDGLDFIKYPPSLK-NISKCVI-QRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQN----KLYSVLMICIGKYQTSKSLPLVE------FSAFSRSQSATLEN------------PLSNSSTSLAKRKSISQIITSFQSLDYSSERDLLEDCEMFSIDI----DINDDLGIYLIDVENKKS-------VICGFVEKSKLKSKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKMEVVTVT----VSRGSKPCKFNHPIIMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIH-KVNNSFGLFIQDCNGPTINKVQPE--------SEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDL 1654
             +K    FGF I    + D++   VK+V+ +   +Q+ K+A  D+++E+NG+ V    + E+  +  ++P  +YV  V  +                        G+  P   + +G+    + E+  +  +K P      I+ C + Q++K        + +   D I +I   NVQ  S   +  ++++       +VL++  G+    KSL  V        S+  +  +A+ E             P  +++++L    S  + +T      Y   + LLE      ID+    DI    G  ++  E  +        V  G  EK     + R GDE+I ++   V G S  ++  LM N     +V+       + RG    +   P+++       N SP   +  +   L     +H  +++T+H K    FG  I        + V P         S   +  ++  GD+I  +NG  + +  H+ ++ LI+  G+ + L
Sbjct:  409 LKKSSQGFGFTIIGGDRTDEFLQ-VKNVLSDGPAAQDKKMASGDVIVEINGICVLGKTHPEVVQMFQSIPINQYVNMVLCR------------------------GYSLPPDALHEGATTMLQPELVSVPLVKGPGGFGFAIADCPLGQKVKMILDAQWCRGLQKGDVIKEINRQNVQTLSHAQVVDILKDLPVGSEVNVLVLRGGQTSPVKSLKPVSKILYLPISSLLQEMTASTETLDTVXDSAPQALPYHSNTSTLRSADSPKRDVTEM----YLKSKALLEKPHTKDIDVFLKRDIETGFGFRVLGGEGPQQPVYIGAIVPNGAAEKD---GRLRAGDELIGIDGVIVKGRSHKQVLDLMTNAARNGQVMLTVRRKVIYRGDAGGQEMAPVLV-------NGSPILPRLPMPSAL-----DHESFDITLHRKETEGFGFVILTSKSKPPHGVIPHKIGRIIEGSPTDRCGLLHVGDRISAVNGRSIIELSHNDIVQLIKDAGNVVTL 875          
BLAST of SMED30016984 vs. TrEMBL
Match: A0A5G3J7V4 (Nephrocystin-3 OS=Xenopus tropicalis OX=8364 GN=nphp3 PE=4 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 5.440e-8
Identity = 99/398 (24.87%), Postives = 165/398 (41.46%), Query Frame = 2
Query:  524 ENEY-EKLDASVEDRNLSSVKLEGGWMYPITIIVQGSRKEVDGLDFIKYPPSLKNI----SKCVIQRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGKYQTSKSLPLVEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSLDYSSERDLLEDCEMFSIDIDINDDLGIYLIDVENKKS-VICGFVEKSKLK---SKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHS--KMEVVTVTVSRGSK-PCKFNHPI-IMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHKVNNSFGLFIQDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRTNEL 1678
            E+E+  KL    E R +  + +E              +  V GL F     +LKN     +   I+ ++P     KD R+  ND I+ I      NY   DM    Q    S+ M+     Q+S S+ LV   A           P+ N+  +L+             +LD   +   +ED E+      IND  G+    V  K S VI   +    L     + + GD I+++ D +V G +S ++ ++++NC +  KM V    + R SK P     P+  +PP+    +N  T    D++   KE     I        V    G F    +G  +  + P S   Q   ++  D+II ++G+ + D  +  V+  +R+ G ++ L +SR+ EL
Sbjct:  118 EDEFNRKLQQMAEGRQIEYIDIE--------------KPSVGGLGFSVV--ALKNPTVGEAGVFIREVQPGSIADKDGRLKENDQILAI------NYIPLDMSVSHQE---SIAML----QQSSGSIRLVVAKA-----------PVLNNFQALSN------------NLDNQIQWGHVEDIEL------INDGSGLGFGIVGGKASGVIVRTIVSGGLADRDGRLKTGDHILQIGDTNVQGMASDQVAQVLRNCGNSVKMVVARDPIERPSKPPAPATLPVGALPPKDVKGDNENTDNVYDIKLTKKEGQSLGIT-------VVGYTGAFNGGSSGIYVKSIIPGSAADQSGCIQVQDRIIAVDGVNIQDYSNQDVVAALRNTGQTVHLTLSRSKEL 450          
BLAST of SMED30016984 vs. Ensembl Nematostella
Match: EDO33706 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRG3])

HSP 1 Score: 54.6842 bits (130), Expect = 1.202e-7
Identity = 115/555 (20.72%), Postives = 221/555 (39.82%), Query Frame = 2
Query:  215 ETKSVVFMWTEALGDNSVILVSRFQKQGNCFGFRISTNFKGDKYE-------HLVKDVVKNSDVSQNTKIAVDDILLEVNGVNVTQLDYSELTILLSALPKYVQFVYAKKENEYEKLDASV-----EDRNLSSVKLE----------GGWMYPITIIVQGS----------------RKEVDGLDF--IKYP-PSLKNISKCVIQRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGK-------YQ----TSKSLP------LVEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSLDY-----------SSERDLLEDC-----EMFSIDIDINDDLGIYLIDVENKKSVICGFVEKS---KLKSKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKMEVVTVTVSRGSKPCKFNHPIIMPPEMNSQNNSPTQIK-SDLEENLKEID---ENHIVYNVTIHKVNNSFGLFIQDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSC 1636
            +T++V   +   +GDN  ILV+   K     G  IS   +G +Y        H +  V     V +N  I   D L+EVNGV V  L ++E+  L+ +LP   + V A+K++  E+ + SV     E  +L +V+L+          G    P +   Q S                 K   GL F  + Y  PS    +  VI+ +   G   +D  +   D ++ + ++N+++ S +   + ++      ++I + K       Y+      +SLP      L  F   + S+    +  L ++  +  K      ++TS QS  +           S + D L D      +  +I   +   LG+ L   E+    +   V +     +  +  VGD I+ VND S+ G S      +++    + ++V V++ +     + + P  +         +P  +   + E  L+ ++   E  +   ++I    N  G       G  +  V   S + +   ++ GD+I+ ++G  + +  H+  + +IR  
Sbjct:  765 DTEAVKQHYQTIIGDNMEILVAEMTKFSPAGGLGIS--LEGTQYPLDGSMPWHRIHAVNPEGPVGKNGIIQSGDHLIEVNGVGVLDLGHNEVVTLIQSLPMEFRLVVARKKDYPEEPETSVTMSQSEVESLPTVQLDDVSSTIDAPVGTGPSPSSSRRQKSVSDQSMWSNKIEYVELEKADKGLGFSILDYQDPSNPEKTVIVIRSLVHGGVAEQDGSLHPGDRLMSVNEVNLEHASLDFAVQTLKGTNRGNVIIGVAKPIPVPDDYEEDSNQGESLPDTTRPFLPTFDLDNESRPGKADISLMDNIENNGKDSDTDSMVTSEQSSKFDFGPPLLFSGDSLDLDNLPDSVKSRMQTITIRRQMVGKLGVSLKGDEDGSGCVVTSVMRGGAIAIDGRIGVGDHIVAVNDESLIGLSRHAARAVLRKQSLQKDIV-VSIDKQEASTREDSPAFL---------TPFDVPFVETESGLRVVELRREPEVGLGISI--AGNKRG----QRQGVHVRHVLENSSVARLGELKAGDQILEVDGHDLRNASHEEAVEVIRRA 1301          

HSP 2 Score: 54.299 bits (129), Expect = 1.390e-7
Identity = 61/274 (22.26%), Postives = 120/274 (43.80%), Query Frame = 2
Query: 1046 EDCEMFSID-IDINDDLGIYL---IDVENKKSVICGFVEK------SKLKSKFRVGDEIIKVNDNSVSGHS---------------SLEIGKLMKNCHSKMEVVTVTV-SRGSKPCKFNH------PIIMPPEMN-SQNNSPTQIKSDLEENLKEID----ENH-----------IVYNVTIHKVNNSFGLFIQDCNGP--------TINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRTNELGKQIECT 1699
            ED E+F++D +     LGI +   I   N   +   F++       + L  + RV D+II+V   S+ G +               SL++ + +   HS+ E    T  S G +  + +H      P+++ PE + +  ++  + +++L+  L+ +D    + H           +V  +T        G+ ++    P         I+ V PE  + +  I++ GD +I +NG+ V D  H+ V+TLI+S      L ++R  +  ++ E +
Sbjct:  609 EDVELFNVDLVKGTRGLGITIAGYIGEANSDELAGIFIKSIAHGSTAALDGRLRVNDQIIQVGSVSLHGKNNGEAVEILKQTGPVVSLKVARHIPGKHSRPETPHSTPHSPGRQTPQSSHSPRSVTPVVIQPEKSIAVESADAKAEAELQRELQTLDTEAVKQHYQTIIGDNMEILVAEMTKFSPAGGLGISLEGTQYPLDGSMPWHRIHAVNPEGPVGKNGIIQSGDHLIEVNGVGVLDLGHNEVVTLIQSLPMEFRLVVARKKDYPEEPETS 882          
BLAST of SMED30016984 vs. Planmine SMEST
Match: SMESG000026850.1 (SMESG000026850.1)

HSP 1 Score: 1151.35 bits (2977), Expect = 0.000e+0
Identity = 565/572 (98.78%), Postives = 565/572 (98.78%), Query Frame = 2
Query:  122 MFNKNGYKLKSSFRKTLMATNEIYLYSITPEETKSVVFMWTEALGDNSVILVSRFQKQGNCFGFRISTNFKGDKYEHLVKDVVKNSDVSQNTKIAVDDILLEVNGVNVTQLDYSELTILLSALPKYVQFVYAKKENEYEKLDASVEDRNLSSVKLEGGWMYPITIIVQGSRKEVDGLDFIKYPPSLKNISKCVIQRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGKYQTSKSLPLVEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSLDYSSERDLLEDCEMFSIDIDINDDLGIYLIDVENKKSVICGFVEKSKLKSKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKMEVVTVTVSRGSKPCKFNHPIIMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHKVNNSFGLFIQDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRTNELGKQIECTKNPIYYSDNLNDPDTGICCSSNNSTNQKEKRKSANIQNSNRCIKTM 1837
            MFNKNGYKLKSSFRKTLMATNEIYLYSITPEE KSVVFMWTEALGDNSVILVSRFQKQGNCFGFRISTNFKGDKYEHLVKDVVKNSDVSQNTKIAVDDILLEVNGVNVTQLDYSELTILLSALPK VQFVYAKKENEYEKLDASVEDRNLSS KLEGGWMYPITIIVQGSRKEVDGLDFIKYPPSLKNISKCVIQRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGKYQTSKSLP VEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSLDYSSERDLLEDCEM SIDIDINDDLGIYLIDVENKKSVICGFVEKSKLKSKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKMEVVTVTVSRGSKPCKFNHPIIMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHKVNNSFGLFIQDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCG SIDLEMSRTNELGKQIECTKNPIYYSDNLNDPDTGICCSSNNSTNQKE RKSANIQNSNRCIKTM
Sbjct:    1 MFNKNGYKLKSSFRKTLMATNEIYLYSITPEEAKSVVFMWTEALGDNSVILVSRFQKQGNCFGFRISTNFKGDKYEHLVKDVVKNSDVSQNTKIAVDDILLEVNGVNVTQLDYSELTILLSALPKNVQFVYAKKENEYEKLDASVEDRNLSSAKLEGGWMYPITIIVQGSRKEVDGLDFIKYPPSLKNISKCVIQRIKPFGYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGKYQTSKSLPRVEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSLDYSSERDLLEDCEMLSIDIDINDDLGIYLIDVENKKSVICGFVEKSKLKSKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKMEVVTVTVSRGSKPCKFNHPIIMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHKVNNSFGLFIQDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGQSIDLEMSRTNELGKQIECTKNPIYYSDNLNDPDTGICCSSNNSTNQKENRKSANIQNSNRCIKTM 572          
BLAST of SMED30016984 vs. Planmine SMEST
Match: SMESG000053393.1 (SMESG000053393.1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.134e-15
Identity = 74/284 (26.06%), Postives = 132/284 (46.48%), Query Frame = 2
Query:  938 ENPLSNSSTSLAKRKSISQIITSFQSLDYSSERDLLEDCEMFSIDIDINDDLGIYLIDVENK-----KSVICGFVEKS--KLKSKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKMEVVTVTVSRGSKPCKFNHPIIMPPEMNSQNNSPTQIKSDLEENLKEIDENHI-----------VYNVTIHKVNNSFGLFIQDCN-----GPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSR---TNELGKQIECTKNPI 1711
            EN  S SS S    +S++  ++  +++    +    E  ++ +I+ID     G+ L+ V NK        ICGF + S   L  +  +GDE++K+N   V G S   +  ++K C  + E + +T+ R   P        +P  +N+ + +P +   +  E     DEN I           +++V + K    FG FI DCN     G  + KV  +     +  +R GD+I+ IN   V ++++D VL  +R C +++++ + R   + +  K IE    PI
Sbjct: 1463 ENSFSVSSLS---NESVTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKR--HPDNLVKMACIPASVNT-SVAPCEKSENAVET--STDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPI 1738          
BLAST of SMED30016984 vs. Planmine SMEST
Match: SMESG000030959.1 (SMESG000030959.1)

HSP 1 Score: 50.447 bits (119), Expect = 4.652e-6
Identity = 54/196 (27.55%), Postives = 92/196 (46.94%), Query Frame = 2
Query: 1112 VENKKSVICGFVEKSKLKSKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKMEVVTVTVSRGSKPCKFNHPIIMPPEMNSQNNS--PTQIKSDLEENLKEIDENH---IVYNVTIHKVNNSFGLFI---QDCNGPT--INKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRT 1669
            +EN  +  CG +         RVGD I+ VN NSVS     +I + +KNC        VT+     P +  H    P  +NS  +S   + I+S    + ++ D N    + ++VT+++ +  FG  I   QD N     + ++  +    Q   ++ GDKI++ING       H+  + +I++ G SI L + R+
Sbjct: 1187 IENSPAQKCGLL---------RVGDRILSVNGNSVSRMRHEKIVQTIKNCGR-----NVTLRISPVPEEGGHS--GPTSINSYESSDQGSSIRSS-NASYQKSDTNSSGDVDFDVTLNRGSKGFGFSIRGGQDFNKMPLFVLRIADDGPAKQDGRLKVGDKILQINGKSTTGMTHNQAINIIQAGGKSIRLLVRRS 1365          
BLAST of SMED30016984 vs. Planmine SMEST
Match: SMESG000030959.1 (SMESG000030959.1)

HSP 1 Score: 50.447 bits (119), Expect = 4.779e-6
Identity = 54/196 (27.55%), Postives = 92/196 (46.94%), Query Frame = 2
Query: 1112 VENKKSVICGFVEKSKLKSKFRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKMEVVTVTVSRGSKPCKFNHPIIMPPEMNSQNNS--PTQIKSDLEENLKEIDENH---IVYNVTIHKVNNSFGLFI---QDCNGPT--INKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLTLIRSCGHSIDLEMSRT 1669
            +EN  +  CG +         RVGD I+ VN NSVS     +I + +KNC        VT+     P +  H    P  +NS  +S   + I+S    + ++ D N    + ++VT+++ +  FG  I   QD N     + ++  +    Q   ++ GDKI++ING       H+  + +I++ G SI L + R+
Sbjct: 1187 IENSPAQKCGLL---------RVGDRILSVNGNSVSRMRHEKIVQTIKNCGR-----NVTLRISPVPEEGGHS--GPTSINSYESSDQGSSIRSS-NASYQKSDTNSSGDVDFDVTLNRGSKGFGFSIRGGQDFNKMPLFVLRIADDGPAKQDGRLKVGDKILQINGKSTTGMTHNQAINIIQAGGKSIRLLVRRS 1365          
The following BLAST results are available for this feature:
BLAST of SMED30016984 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
PATJ1.089e-619.25PATJ crumbs cell polarity complex component [Sourc... [more]
PATJ1.582e-619.25PATJ crumbs cell polarity complex component [Sourc... [more]
PATJ1.754e-619.25PATJ crumbs cell polarity complex component [Sourc... [more]
back to top
BLAST of SMED30016984 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
magi-11.049e-625.26MAGI (Membrane Associated Guanylate kinase Inverte... [more]
magi-11.206e-625.26MAGI (Membrane Associated Guanylate kinase Inverte... [more]
magi-11.527e-625.26MAGI (Membrane Associated Guanylate kinase Inverte... [more]
magi-11.651e-625.26MAGI (Membrane Associated Guanylate kinase Inverte... [more]
magi-11.704e-625.26MAGI (Membrane Associated Guanylate kinase Inverte... [more]
back to top
BLAST of SMED30016984 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016984 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016984 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nphp35.385e-1224.75nephronophthisis 3 (adolescent) [Source:Xenbase;Ac... [more]
nphp32.005e-1124.43nephronophthisis 3 (adolescent) [Source:Xenbase;Ac... [more]
nphp33.465e-1124.87nephronophthisis 3 (adolescent) [Source:Xenbase;Ac... [more]
nphp35.098e-1124.75nephronophthisis 3 (adolescent) [Source:Xenbase;Ac... [more]
nphp31.385e-1024.38nephronophthisis 3 (adolescent) [Source:Xenbase;Ac... [more]
back to top
BLAST of SMED30016984 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016984 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q8NI35|INADL_HUMAN8.425e-619.25InaD-like protein OS=Homo sapiens OX=9606 GN=PATJ ... [more]
back to top
BLAST of SMED30016984 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
F6ZDU08.455e-924.75Nephrocystin-3 OS=Xenopus tropicalis OX=8364 GN=np... [more]
A1L0Y32.054e-824.80LOC100036704 protein (Fragment) OS=Xenopus tropica... [more]
A0A5G3JA153.149e-824.43Nephrocystin-3 OS=Xenopus tropicalis OX=8364 GN=np... [more]
A0A3Q0RW965.090e-820.74Membrane associated guanylate kinase, WW and PDZ d... [more]
A0A5G3J7V45.440e-824.87Nephrocystin-3 OS=Xenopus tropicalis OX=8364 GN=np... [more]
back to top
BLAST of SMED30016984 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016984 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016984 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016984 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO337061.202e-720.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30016984 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016984 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000026850.10.000e+098.78SMESG000026850.1[more]
SMESG000053393.11.134e-1526.06SMESG000053393.1[more]
SMESG000030959.14.652e-627.55SMESG000030959.1[more]
SMESG000030959.14.779e-627.55SMESG000030959.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016984 ID=SMED30016984|Name=SMED30016984|organism=Schmidtea mediterranea sexual|type=transcript|length=1846bp
AAATAAATTCGCGTGCATTTATTTTGGTAATTTAAAAATTTAAATTTATT
TTAGTTGGAAAAAAATAAAGAAAAAATTATTATTTTTTGAAACATTTTGT
TTTATCGAATCAGAAAATTAAATGTTTAACAAAAATGGTTACAAATTGAA
GTCTTCGTTTCGCAAAACATTGATGGCCACCAATGAGATTTATCTGTACT
CGATTACTCCCGAAGAAACCAAATCTGTCGTGTTTATGTGGACGGAAGCG
CTCGGAGATAATTCCGTGATTTTGGTGTCAAGATTTCAAAAACAAGGAAA
TTGTTTTGGATTCAGAATTTCGACGAATTTCAAGGGGGATAAATATGAGC
ATTTAGTGAAAGACGTCGTAAAAAATAGTGATGTTTCCCAGAATACCAAA
ATTGCTGTTGATGATATTTTATTGGAAGTCAATGGAGTAAATGTTACGCA
ACTGGACTATTCAGAACTGACAATATTGCTCAGTGCCCTCCCAAAATATG
TTCAATTTGTTTACGCTAAAAAAGAAAATGAATATGAAAAATTAGACGCC
TCAGTTGAAGACAGAAATTTAAGCTCAGTGAAACTCGAAGGTGGCTGGAT
GTATCCAATCACGATTATCGTCCAAGGATCTCGAAAAGAAGTTGATGGAT
TAGATTTTATAAAATATCCACCTTCATTGAAAAACATTTCGAAATGTGTA
ATTCAACGGATAAAGCCTTTTGGTTATTGTTATAAAGATAAAAGGATCTC
AGTGAACGATTCTATAGTGAAGATTTACGATATCAATGTGCAAAACTATT
CAGAAAACGATATGTATAAATTAATGCAAAATAAATTATACTCGGTCCTG
ATGATATGTATTGGTAAATATCAAACCTCCAAATCTTTGCCACTTGTCGA
ATTCTCGGCATTTTCTAGGAGCCAATCTGCTACACTTGAAAATCCACTTT
CCAACAGCAGCACCTCACTGGCAAAGCGTAAATCTATATCACAAATAATA
ACATCCTTTCAATCATTGGATTATTCGAGTGAAAGAGATTTACTGGAGGA
TTGTGAAATGTTTTCCATTGACATTGATATCAATGATGACTTGGGAATAT
ATCTAATAGATGTCGAAAATAAAAAATCCGTTATATGCGGATTTGTAGAG
AAATCAAAGTTAAAAAGTAAATTCCGCGTTGGTGATGAAATTATAAAGGT
TAATGATAATTCTGTGTCCGGCCATTCCAGTCTCGAAATAGGGAAGTTAA
TGAAAAACTGTCACAGTAAAATGGAAGTTGTAACCGTTACAGTTTCTAGA
GGTTCGAAGCCCTGCAAATTTAACCATCCGATCATTATGCCTCCTGAAAT
GAACAGTCAAAATAATTCTCCAACTCAAATCAAAAGTGACCTCGAAGAAA
ATCTGAAAGAAATTGACGAAAATCATATTGTTTACAATGTGACGATTCAT
AAGGTGAATAATTCTTTTGGATTGTTTATTCAAGACTGCAACGGGCCAAC
AATTAATAAAGTGCAACCGGAATCAGAAATTTATCAAAAAGATATTATGA
GGCCTGGAGACAAAATTATTCGAATCAATGGCATTTATGTTGCAGATAAA
GAACACGATTTCGTTCTTACTCTAATTCGAAGCTGCGGTCACTCAATTGA
TCTCGAAATGTCCCGAACCAATGAGCTAGGGAAACAAATTGAATGTACCA
AAAATCCGATCTATTATTCAGACAACTTAAATGATCCAGATACAGGAATC
TGTTGTTCTTCAAACAATTCTACAAATCAAAAGGAAAAGCGAAAATCCGC
TAATATCCAAAATTCCAATAGATGCATAAAGACAATGTAATATGTT
back to top

protein sequence of SMED30016984-orf-1

>SMED30016984-orf-1 ID=SMED30016984-orf-1|Name=SMED30016984-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=573bp
MFNKNGYKLKSSFRKTLMATNEIYLYSITPEETKSVVFMWTEALGDNSVI
LVSRFQKQGNCFGFRISTNFKGDKYEHLVKDVVKNSDVSQNTKIAVDDIL
LEVNGVNVTQLDYSELTILLSALPKYVQFVYAKKENEYEKLDASVEDRNL
SSVKLEGGWMYPITIIVQGSRKEVDGLDFIKYPPSLKNISKCVIQRIKPF
GYCYKDKRISVNDSIVKIYDINVQNYSENDMYKLMQNKLYSVLMICIGKY
QTSKSLPLVEFSAFSRSQSATLENPLSNSSTSLAKRKSISQIITSFQSLD
YSSERDLLEDCEMFSIDIDINDDLGIYLIDVENKKSVICGFVEKSKLKSK
FRVGDEIIKVNDNSVSGHSSLEIGKLMKNCHSKMEVVTVTVSRGSKPCKF
NHPIIMPPEMNSQNNSPTQIKSDLEENLKEIDENHIVYNVTIHKVNNSFG
LFIQDCNGPTINKVQPESEIYQKDIMRPGDKIIRINGIYVADKEHDFVLT
LIRSCGHSIDLEMSRTNELGKQIECTKNPIYYSDNLNDPDTGICCSSNNS
TNQKEKRKSANIQNSNRCIKTM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR001478PDZ
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0030165PDZ domain binding
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0031526brush border membrane
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0015879carnitine transport
GO:0034767positive regulation of ion transmembrane transport
GO:0044070regulation of anion transport
GO:0090314positive regulation of protein targeting to membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 161..250
e-value: 12.0
score: 2.5
coord: 60..135
e-value: 1.8E-4
score: 30.9
coord: 322..395
e-value: 0.0036
score: 26.5
coord: 447..517
e-value: 1.1E-9
score: 48.1
IPR001478PDZ domainPFAMPF00595PDZcoord: 56..128
e-value: 3.1E-5
score: 24.3
coord: 445..512
e-value: 2.2E-6
score: 27.9
IPR001478PDZ domainPROSITEPS50106PDZcoord: 49..135
score: 11.159
IPR001478PDZ domainPROSITEPS50106PDZcoord: 439..517
score: 13.21
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 425..525
e-value: 3.0E-13
score: 51.5
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 316..401
e-value: 1.5E-6
score: 29.9
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 52..158
e-value: 1.6E-12
score: 49.3
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 171..253
e-value: 1.0E-5
score: 27.0
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 50..133
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 322..401
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 169..249
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 434..517
NoneNo IPR availablePANTHERPTHR19964MULTIPLE PDZ DOMAIN PROTEINcoord: 351..545
coord: 30..137
coord: 196..515
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 57..132
e-value: 1.22526E-6
score: 44.4799
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 437..512
e-value: 4.12299E-10
score: 54.4951
NoneNo IPR availableCDDcd00136PDZcoord: 324..391
e-value: 8.93147E-6
score: 41.5221