Anoctamin

Overview
NameAnoctamin
Smed IDSMED30016964
Length (bp)3498
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Anoctamin (SMED30016964) t-SNE clustered cells

Violin plots show distribution of expression levels for Anoctamin (SMED30016964) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Anoctamin (SMED30016964) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Anoctamin (SMED30016964) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016964

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30016964SMESG000033730.1 SMESG000033728.1 dd_Smed_v4_6514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30016964SMESG000033730.1 SMESG000033728.1 dd_Smed_v4_6514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30016964SMESG000033730.1 SMESG000033728.1 dd_Smed_v4_6514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016964SMESG000033730.1 SMESG000033728.1 dd_Smed_v4_6514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016964SMESG000033730.1 SMESG000033728.1 dd_Smed_v4_6514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Anoctamin vs. Ensembl Human
Match: ANO4 (anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837])

HSP 1 Score: 411.764 bits (1057), Expect = 2.854e-126
Identity = 317/991 (31.99%), Postives = 496/991 (50.05%), Query Frame = 1
Query:   91 TIMSNEDEILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIR----KQMLSLGFEYDFNRK-----TIFQRLFET----FDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERP-XXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIG-FIQPFT-QPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIY------IIGYSENG--FLNGFTDFSLSYMNSSEF---NATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSK 2982
            T  S++   L A    + +  K +NG++F DG  +ID++LVY + N       KR  F +++  EGL++E           KE+S  ++D          I+F+K+ A WE L RYAE + +R    +++  L   Y F  +     + F+R         D   + ++ E       +T P+S+ + + F I  +  TFF  A RS I                          V  IL R                                   E+  NK    G+ +L++ G +++A+ LHE    +++    +   N R+LLY+ W S    ++ QPLD ++ YFGEK+  YFAWLG+YT  L P + +G+ V LY +    +  V KE+ Q T+I MCP+    + C F +LSD+     +  L DNGATV  AV M++WA++FLE WKR++  +AY W++ D E E+E  RP+F A   K   ++ N ISGK EP+  F   +   +  + S +   I + +A + GI++Y++V+ S         I N S + T  T   ++  IIM L ++Y +VA+ LT++E  RT+S++++S TLK++L +F+N  SS FYI  F+  FT  P    R  +  +   C   GCL+DL +Q+  IM+ KQ  ++  E   P + +   R K++Q        S  + E D                    + ++P  +  Y            LF EYLEM++QFGF TIF+ AFPLAPLLAL NN+ EIR DA KF    RRP+A R KDIGIW  I+  +  ++V +NA +IA  + +I +L+Y        G  E G   + G+ + SLS    S+F   +     G + + GT   YCRY  +R PP      PY YT  +W +LAA++ F+ +FE+LV+    +I+ +IPD+P  LR  M+RE  L  E++ +A+L +++ +   +
Sbjct:   50 TSTSDDASRLEAGGETVPERNK-SNGLYFRDGKCRIDYILVYRKSNPQTE---KREVFERNIRAEGLQME-----------KESSLINSD----------IIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEEND----CYTAPFSQQRIHHFII-HNKETFFNNATRSRI--------------------------VHHILQR--------------------------------IKYEEGKNK---IGLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHSQVSKEVCQATDIIMCPV--CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERMNPISGKPEPYQAF-TDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEHGPERKISFPQWEKD--------------------YNLQP--MNAYG-----------LFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFS-GTPLKYCRYRDYRDPP--HSLVPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQKERKER 908          
BLAST of Anoctamin vs. Ensembl Human
Match: ANO4 (anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837])

HSP 1 Score: 411.379 bits (1056), Expect = 8.587e-126
Identity = 317/992 (31.96%), Postives = 496/992 (50.00%), Query Frame = 1
Query:   88 FTIMSNEDEILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIR----KQMLSLGFEYDFNRK-----TIFQRLFET----FDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERP-XXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIG-FIQPFT-QPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIY------IIGYSENG--FLNGFTDFSLSYMNSSEF---NATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSK 2982
             T  S++   L A    + +  K +NG++F DG  +ID++LVY + N       KR  F +++  EGL++E           KE+S  ++D          I+F+K+ A WE L RYAE + +R    +++  L   Y F  +     + F+R         D   + ++ E       +T P+S+ + + F I  +  TFF  A RS I                          V  IL R                                   E+  NK    G+ +L++ G +++A+ LHE    +++    +   N R+LLY+ W S    ++ QPLD ++ YFGEK+  YFAWLG+YT  L P + +G+ V LY +    +  V KE+ Q T+I MCP+    + C F +LSD+     +  L DNGATV  AV M++WA++FLE WKR++  +AY W++ D E E+E  RP+F A   K   ++ N ISGK EP+  F   +   +  + S +   I + +A + GI++Y++V+ S         I N S + T  T   ++  IIM L ++Y +VA+ LT++E  RT+S++++S TLK++L +F+N  SS FYI  F+  FT  P    R  +  +   C   GCL+DL +Q+  IM+ KQ  ++  E   P + +   R K++Q        S  + E D                    + ++P  +  Y            LF EYLEM++QFGF TIF+ AFPLAPLLAL NN+ EIR DA KF    RRP+A R KDIGIW  I+  +  ++V +NA +IA  + +I +L+Y        G  E G   + G+ + SLS    S+F   +     G + + GT   YCRY  +R PP      PY YT  +W +LAA++ F+ +FE+LV+    +I+ +IPD+P  LR  M+RE  L  E++ +A+L +++ +   +
Sbjct:   84 LTSTSDDASRLEAGGETVPERNK-SNGLYFRDGKCRIDYILVYRKSNPQTE---KREVFERNIRAEGLQME-----------KESSLINSD----------IIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEEND----CYTAPFSQQRIHHF-IIHNKETFFNNATRSRI--------------------------VHHILQR--------------------------------IKYEEGKNK---IGLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHSQVSKEVCQATDIIMCPV--CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERMNPISGKPEPYQAF-TDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEHGPERKISFPQWEKD--------------------YNLQP--MNAYG-----------LFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFS-GTPLKYCRYRDYRDPP--HSLVPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQKERKER 943          
BLAST of Anoctamin vs. Ensembl Human
Match: ANO1 (anoctamin 1 [Source:HGNC Symbol;Acc:HGNC:21625])

HSP 1 Score: 405.986 bits (1042), Expect = 5.464e-125
Identity = 299/956 (31.28%), Postives = 474/956 (49.58%), Query Frame = 1
Query:  241 NQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIR---KQMLSLGFEYDFNRK--TIFQRLFETFDFLNIFNINELKP-IPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIY-QGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPF-WRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQII-SHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPW-ETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMK-----------------NQHTSKLVADSFKKSA 3012
             + +R  +  +LL+ GLE+E +D+  K++                     + F+K+ A W  LCR AE LK++   K+M  +       +K  ++ Q++ +         + E +P   +  + P+S+ K++LFD+  D  +FF +  RS I                          V +IL R                     T C              +      GI  L++ GV+ +AY LH+     D + ENVE N+R LLY+ W      ++ QP+D ++ YFGEK+  YFAWLG YT  L+P S++GIIV LY       +I   E+  Q  NITMCPL    + C +WK+S A +      L DN ATV  +V M++WA+ F+E WKR+Q++L Y W++   E E++  R E+ A + +   KK +    KE   +   WR R P       +++  IA+  A + G+I+Y++   + + M+ S ++ +   +   AT  +++LV+I+ L  VY  +A WLT +E  +T+  ++  +  K +LL+F+N+Y+ IFY+ F +      P      FRS  M     C  GGCL++L +QL+ IM+GKQ+I +++ E  +P++   ++  KLKQ      +  +      R EV                + +EP     +A           L  EY+EM+IQFGF+T+F+ +FPLAPL AL NN+ EIR DA KF   LRRPVA R KDIGIW +I+  +  +AV  NA +I+F + +I +L+Y+  YS+NG ++GF + +LS  N S+F         L LG     CRY  +R PPW E KY+    +  +W +LAA++ FV +F+NLV      +  VIPD+P  +   + +E  L  E+ ++ +  + +                 N H +K   DS    A
Sbjct:    8 KRFRREEYEGNLLEAGLELE-RDEDTKIH--------------------GVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQP----KVAEHRPQTMKRLSYPFSREKQHLFDL-SDKDSFFDSKTRSTI--------------------------VYEILKR---------------------TTC--------------TKAKYSMGITSLLANGVYAAAYPLHD----GDYNGENVEFNDRKLLYEEWARYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGIIVFLYGCATMDENIPSMEMCDQRHNITMCPL--CDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEDHPRAEYEARVLEKSLKKES--RNKETDKVKLTWRDRFPAYLTNLVSIIFMIAVTFAIVLGVIIYRISMAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLIFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRM---EECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSPP--DHEECVKRKQRYEV---------------DYNLEP-----FAG----------LTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAVRAKDIGIWYNILRGIGKLAVIINAFVISFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYD---ISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPA 830          
BLAST of Anoctamin vs. Ensembl Human
Match: ANO4 (anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837])

HSP 1 Score: 412.92 bits (1060), Expect = 9.030e-125
Identity = 317/992 (31.96%), Postives = 496/992 (50.00%), Query Frame = 1
Query:   88 FTIMSNEDEILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIR----KQMLSLGFEYDFNRK-----TIFQRLFET----FDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERP-XXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIG-FIQPFT-QPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIY------IIGYSENG--FLNGFTDFSLSYMNSSEF---NATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSK 2982
             T  S++   L A    + +  K +NG++F DG  +ID++LVY + N       KR  F +++  EGL++E           KE+S  ++D          I+F+K+ A WE L RYAE + +R    +++  L   Y F  +     + F+R         D   + ++ E       +T P+S+ + + F I  +  TFF  A RS I                          V  IL R                                   E+  NK    G+ +L++ G +++A+ LHE    +++    +   N R+LLY+ W S    ++ QPLD ++ YFGEK+  YFAWLG+YT  L P + +G+ V LY +    +  V KE+ Q T+I MCP+    + C F +LSD+     +  L DNGATV  AV M++WA++FLE WKR++  +AY W++ D E E+E  RP+F A   K   ++ N ISGK EP+  F   +   +  + S +   I + +A + GI++Y++V+ S         I N S + T  T   ++  IIM L ++Y +VA+ LT++E  RT+S++++S TLK++L +F+N  SS FYI  F+  FT  P    R  +  +   C   GCL+DL +Q+  IM+ KQ  ++  E   P + +   R K++Q        S  + E D                    + ++P  +  Y            LF EYLEM++QFGF TIF+ AFPLAPLLAL NN+ EIR DA KF    RRP+A R KDIGIW  I+  +  ++V +NA +IA  + +I +L+Y        G  E G   + G+ + SLS    S+F   +     G + + GT   YCRY  +R PP      PY YT  +W +LAA++ F+ +FE+LV+    +I+ +IPD+P  LR  M+RE  L  E++ +A+L +++ +   +
Sbjct:  250 LTSTSDDASRLEAGGETVPERNK-SNGLYFRDGKCRIDYILVYRKSNPQTE---KREVFERNIRAEGLQME-----------KESSLINSD----------IIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEEND----CYTAPFSQQRIHHFII-HNKETFFNNATRSRI--------------------------VHHILQR--------------------------------IKYEEGKNK---IGLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHSQVSKEVCQATDIIMCPV--CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERMNPISGKPEPYQAF-TDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEHGPERKISFPQWEKD--------------------YNLQP--MNAYG-----------LFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFS-GTPLKYCRYRDYRDPP--HSLVPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQKERKER 1109          
BLAST of Anoctamin vs. Ensembl Human
Match: ANO1 (anoctamin 1 [Source:HGNC Symbol;Acc:HGNC:21625])

HSP 1 Score: 402.905 bits (1034), Expect = 2.549e-122
Identity = 319/1081 (29.51%), Postives = 512/1081 (47.36%), Query Frame = 1
Query:   97 MSNEDEILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVY--ERINDNRT---------------------------------------------NQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIR---KQMLSLGFEYDFNRK--TIFQRLFETFDFLNIFNINELKP-IPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIY-QGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA----RPEFVA-LIDKNYPKKTNLISGKEEPFIP--------------------------FWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQII-SHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPW-ETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMK-----------------NQHTSKLVADSFKKSA 3012
            + +E  +L + + D + + KY  G++F DG RK+D++LVY  +R + NRT                                              + +R  +  +LL+ GLE+E +D+  K++                     + F+K+ A W  LCR AE LK++   K+M  +       +K  ++ Q++ +         + E +P   +  + P+S+ K++LFD+  D  +FF +  RS I                          V +IL R                     T C              +      GI  L++ GV+ +AY LH+     D + ENVE N+R LLY+ W      ++ QP+D ++ YFGEK+  YFAWLG YT  L+P S++GIIV LY       +I   E+  Q  NITMCPL    + C +WK+S A +      L DN ATV  +V M++WA+ F+E WKR+Q++L Y W++   E E+E      R E+ A +++K+  K++   + ++   IP                           WR R P       +++  IA+  A + G+I+Y++   + + M+ S ++ +   +   AT  +++LV+I+ L  VY  +A WLT +E  +T+  ++  +  K +LL+F+N+Y+ IFY+ F +      P      FRS  M     C  GGCL++L +QL+ IM+GKQ+I +++ E  +P++   ++  KLKQ      +  +      R EV                + +EP     +A           L  EY+EM+IQFGF+T+F+ +FPLAPL AL NN+ EIR DA KF   LRRPVA R KDIGIW +I+  +  +AV  NA +I+F + +I +L+Y+  YS+NG ++GF + +LS  N S+F         L LG     CRY  +R PPW E KY+    +  +W +LAA++ FV +F+NLV      +  VIPD+P  +   + +E  L  E+ ++ +  + +                 N H +K   DS    A
Sbjct:   31 LPSEGTLLNSLSVDPDAECKY--GLYFRDGRRKVDYILVYHHKRPSGNRTLVRRVQHSDTPSGARSVKQDHPLPGKGASLDAGSGEPPMDYHEDDKRFRREEYEGNLLEAGLELE-RDEDTKIH--------------------GVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQP----KVAEHRPQTMKRLSYPFSREKQHLFDL-SDKDSFFDSKTRSTI--------------------------VYEILKR---------------------TTC--------------TKAKYSMGITSLLANGVYAAAYPLHD----GDYNGENVEFNDRKLLYEEWARYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGIIVFLYGCATMDENIPSMEMCDQRHNITMCPL--CDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLKKESR--NKEKRRHIPEESTNKWKQRVKTAMAGVKLTDKVKLTWRDRFPAYLTNLVSIIFMIAVTFAIVLGVIIYRISMAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLIFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRM---EECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQQSPP--DHEECVKRKQRYEV---------------DYNLEP-----FAG----------LTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAVRAKDIGIWYNILRGIGKLAVIINAFVISFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYD---ISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPA 976          
BLAST of Anoctamin vs. Ensembl Celegans
Match: anoh-1 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:C0P286])

HSP 1 Score: 155.221 bits (391), Expect = 2.648e-38
Identity = 175/694 (25.22%), Postives = 301/694 (43.37%), Query Frame = 1
Query:  580 RGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILH----ERPXXXXXXXXXXXXXXXXXXYKHWVSMRNI-------FRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDI--------VVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFF------LIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFT---QPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLI 2577
            R    P+ +    LF    D  +FFT+++R  +   IL +                ID+ +D+   R        TD               PS     + E +  K    G++ L+   V++ A++LH    E P  +     +V+     +        R++       ++ QPL+ I+ YFGE++A+YFAW G +   L P  + G++V +Y  + + +          VV  I Q  N+      C  R        +  + FF       +   D       AV MSIW S+F+++WKR    L+Y WN  D  +  EP RPEF     +    K + I+G++    P   R + ++    S V +S +M +  +  +++  L  + +     ++  +    +  A   S+L+ +  M L  +YS +   L   E+HRT+S++++S+ +K++  + +N Y+S+FY+ FI+P +   QP   F   +  K   C    C   L+LQL    + K      K+  LP     VK ++L+    +         EA RVE+   D+A +L    +  W ++P       D +L          E  E +I FG   +F   FPLAPLLAL     ++R DA +     R+P+      IGIW+ I++ +   AV +NA ++AF + +    +
Sbjct:  111 RFINAPFQRKHGSLFLNYHDEKSFFTSSQRGYLTYQILTK----------------IDISKDLKGERLGESQDEPTD---------------PSTSSITSDEQLRRK----GLSWLLMSDVYEEAFVLHAPSKEEPYFKAMQNGSVKAYNEFISEIELDPRRSLSLNWERWYKFQPLNKIRDYFGEQIAYYFAWQGTFLTLLWPAVIFGLVVFIYGFIDSISSAPLDWNHCKVVNFIGQTENVA-----CGMR--------NGVTLFFSMVTQWFMSSFDTKMNAFFAVFMSIWGSVFVQIWKRNNSVLSYQWNSDDF-HAIEPDRPEF-----RGSKVKEDPITGEDIWISPALARYIKML---ASFVFVSFSMLVVVISLMLVTLLKIWMVYNFQCTKEYTFHCWLSAAFLPSILNTLSAMGLGAIYSNLVSRLNSWENHRTESEHNNSLIVKIFAFQMVNTYTSLFYVAFIRPESHGLQPNGLFGLGTEFKDT-CLDDTCSSLLALQLLTHTLIKPFPKFFKDVVLPYF---VKLFRLRMYTSR--------TEA-RVEIEDDDQANVL----VREW-LKPSA----GDFVL---------WEMNEKIILFGTTMMFASLFPLAPLLALIIGFVDMRIDAHRLIWFNRKPIPIITNGIGIWLPILTFLQYCAVFTNAFIVAFTSGFCSTFL 716          
BLAST of Anoctamin vs. Ensembl Celegans
Match: anoh-1 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:C0P286])

HSP 1 Score: 155.221 bits (391), Expect = 2.750e-38
Identity = 175/694 (25.22%), Postives = 301/694 (43.37%), Query Frame = 1
Query:  580 RGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILH----ERPXXXXXXXXXXXXXXXXXXYKHWVSMRNI-------FRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDI--------VVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFF------LIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFT---QPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLI 2577
            R    P+ +    LF    D  +FFT+++R  +   IL +                ID+ +D+   R        TD               PS     + E +  K    G++ L+   V++ A++LH    E P  +     +V+     +        R++       ++ QPL+ I+ YFGE++A+YFAW G +   L P  + G++V +Y  + + +          VV  I Q  N+      C  R        +  + FF       +   D       AV MSIW S+F+++WKR    L+Y WN  D  +  EP RPEF     +    K + I+G++    P   R + ++    S V +S +M +  +  +++  L  + +     ++  +    +  A   S+L+ +  M L  +YS +   L   E+HRT+S++++S+ +K++  + +N Y+S+FY+ FI+P +   QP   F   +  K   C    C   L+LQL    + K      K+  LP     VK ++L+    +         EA RVE+   D+A +L    +  W ++P       D +L          E  E +I FG   +F   FPLAPLLAL     ++R DA +     R+P+      IGIW+ I++ +   AV +NA ++AF + +    +
Sbjct:  129 RFINAPFQRKHGSLFLNYHDEKSFFTSSQRGYLTYQILTK----------------IDISKDLKGERLGESQDEPTD---------------PSTSSITSDEQLRRK----GLSWLLMSDVYEEAFVLHAPSKEEPYFKAMQNGSVKAYNEFISEIELDPRRSLSLNWERWYKFQPLNKIRDYFGEQIAYYFAWQGTFLTLLWPAVIFGLVVFIYGFIDSISSAPLDWNHCKVVNFIGQTENVA-----CGMR--------NGVTLFFSMVTQWFMSSFDTKMNAFFAVFMSIWGSVFVQIWKRNNSVLSYQWNSDDF-HAIEPDRPEF-----RGSKVKEDPITGEDIWISPALARYIKML---ASFVFVSFSMLVVVISLMLVTLLKIWMVYNFQCTKEYTFHCWLSAAFLPSILNTLSAMGLGAIYSNLVSRLNSWENHRTESEHNNSLIVKIFAFQMVNTYTSLFYVAFIRPESHGLQPNGLFGLGTEFKD-TCLDDTCSSLLALQLLTHTLIKPFPKFFKDVVLPYF---VKLFRLRMYTSR--------TEA-RVEIEDDDQANVL----VREW-LKPSA----GDFVL---------WEMNEKIILFGTTMMFASLFPLAPLLALIIGFVDMRIDAHRLIWFNRKPIPIITNGIGIWLPILTFLQYCAVFTNAFIVAFTSGFCSTFL 734          
BLAST of Anoctamin vs. Ensembl Celegans
Match: anoh-2 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:H2L2L3])

HSP 1 Score: 113.62 bits (283), Expect = 3.689e-25
Identity = 98/351 (27.92%), Postives = 156/351 (44.44%), Query Frame = 1
Query: 1069 QPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIV-SLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDM---EYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYS-TVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVK 2106
            QP+D +K YFG ++A YFAWLG+ T  L   SLLGI++  L    Y ++    +++YQ                                L+ +   VL A    IW++++LE WKR Q +LA+ W  +D     Y  +P RP F    D   P   N +SG+ EPF P W+  +     TY  T L  + M  A L    +  L  F           S M S +        +L+I++S   +Y R+A+ L D+E++RT  +Y+  +  K+ L +F+  + S+FYI F+          R               +  L   LA ++I +Q+  +I E  +P ++  +K
Sbjct:  269 QPIDQVKDYFGTEIAMYFAWLGHMTTALWFPSLLGILMWFLGGFKYKNSPGDKQDLYQ--------------------------------LISDICFVLFAFFNCIWSTIYLEWWKRVQAELAFKWGTYDATQDSYLQDP-RPAFQG--DYLAP---NPVSGRLEPFYPAWKHTVMRYVITYPITFLCVVGMFAAMLAIFTVQDLADFYFGD-------SWMLSWLCYFPMIFYALMIVIS-DKIYRRLALILNDLENYRTDDEYEDFLITKIVLFQFVTAFGSLFYIAFV---------LRD--------------MKRLQETLATLLITRQVTQNIMETVVPFMIEKLK 550          

HSP 2 Score: 68.1662 bits (165), Expect = 3.478e-11
Identity = 48/109 (44.04%), Postives = 66/109 (60.55%), Query Frame = 1
Query: 2221 CIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIA 2547
            C D+    PEL +   ++++S    RPL  ++LEM IQFG++ +F PAFPLA + AL NNL EIR DA K    ++RP  +RVKDIG W   M ++  + V  N  LI 
Sbjct:  656 CTDS---NPELTQAELESVMSVYA-RPL-DDFLEMFIQFGYVLLFSPAFPLAAVCALINNLIEIRVDAFKLCNTVQRPFGRRVKDIGAWQKAMEILGILGVIVNCALIG 759          
BLAST of Anoctamin vs. Ensembl Celegans
Match: anoh-2 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:H2L2L3])

HSP 1 Score: 112.849 bits (281), Expect = 4.734e-25
Identity = 98/351 (27.92%), Postives = 156/351 (44.44%), Query Frame = 1
Query: 1069 QPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIV-SLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDM---EYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYS-TVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVK 2106
            QP+D +K YFG ++A YFAWLG+ T  L   SLLGI++  L    Y ++    +++YQ                                L+ +   VL A    IW++++LE WKR Q +LA+ W  +D     Y  +P RP F    D   P   N +SG+ EPF P W+  +     TY  T L  + M  A L    +  L  F           S M S +        +L+I++S   +Y R+A+ L D+E++RT  +Y+  +  K+ L +F+  + S+FYI F+          R               +  L   LA ++I +Q+  +I E  +P ++  +K
Sbjct:  213 QPIDQVKDYFGTEIAMYFAWLGHMTTALWFPSLLGILMWFLGGFKYKNSPGDKQDLYQ--------------------------------LISDICFVLFAFFNCIWSTIYLEWWKRVQAELAFKWGTYDATQDSYLQDP-RPAFQG--DYLAP---NPVSGRLEPFYPAWKHTVMRYVITYPITFLCVVGMFAAMLAIFTVQDLADFYFGD-------SWMLSWLCYFPMIFYALMIVIS-DKIYRRLALILNDLENYRTDDEYEDFLITKIVLFQFVTAFGSLFYIAFV---------LRD--------------MKRLQETLATLLITRQVTQNIMETVVPFMIEKLK 494          

HSP 2 Score: 68.1662 bits (165), Expect = 3.204e-11
Identity = 48/109 (44.04%), Postives = 66/109 (60.55%), Query Frame = 1
Query: 2221 CIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIA 2547
            C D+    PEL +   ++++S    RPL  ++LEM IQFG++ +F PAFPLA + AL NNL EIR DA K    ++RP  +RVKDIG W   M ++  + V  N  LI 
Sbjct:  600 CTDS---NPELTQAELESVMSVYA-RPL-DDFLEMFIQFGYVLLFSPAFPLAAVCALINNLIEIRVDAFKLCNTVQRPFGRRVKDIGAWQKAMEILGILGVIVNCALIG 703          
BLAST of Anoctamin vs. Ensembl Fly
Match: subdued (gene:FBgn0038721 transcript:FBtr0083806)

HSP 1 Score: 482.256 bits (1240), Expect = 4.584e-153
Identity = 334/943 (35.42%), Postives = 502/943 (53.23%), Query Frame = 1
Query:  160 NNGMFFVDGVRKIDFVLVYERINDNRTNQI----KRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNR--KTIFQRLFETFDFL--NIFNINELKPI-PRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQG--TNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQ-PFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYG-GHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKAD 2949
            N  +FF D VR IDFVL Y RIN +   ++    KR  F  +L+ +GLE+E                         S +  I F+K+ A  E L RYAE+LK+R  M  +      NR  K++F  L   F F   NI+   E+ P     FT  YS+ KEYLFDI +D   FFT A RS I                          VE IL R+                       + P+ ++     D++     FGI +LI+EGV+ +AY LH+                R LLYKHW S+   +R QPLD IK YFG K+  YFAWLGYYTY LL  S++G+I  LY+     N + VK+I Q   TNITMCPL C    C FW L +  +   +  L+DN +TV  AV MS WA+LFLE+WKR   ++ + W++   +  +E  RP+++A ++   P + + ++  +EP +PFWR ++P   F++S VLL IA+A   L  +++Y++   + +++  S   ++ + ++  A+ + ++L ++  L  +Y+ +A +LT++E  RTQ+Q+D S+TLK+YLL+F+N Y+SIFYI F +  F      +      +   C +GGCL +L +QLA IM+GKQ  + I E  LP     V    ++    +L N +    +A       KD+  + D K +D W                  G R LF EYLEM++Q+GF+TIF+ AFPLAP  AL NN+ E+R DA K     +RPV+QRV+DIG+W  I+  +  ++V +N  +IAF +  I +L+Y    ++ G L+G+ +F+LS     + + TLY     L   +N T CRY+ FR PP  +  E Y+ + +++ ILA ++ FV +FEN V L M ++   IPD+  +LR  ++RE  +TNEII+  +
Sbjct:   33 NTSLFFEDCVRSIDFVLAY-RINAHEPTELENTEKRRVFEANLISQGLEVE------------------------SSQKDQIWFVKIHAPLEVLRRYAEILKLRMPMKEIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDEEIFPKRAHRFTAIYSRDKEYLFDIRQD--CFFTTAVRSRI--------------------------VEFILDRQ-----------------------RFPAKNQ----HDMA-----FGIERLIAEGVYSAAYPLHD-------GEITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKNYVPVKDICQSGNTNITMCPL-CD--WCNFWDLKETCNYAKVTYLIDNPSTVFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPPTRVDYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPMTTSSAIVLATASAAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMFWRKV--LAIQVGLSRLFNNTPNPDKA-------KDERWMRDFKLLD-W------------------GARGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRILDCIGKLSVITNGFIIAFTSDMIPRLVYRHYVNKQGTLDGYLNFTLSEFKVID-SPTLYSLAGDL---SNITTCRYTDFRLPP--SSPEKYTLSSMFYIILACRLGFVVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEIIIDQE 846          
BLAST of Anoctamin vs. Ensembl Fly
Match: subdued (gene:FBgn0038721 transcript:FBtr0334921)

HSP 1 Score: 482.256 bits (1240), Expect = 4.584e-153
Identity = 334/943 (35.42%), Postives = 502/943 (53.23%), Query Frame = 1
Query:  160 NNGMFFVDGVRKIDFVLVYERINDNRTNQI----KRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNR--KTIFQRLFETFDFL--NIFNINELKPI-PRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQG--TNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQ-PFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYG-GHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKAD 2949
            N  +FF D VR IDFVL Y RIN +   ++    KR  F  +L+ +GLE+E                         S +  I F+K+ A  E L RYAE+LK+R  M  +      NR  K++F  L   F F   NI+   E+ P     FT  YS+ KEYLFDI +D   FFT A RS I                          VE IL R+                       + P+ ++     D++     FGI +LI+EGV+ +AY LH+                R LLYKHW S+   +R QPLD IK YFG K+  YFAWLGYYTY LL  S++G+I  LY+     N + VK+I Q   TNITMCPL C    C FW L +  +   +  L+DN +TV  AV MS WA+LFLE+WKR   ++ + W++   +  +E  RP+++A ++   P + + ++  +EP +PFWR ++P   F++S VLL IA+A   L  +++Y++   + +++  S   ++ + ++  A+ + ++L ++  L  +Y+ +A +LT++E  RTQ+Q+D S+TLK+YLL+F+N Y+SIFYI F +  F      +      +   C +GGCL +L +QLA IM+GKQ  + I E  LP     V    ++    +L N +    +A       KD+  + D K +D W                  G R LF EYLEM++Q+GF+TIF+ AFPLAP  AL NN+ E+R DA K     +RPV+QRV+DIG+W  I+  +  ++V +N  +IAF +  I +L+Y    ++ G L+G+ +F+LS     + + TLY     L   +N T CRY+ FR PP  +  E Y+ + +++ ILA ++ FV +FEN V L M ++   IPD+  +LR  ++RE  +TNEII+  +
Sbjct:   33 NTSLFFEDCVRSIDFVLAY-RINAHEPTELENTEKRRVFEANLISQGLEVE------------------------SSQKDQIWFVKIHAPLEVLRRYAEILKLRMPMKEIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDEEIFPKRAHRFTAIYSRDKEYLFDIRQD--CFFTTAVRSRI--------------------------VEFILDRQ-----------------------RFPAKNQ----HDMA-----FGIERLIAEGVYSAAYPLHD-------GEITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKNYVPVKDICQSGNTNITMCPL-CD--WCNFWDLKETCNYAKVTYLIDNPSTVFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPPTRVDYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPMTTSSAIVLATASAAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMFWRKV--LAIQVGLSRLFNNTPNPDKA-------KDERWMRDFKLLD-W------------------GARGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRILDCIGKLSVITNGFIIAFTSDMIPRLVYRHYVNKQGTLDGYLNFTLSEFKVID-SPTLYSLAGDL---SNITTCRYTDFRLPP--SSPEKYTLSSMFYIILACRLGFVVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEIIIDQE 846          
BLAST of Anoctamin vs. Ensembl Fly
Match: subdued (gene:FBgn0038721 transcript:FBtr0083805)

HSP 1 Score: 482.256 bits (1240), Expect = 2.732e-151
Identity = 334/943 (35.42%), Postives = 502/943 (53.23%), Query Frame = 1
Query:  160 NNGMFFVDGVRKIDFVLVYERINDNRTNQI----KRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNR--KTIFQRLFETFDFL--NIFNINELKPI-PRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQG--TNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQ-PFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYG-GHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKAD 2949
            N  +FF D VR IDFVL Y RIN +   ++    KR  F  +L+ +GLE+E                         S +  I F+K+ A  E L RYAE+LK+R  M  +      NR  K++F  L   F F   NI+   E+ P     FT  YS+ KEYLFDI +D   FFT A RS I                          VE IL R+                       + P+ ++     D++     FGI +LI+EGV+ +AY LH+                R LLYKHW S+   +R QPLD IK YFG K+  YFAWLGYYTY LL  S++G+I  LY+     N + VK+I Q   TNITMCPL C    C FW L +  +   +  L+DN +TV  AV MS WA+LFLE+WKR   ++ + W++   +  +E  RP+++A ++   P + + ++  +EP +PFWR ++P   F++S VLL IA+A   L  +++Y++   + +++  S   ++ + ++  A+ + ++L ++  L  +Y+ +A +LT++E  RTQ+Q+D S+TLK+YLL+F+N Y+SIFYI F +  F      +      +   C +GGCL +L +QLA IM+GKQ  + I E  LP     V    ++    +L N +    +A       KD+  + D K +D W                  G R LF EYLEM++Q+GF+TIF+ AFPLAP  AL NN+ E+R DA K     +RPV+QRV+DIG+W  I+  +  ++V +N  +IAF +  I +L+Y    ++ G L+G+ +F+LS     + + TLY     L   +N T CRY+ FR PP  +  E Y+ + +++ ILA ++ FV +FEN V L M ++   IPD+  +LR  ++RE  +TNEII+  +
Sbjct:  182 NTSLFFEDCVRSIDFVLAY-RINAHEPTELENTEKRRVFEANLISQGLEVE------------------------SSQKDQIWFVKIHAPLEVLRRYAEILKLRMPMKEIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDEEIFPKRAHRFTAIYSRDKEYLFDIRQD--CFFTTAVRSRI--------------------------VEFILDRQ-----------------------RFPAKNQ----HDMA-----FGIERLIAEGVYSAAYPLHD-------GEITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKNYVPVKDICQSGNTNITMCPL-CD--WCNFWDLKETCNYAKVTYLIDNPSTVFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPPTRVDYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPMTTSSAIVLATASAAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMFWRKV--LAIQVGLSRLFNNTPNPDKA-------KDERWMRDFKLLD-W------------------GARGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRILDCIGKLSVITNGFIIAFTSDMIPRLVYRHYVNKQGTLDGYLNFTLSEFKVID-SPTLYSLAGDL---SNITTCRYTDFRLPP--SSPEKYTLSSMFYIILACRLGFVVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEIIIDQE 995          
BLAST of Anoctamin vs. Ensembl Fly
Match: subdued (gene:FBgn0038721 transcript:FBtr0334922)

HSP 1 Score: 472.241 bits (1214), Expect = 6.377e-149
Identity = 335/967 (34.64%), Postives = 503/967 (52.02%), Query Frame = 1
Query:  160 NNGMFFVDGVRKIDFVLVYERINDNRTNQI----KRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQM---------------LSLGFEYDFNR-----------KTIFQRLFETFDFL--NIFNINELKPI-PRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQG--TNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQ-PFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYG-GHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKAD 2949
            N  +FF D VR IDFVL Y RIN +   ++    KR  F  +L+ +GLE+E                         S +  I F+K+ A  E L RYAE+LK+R  M               L     Y  N+           K++F  L   F F   NI+   E+ P     FT  YS+ KEYLFDI +D   FFT A RS I                          VE IL R+                       + P+ ++     D++     FGI +LI+EGV+ +AY LH+                R LLYKHW S+   +R QPLD IK YFG K+  YFAWLGYYTY LL  S++G+I  LY+     N + VK+I Q   TNITMCPL C    C FW L +  +   +  L+DN +TV  AV MS WA+LFLE+WKR   ++ + W++   +  +E  RP+++A ++   P + + ++  +EP +PFWR ++P   F++S VLL IA+A   L  +++Y++   + +++  S   ++ + ++  A+ + ++L ++  L  +Y+ +A +LT++E  RTQ+Q+D S+TLK+YLL+F+N Y+SIFYI F +  F      +      +   C +GGCL +L +QLA IM+GKQ  + I E  LP     V    ++    +L N +    +A       KD+  + D K +D W                  G R LF EYLEM++Q+GF+TIF+ AFPLAP  AL NN+ E+R DA K     +RPV+QRV+DIG+W  I+  +  ++V +N  +IAF +  I +L+Y    ++ G L+G+ +F+LS     + + TLY     L   +N T CRY+ FR PP  +  E Y+ + +++ ILA ++ FV +FEN V L M ++   IPD+  +LR  ++RE  +TNEII+  +
Sbjct:   33 NTSLFFEDCVRSIDFVLAY-RINAHEPTELENTEKRRVFEANLISQGLEVE------------------------SSQKDQIWFVKIHAPLEVLRRYAEILKLRMPMKESLCNLRISERSNRLRNAAHYLTNKIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDEEIFPKRAHRFTAIYSRDKEYLFDIRQD--CFFTTAVRSRI--------------------------VEFILDRQ-----------------------RFPAKNQ----HDMA-----FGIERLIAEGVYSAAYPLHD-------GEITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKNYVPVKDICQSGNTNITMCPL-CD--WCNFWDLKETCNYAKVTYLIDNPSTVFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPPTRVDYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPMTTSSAIVLATASAAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMFWRKV--LAIQVGLSRLFNNTPNPDKA-------KDERWMRDFKLLD-W------------------GARGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRILDCIGKLSVITNGFIIAFTSDMIPRLVYRHYVNKQGTLDGYLNFTLSEFKVID-SPTLYSLAGDL---SNITTCRYTDFRLPP--SSPEKYTLSSMFYIILACRLGFVVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEIIIDQE 870          
BLAST of Anoctamin vs. Ensembl Fly
Match: subdued (gene:FBgn0038721 transcript:FBtr0302492)

HSP 1 Score: 472.241 bits (1214), Expect = 2.753e-147
Identity = 335/967 (34.64%), Postives = 503/967 (52.02%), Query Frame = 1
Query:  160 NNGMFFVDGVRKIDFVLVYERINDNRTNQI----KRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQM---------------LSLGFEYDFNR-----------KTIFQRLFETFDFL--NIFNINELKPI-PRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQG--TNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQ-PFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYG-GHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKAD 2949
            N  +FF D VR IDFVL Y RIN +   ++    KR  F  +L+ +GLE+E                         S +  I F+K+ A  E L RYAE+LK+R  M               L     Y  N+           K++F  L   F F   NI+   E+ P     FT  YS+ KEYLFDI +D   FFT A RS I                          VE IL R+                       + P+ ++     D++     FGI +LI+EGV+ +AY LH+                R LLYKHW S+   +R QPLD IK YFG K+  YFAWLGYYTY LL  S++G+I  LY+     N + VK+I Q   TNITMCPL C    C FW L +  +   +  L+DN +TV  AV MS WA+LFLE+WKR   ++ + W++   +  +E  RP+++A ++   P + + ++  +EP +PFWR ++P   F++S VLL IA+A   L  +++Y++   + +++  S   ++ + ++  A+ + ++L ++  L  +Y+ +A +LT++E  RTQ+Q+D S+TLK+YLL+F+N Y+SIFYI F +  F      +      +   C +GGCL +L +QLA IM+GKQ  + I E  LP     V    ++    +L N +    +A       KD+  + D K +D W                  G R LF EYLEM++Q+GF+TIF+ AFPLAP  AL NN+ E+R DA K     +RPV+QRV+DIG+W  I+  +  ++V +N  +IAF +  I +L+Y    ++ G L+G+ +F+LS     + + TLY     L   +N T CRY+ FR PP  +  E Y+ + +++ ILA ++ FV +FEN V L M ++   IPD+  +LR  ++RE  +TNEII+  +
Sbjct:  182 NTSLFFEDCVRSIDFVLAY-RINAHEPTELENTEKRRVFEANLISQGLEVE------------------------SSQKDQIWFVKIHAPLEVLRRYAEILKLRMPMKESLCNLRISERSNRLRNAAHYLTNKIPGMSVVNRSTKSVFSSLKHVFQFFLRNIYVDEEIFPKRAHRFTAIYSRDKEYLFDIRQD--CFFTTAVRSRI--------------------------VEFILDRQ-----------------------RFPAKNQ----HDMA-----FGIERLIAEGVYSAAYPLHD-------GEITETGTMRALLYKHWASVPKWYRYQPLDDIKEYFGVKIGLYFAWLGYYTYMLLLASIVGVICFLYSWFSLKNYVPVKDICQSGNTNITMCPL-CD--WCNFWDLKETCNYAKVTYLIDNPSTVFFAVFMSFWATLFLELWKRYSAEITHRWDLTGFDVHEEHPRPQYLARLEHIPPTRVDYVTNIKEPTVPFWRMKLPATVFSFSVVLLLIALAFVALLAVVVYRMSMLAALKVGASPMTTSSAIVLATASAAFVNLCLLYILNYMYNHLAEYLTELEMWRTQTQFDDSLTLKIYLLQFVNYYASIFYIAFFKGKFVGHPGEYNKLFDYRQEECSSGGCLTELCIQLAIIMVGKQAFNTILEVYLPMFWRKV--LAIQVGLSRLFNNTPNPDKA-------KDERWMRDFKLLD-W------------------GARGLFPEYLEMVLQYGFVTIFVAAFPLAPFFALLNNILEMRLDAKKLLTHHKRPVSQRVRDIGVWYRILDCIGKLSVITNGFIIAFTSDMIPRLVYRHYVNKQGTLDGYLNFTLSEFKVID-SPTLYSLAGDL---SNITTCRYTDFRLPP--SSPEKYTLSSMFYIILACRLGFVVVFENFVALVMILVRWCIPDMSVELRDQIRREVYVTNEIIIDQE 1019          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano3 (anoctamin 3 [Source:ZFIN;Acc:ZDB-GENE-111031-3])

HSP 1 Score: 415.231 bits (1066), Expect = 5.138e-127
Identity = 310/951 (32.60%), Postives = 470/951 (49.42%), Query Frame = 1
Query:  163 NGMFFVDGVRKIDFVLVYERINDNRTNQI-KRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDN---ATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXX-XXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSMIKPR--GCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYII--------GYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ 2970
            +G+ F DG ++ID++LVY++     + Q+ KR TF ++L  EGL +E           KE S  ++D          I+F+K+ A W+TLC+YAE + IR       +  D+ +K +  R    F  L  +       +PR    P    KE L D+ E +   A F  A      +N    R ++   S +  I       V  +L R                                   ED  +K    GI +L+    +++A+  HE           +   N R+LLY+ W      ++ QPLD I+ YFGEK+  YFAWLG+YT  L+P +L+G+ V LY +    +  V KEI +     MCP MC    C  W LSD+     +  L DNG TV  A+ M+IWA++FLE WKR++ +L Y W++ D E E+E  RP+F A   +   ++ N ISGK EPF P    ++  +  + S +   I++ L  +  +++++L++           +       T+ TG  ++ +IIMSL +VY +VA  LT++EH RT+S++++S  LK++L +F+N  SS FYI F        P   +    + R   C   GCL+DL LQ+  IM+ KQI ++  E   P L +   R K+K+A E    QS+++ E                P+    W ++P          ++  G   L  EYLEM++QFGF TIF+ AFPLAPLLAL NN+ EIR DA KF    RRP+  R  DIGIW  ++  +  +AV +NA +IA  + YI + +Y I        GY     L G+ + SLS  +  E     Y            YCRY  +R PPW    EPY +T  +W +LAA++ F+ +FE+LV+     IA +IPD+P  L   M+RE  L  E++ +A+L  ++ +
Sbjct:  153 SGLMFRDGKKRIDYILVYKK----SSPQVEKRCTFERNLRAEGLMLE-----------KEPSLTNSD----------IMFVKIHAPWDTLCKYAEQMNIRMPFRKKCYFTDWKKKAMGSRFQLRFRQLKSW-------LPR---NPMKLDKEALPDLVETDCYTAPFCRARMHHFTIN---NRETFFSNSTRSRI-------VHHVLQRT--------------------------------KYEDGKSK---MGINRLLGNSTYEAAFPPHEGCYKSRHPIKTHGAQNHRHLLYERWARWGIWYKYQPLDLIRRYFGEKIGLYFAWLGWYTGMLIPAALVGLFVFLYGLFTMDSSQVSKEICEANTTVMCP-MCEG-NCSSWTLSDSCVYAKVTHLFDNGGTVFFAIFMAIWATVFLEFWKRRRAELTYDWDLIDWEEEEEELRPQFEAKYSRK--ERVNPISGKPEPFQPL-TDKLSRLMVSVSGIFFMISLVLTAVFAVVVFRLIAMEKFVSFQWEFVKKNWQFATSGTGVCINFMIIMSLNVVYEKVAYLLTNLEHPRTESEWENSFALKMFLFQFVNLNSSTFYIAFFLGRFAGRPGDYNKLFNRWRMEECHPSGCLIDLCLQMGVIMVLKQIWNNFMELGYPLLQNWWSRRKMKRAGE----QSNSKEEL---------------PQWDRDWNLQP----------MNAHG---LVDEYLEMVLQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPMPARATDIGIWHGVLEGIGVVAVITNAFVIAITSDYIPRFVYAIKYGPCVDKGYRHEKCLRGYLNNSLSVFDMGELRNGSY---------ENQYCRYRDYRAPPWSP--EPYEFTLQFWHVLAARLAFIIVFEHLVFGIKTFIAHMIPDMPKDLCDRMRREKYLMQEMVYEAELEHLQKE 975          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano5a (anoctamin 5a [Source:ZFIN;Acc:ZDB-GENE-091013-2])

HSP 1 Score: 399.438 bits (1025), Expect = 6.887e-122
Identity = 306/992 (30.85%), Postives = 482/992 (48.59%), Query Frame = 1
Query:  100 SNED-EILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKPIPRGFT-TPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDID--VVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ---GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDE--PARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSF----SLMRMHHSRTISNMSSII-----TAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLI--YIIGYSENGFLNGFTDFSLSYMNSSEF----------NATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ 2970
            SN D E    +N +++  ++  + ++F DGVR+IDFVL Y    D    Q +R  F  +L K GLE+E +D                    S S      F+K+   WE L  YA+VLKI+     + F+ +                    +I E K IP G+  TP+      +   P+    FFT+      +++ L       I DK  + P      +V  +LSR                               P++ ED   K    GI +L++ G + SA+ LH+         ++   +ER  LYK+W    + ++ QPL+ I+ Y+GEK+  YFAWLG+YT  L   +++G++  +Y +     +I  +EI     G  I MCPL C  + C +WKLS   S  +   L DN ATV  A+ M IW +LFLE WKR+Q +L Y W++ D E E +    RPE+ +   K   ++ N ++ + EP++P    +      + +TVL  I++ +A + G+I Y+L  F    S+M+   +  +  + ++I     T+ T S ++ VIIM L  +Y RVA+ +TDME  +T  +Y++ +T+K++L +F+N YSS FY+ F +      P      F   S ++   C  GGCL++L+ QL  +M+GKQ+  +I+E  +P L +       +   E L +                                     R   D+ L + G   LF EYLEM+IQFGFIT+F+ +FPLAPLLAL NN+ E+R DA KF    RRPVA +   IG W  I++M+A  +V +NA +++F +  I +L+  Y+        ++G+   SLS  N SEF          N   +         N T CRY  +R+PP   K   Y++   +W ILAAK+ F+ + E++V++    +A +IPDVP  ++  +KRE  L  E +   ++ ++KNQ
Sbjct:   32 SNSDKETFQLENAEVDKQQQSKDSVYFRDGVRRIDFVLSYIDDKDGEKKQDRRKVFEANLQKAGLEVETEDK-------------------SESEDGKTYFLKIHVPWEVLATYADVLKIK-----VPFKAN--------------------DIPENKEIPMGWLFTPFRLPDHVMNPEPD----FFTSTFDKSKIDFFL-------IEDKETLFPASTRNRIVYYLLSR------------------------------IPYSTEDKDKK----GIKRLLNNGTYTSAFPLHD-CRYWTRSRDDNCESERYSLYKNWARFSSFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLSYAAVVGLLCFIYGVATFDENIWSREICNETIGGQIVMCPL-CDKK-CGYWKLSTTCSSSWQSYLFDNAATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYES---KCTNRRLNRVTQEMEPYLPL-TSKCARSILSGATVLFWISLIIASIIGVIAYRLAVFAAFASIMKDSPTNKLEIVGNLITPQFATSVTASCINFVIIMVLNFLYERVAIKITDMEVPKTHVEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGNYAYMFGPWSGLRNEECEPGGCLIELTTQLVIVMVGKQVWGNIQEALVPWLRNWWVSRSARNHPESLYS-------------------------------------RWEQDHDLQNLGQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKFTTQFRRPVAAKAHSIGAWEEILNMIAVFSVVTNAFIVSFTSDMIPRLVYQYVHNTGNAASMSGYITHSLSIYNISEFPPENRPDDDENPDWFN------AGNYTTCRYRDYRYPPGHEK--QYTHNMDFWHILAAKLAFIIIMEHVVFVVKFFVAWLIPDVPSDVKARVKRERYLIQEYLHDYEVEKLKNQ 882          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano5b (anoctamin 5b [Source:ZFIN;Acc:ZDB-GENE-061215-108])

HSP 1 Score: 396.741 bits (1018), Expect = 6.340e-121
Identity = 308/997 (30.89%), Postives = 481/997 (48.24%), Query Frame = 1
Query:  136 DINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ---GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA--RPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSF----SLMRMHHSRTISNMSSIIT-----AATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSEN--GFLNGFTDFSLSYMNSSEF---NATLYGGHKLTLGTNE-TYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ---------HTSKLVADSFKKSAVIAK 3024
            +I+   +  + +FF DGVR+IDFVL Y    +      +R  F  +L K GLE+E +D                    S S      ++K+ A WE L  YA+VLKI+             R+   + L   F        N ++P P  FT P+ KSK   F I +D  TFF  + R+ IV YIL                            RC                             P+  ED   K    GI +L++ G + SAY LH+         +    +ER  LY++W      ++ QPL+ IK Y+GEK+  YFAWLG+YT  L   +++G+I  +Y ++   ++I  KEI     G  I MCPL    + C +WKL+      +   L DN  TV  A+ M IW +LFLE WKR+Q +L Y W++ D E E +    RPE+     K   ++ N I+ + EP++PF   +      + +TVL    + +A + G+I Y+L  +    S+M+   +  I  + S+IT     + T S ++ VII+ L  +Y  VA+W+TDME  +T  +Y++ +T+K+++ +F+N YSS FY+ F +      P      F   S ++   C  GGCL++L+ QL  +M GKQ++ +++E  LP + +     K          +S  E    R E                             D+ L +     LF EYLEM+IQFGFIT+F+ +FPLAPLLAL NN+ E+R DA KF    RRP+A + ++IG W  I+++VA ++V +NA ++AF +  I +L+Y+  Y       + G+   SLS  N S+    N    G +     ++  T CRY  +R+PP   +   Y++T  +W ILAAK+ F+ + E++V++    +A +IPDVP +++  +KRE  L  E +   ++ ++K Q          T+ L+  S  K  VI++
Sbjct:   46 EIDKFDQNRDSVFFKDGVRRIDFVLSYVDDKEGDKKAERRREFEANLEKAGLELETEDK-------------------SESDDRKTHYLKIHAPWEVLATYADVLKIKVPFKVSDIPK--AREVPLEWLSHPFRLPE----NIMRPEPDYFTAPFDKSKVDFFLI-DDKDTFFPPSTRNRIVYYILT---------------------------RC-----------------------------PYYKEDRKEKDKT-GINRLLNNGTYTSAYPLHD-CRYWKKAQDMQCESERYHLYRYWARFLCFYKEQPLNLIKKYYGEKIGIYFAWLGFYTEMLFYAAVMGVICFVYGVLSYEDNITSKEICDPKIGGMIVMCPL--CDKKCSYWKLNSTCLSSWQSHLFDNEGTVFFAMFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQIRPEYE---QKCTGRRLNRITQEMEPYLPF-PSKCARFCLSGATVLFWTCLIVACIMGVIAYRLAVYAAFASVMKDSSTSKIQLVGSLITPQLATSVTASCINFVIILILNFLYEHVAIWITDMEIPKTHLEYENKLTMKMFMFQFVNYYSSCFYVAFFKGKFVGYPGNYSYMFGKWSTLRNEECAPGGCLIELTTQLLIVMAGKQMVGNVQEALLPLVRNWWSSRK---------GRSHPESTYSRWE----------------------------QDHDLQNFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALFNNILEVRVDAWKFTTQFRRPMAAKARNIGAWEEILNVVAIMSVVTNAFIMAFTSDMIPRLVYLYAYHPGIEANMTGYITNSLSIYNISQIPEDNLPEAGENPSWFNSSTITTCRYRDYRYPPGHLR--QYTHTMQFWHILAAKLAFIIIMEHVVFVVKFFVAWLIPDVPSEVKARIKRERFLVQEYLHNYEVEKLKMQLSQSFCLSTETASLLPSSPNKHQVISE 913          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano5a (anoctamin 5a [Source:ZFIN;Acc:ZDB-GENE-091013-2])

HSP 1 Score: 392.119 bits (1006), Expect = 1.114e-119
Identity = 301/978 (30.78%), Postives = 475/978 (48.57%), Query Frame = 1
Query:  139 INDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKPIPRGFT-TPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDID--VVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ---GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDE--PARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSF----SLMRMHHSRTISNMSSII-----TAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLI--YIIGYSENGFLNGFTDFSLSYMNSSEF----------NATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ 2970
            ++  ++  + ++F DGVR+IDFVL Y    D    Q +R  F  +L K GLE+E +D                    S S      F+K+   WE L  YA+VLKI+     + F+ +                    +I E K IP G+  TP+      +   P+    FFT+      +++ L       I DK  + P      +V  +LSR                               P++ ED   K    GI +L++ G + SA+ LH+         ++   +ER  LYK+W    + ++ QPL+ I+ Y+GEK+  YFAWLG+YT  L   +++G++  +Y +     +I  +EI     G  I MCPL C  + C +WKLS   S  +   L DN ATV  A+ M IW +LFLE WKR+Q +L Y W++ D E E +    RPE+ +   K   ++ N ++ + EP++P    +      + +TVL  I++ +A + G+I Y+L  F    S+M+   +  +  + ++I     T+ T S ++ VIIM L  +Y RVA+ +TDME  +T  +Y++ +T+K++L +F+N YSS FY+ F +      P      F   S ++   C  GGCL++L+ QL  +M+GKQ+  +I+E  +P L +       +   E L +                                     R   D+ L + G   LF EYLEM+IQFGFIT+F+ +FPLAPLLAL NN+ E+R DA KF    RRPVA +   IG W  I++M+A  +V +NA +++F +  I +L+  Y+        ++G+   SLS  N SEF          N   +         N T CRY  +R+PP   K   Y++   +W ILAAK+ F+ + E++V++    +A +IPDVP  ++  +KRE  L  E +   ++ ++KNQ
Sbjct:   23 VDKQQQSKDSVYFRDGVRRIDFVLSYIDDKDGEKKQDRRKVFEANLQKAGLEVETEDK-------------------SESEDGKTYFLKIHVPWEVLATYADVLKIK-----VPFKAN--------------------DIPENKEIPMGWLFTPFRLPDHVMNPEPD----FFTSTFDKSKIDFFL-------IEDKETLFPASTRNRIVYYLLSR------------------------------IPYSTEDKDKK----GIKRLLNNGTYTSAFPLHD-CRYWTRSRDDNCESERYSLYKNWARFSSFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLSYAAVVGLLCFIYGVATFDENIWSREICNETIGGQIVMCPL-CDKK-CGYWKLSTTCSSSWQSYLFDNAATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYES---KCTNRRLNRVTQEMEPYLPL-TSKCARSILSGATVLFWISLIIASIIGVIAYRLAVFAAFASIMKDSPTNKLEIVGNLITPQFATSVTASCINFVIIMVLNFLYERVAIKITDMEVPKTHVEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGNYAYMFGPWSGLRNEECEPGGCLIELTTQLVIVMVGKQVWGNIQEALVPWLRNWWVSRSARNHPESLYS-------------------------------------RWEQDHDLQNLGQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKFTTQFRRPVAAKAHSIGAWEEILNMIAVFSVVTNAFIVSFTSDMIPRLVYQYVHNTGNAASMSGYITHSLSIYNISEFPPENRPDDDENPDWFN------AGNYTTCRYRDYRYPPGHEK--QYTHNMDFWHILAAKLAFIIIMEHVVFVVKFFVAWLIPDVPSDVKARVKRERYLIQEYLHDYEVEKLKNQ 859          
BLAST of Anoctamin vs. Ensembl Zebrafish
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 376.711 bits (966), Expect = 1.999e-116
Identity = 241/698 (34.53%), Postives = 385/698 (55.16%), Query Frame = 1
Query:  898 KTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXX-XXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNI-TMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSM-IKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIIL--KADLLQMKNQHT 2976
            K  + G+A+L+ +G F  A+ LHE P           + N+R +LY +W S     + QPLDHI+ YFGEK+A YFAWLG+YT WLLP +L+G  V +  I+   ++   KEI +   +  MCPL C +  C+ W +SD      +  L D+  TV  +V MS+WA  FLE WKR+   LA+HW+  D   ++EP RPEF A+       + N ++G +EP+ P  + R+  M      +++ + + + FL  +I+Y+ +   +M    S  +   +  I   + +L++L +I+ +  VY+ +A  LT  E HRTQ+QY+ + T K+++ +F+N YSS FY+ F +      P    +   ++   C  GGCL++L+ QL  IM+GKQ+I++I+E+ +P+    +K ++ K+A    + ++    E +R                   W+ + ELI C             LF EYLE+++QFGFITIF+ AFPLAPL AL NN  E+R DA KF    RRPVA+R + IG+W  I+  ++ ++V  NA LIAF + ++ +L+Y   Y  N  L+G+ +F+L+Y   S +N            ++ T CRY  FR        E   Y  VYW++LA ++ F+  FE++V+  + +I  ++PD+P+ L++ +KRE  L  + +   +  LLQ K   T
Sbjct:   14 KRAEVGVARLLRDGAFTGAFPLHEGPFKLPSCDTQPDQLNKRQVLYHYWASWLKWCKYQPLDHIREYFGEKIALYFAWLGFYTAWLLPAALVGTCVFVSGILTMGSNTPAKEICESGGLYLMCPL-CET--CKPWNMSDICPMAKVGYLFDHPGTVFFSVFMSLWAVTFLEYWKRKNATLAHHWDCMDFHEDEEPPRPEFAAMAPA---MEENPVTGVKEPYFPE-KARISRMLTGSMVIVIMLCVVMIFLVTVIIYRSIVSVMMFETGSSVLRTQAGNIANISSTLVNLALILLMGQVYTALAEQLTKWEMHRTQTQYEDAFTFKVFIFQFVNFYSSPFYVAFFKGRFVGYPGHYGTLFGMRNEDCGPGGCLIELAEQLCIIMVGKQLINNIQEFVIPK----IKAWRQKRALAS-VKKAQKTQEPER-------------------WEQDYELIPCEG-----------LFDEYLEIVLQFGFITIFVAAFPLAPLFALLNNWVEVRLDAHKFVCEYRRPVAERAQHIGVWFIILEALSHVSVVVNAFLIAFTSDFLPRLLY--QYKFNNDLHGYVNFTLAYSPPS-YNH-----------SSHTVCRYKAFRD-------ENGKYKLVYWELLAVRLGFIIAFEHVVFFVLRVIDWMVPDIPESLQLKIKRERYLAKQALADNQEALLQAKRLAT 648          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: ANO5 (anoctamin 5 [Source:NCBI gene;Acc:100489787])

HSP 1 Score: 400.593 bits (1028), Expect = 1.153e-122
Identity = 314/974 (32.24%), Postives = 473/974 (48.56%), Query Frame = 1
Query:  115 ILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVY--ERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ---GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA--RPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSF----SLMRMHHS-RTISNM--SSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSMIKPRG--CPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYS--ENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSK 2982
            +L    P I+   +  + +FF DG R+IDFVL Y  +   D      +R  F  +L K GLE+E +D                      S      F+K+ A WE L  YAEVL ++  + +   + D   + I   + + F          + P P  FT P+ K K+ LF   E+   FFT + R+ IV Y                          ILSR                       C        +  E+   K   FGI +L++ G +  AY LH+    +     +  N ER  LY HW      ++ QPLD I+ Y+GEK+  YFAWLG+YT  L   +++G    LY  +   + I  KEI     G  I MCPL C  R C FW+L+          + DN AT+  A+ M IW +LFLE WKR+Q +L Y W++ D E E +    RPE+ +   K   KK N ++ + EP++P    +     F+ +TVL  IA+ +A +  II+Y+L  +    S+M  + + + +SN+    + T+ T S+L+ V IM L  +Y RVA+W+TDME  RT  +Y++ +T+K++L +F+N YSS FY+ F +      P+  S    K R   C   GCL++L+ QL  +M GKQI  +I+E  +P   + +KR K +   + L +                                     R   D  L   G   LF EYLEM++QFGFIT+F+ +FPLAPLLAL NN+ EIR D+ K     +RPVA +   IG+W  I++ +A ++V +NA ++AF +  I +L+Y   YS  E   ++G+   SLS  N S+F         +    N   CRY  +R+PP   K   Y  T  YW ILAAK+ F+ + E++V+L    +A +IPDVP +++  +KRE  LT +I+ + +L ++K +  +K
Sbjct:   15 LLPPPPPQIDKHAQSKDSVFFWDGSRRIDFVLSYTEDTGKDAEKKAERRREFELNLQKSGLELETEDK-------------------KESENGKTYFVKIHAPWEVLTTYAEVLNLKMPLKADDLKDD--SENILSHVLKLFKLPQ----EVMYPEPDYFTAPFRKDKQELFRT-EEREKFFTPSTRNRIVYY--------------------------ILSR-----------------------CH-------YGEEEGKKK---FGIKRLLTNGSYLDAYPLHD---CQYWKKTDERNCERYTLYTHWAKFTRFYKEQPLDLIRKYYGEKIGIYFAWLGFYTEMLFYAAVVGFFCFLYGWITMDDSISSKEICDPNIGGQIIMCPL-CDKR-CEFWRLNSTCEPSQYSHMFDNVATLFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYES---KCTEKKKNPVTQEMEPYLPA-TSKAARFCFSGATVLFWIALIIASIIAIIVYRLWVYAAFASIMDNNLALKPVSNLLTPQLATSVTASVLNFVTIMILNFLYERVAIWITDMEIPRTHLEYENRLTMKMFLFQFVNYYSSCFYVAFFKGKFVGYPADYSYLFGKWRNEECDPAGCLIELTTQLTIVMAGKQIWGNIQEAFVPWTWNWLKRRKARNHPQNLYS-------------------------------------RWEHDGDLQTFGGLGLFNEYLEMVVQFGFITLFVASFPLAPLLALLNNILEIRVDSWKLTTQFKRPVAAKAHSIGVWQEILNGIAILSVVTNAFIVAFTSDMIPRLVYYYAYSQDEGTPMSGYIGSSLSVFNVSDFKEQ---SMPMENDMNVISCRYRDYRYPPGHEK--EYQVTMQYWHILAAKMAFIIIMEHVVFLVKFFVAWLIPDVPSEVKARVKREKFLTQKILHEYELEKLKQKLCNK 852          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: ANO5 (anoctamin 5 [Source:NCBI gene;Acc:100489787])

HSP 1 Score: 400.208 bits (1027), Expect = 1.748e-122
Identity = 314/974 (32.24%), Postives = 473/974 (48.56%), Query Frame = 1
Query:  115 ILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVY--ERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ---GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA--RPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSF----SLMRMHHS-RTISNM--SSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSMIKPRG--CPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYS--ENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSK 2982
            +L    P I+   +  + +FF DG R+IDFVL Y  +   D      +R  F  +L K GLE+E +D                      S      F+K+ A WE L  YAEVL ++  + +   + D   + I   + + F          + P P  FT P+ K K+ LF   E+   FFT + R+ IV Y                          ILSR                       C        +  E+   K   FGI +L++ G +  AY LH+    +     +  N ER  LY HW      ++ QPLD I+ Y+GEK+  YFAWLG+YT  L   +++G    LY  +   + I  KEI     G  I MCPL C  R C FW+L+          + DN AT+  A+ M IW +LFLE WKR+Q +L Y W++ D E E +    RPE+ +   K   KK N ++ + EP++P    +     F+ +TVL  IA+ +A +  II+Y+L  +    S+M  + + + +SN+    + T+ T S+L+ V IM L  +Y RVA+W+TDME  RT  +Y++ +T+K++L +F+N YSS FY+ F +      P+  S    K R   C   GCL++L+ QL  +M GKQI  +I+E  +P   + +KR K +   + L +                                     R   D  L   G   LF EYLEM++QFGFIT+F+ +FPLAPLLAL NN+ EIR D+ K     +RPVA +   IG+W  I++ +A ++V +NA ++AF +  I +L+Y   YS  E   ++G+   SLS  N S+F         +    N   CRY  +R+PP   K   Y  T  YW ILAAK+ F+ + E++V+L    +A +IPDVP +++  +KRE  LT +I+ + +L ++K +  +K
Sbjct:   15 LLPPPPPQIDKHAQSKDSVFFWDGSRRIDFVLSYTEDTGKDAEKKAERRREFELNLQKSGLELETEDK-------------------KESENGKTYFVKIHAPWEVLTTYAEVLNLKMPLKADDLKDD--SENILSHVLKLFKLPQ----EVMYPEPDYFTAPFRKDKQELFRT-EEREKFFTPSTRNRIVYY--------------------------ILSR-----------------------CH-------YGEEEGKKK---FGIKRLLTNGSYLDAYPLHD---CQYWKKTDERNCERYTLYTHWAKFTRFYKEQPLDLIRKYYGEKIGIYFAWLGFYTEMLFYAAVVGFFCFLYGWITMDDSISSKEICDPNIGGQIIMCPL-CDKR-CEFWRLNSTCEPSQYSHMFDNVATLFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYES---KCTEKKKNPVTQEMEPYLPA-TSKAARFCFSGATVLFWIALIIASIIAIIVYRLWVYAAFASIMDNNLALKPVSNLLTPQLATSVTASVLNFVTIMILNFLYERVAIWITDMEIPRTHLEYENRLTMKMFLFQFVNYYSSCFYVAFFKGKFVGYPADYSYLFGKWRNEECDPAGCLIELTTQLTIVMAGKQIWGNIQEAFVPWTWNWLKRRKARNHPQNLYS-------------------------------------RWEHDGDLQTFGGLGLFNEYLEMVVQFGFITLFVASFPLAPLLALLNNILEIRVDSWKLTTQFKRPVAAKAHSIGVWQEILNGIAILSVVTNAFIVAFTSDMIPRLVYYYAYSQDEGTPMSGYIGSSLSVFNVSDFKEQ---SMPMENDMNVISCRYRDYRYPPGHEK--EYQVTMQYWHILAAKMAFIIIMEHVVFLVKFFVAWLIPDVPSEVKARVKREKFLTQKILHEYELEKLKQKLCNK 852          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: ANO4 (major histocompatibility complex class I-related gene protein-like [Source:Xenbase;Acc:XB-GENE-5756215])

HSP 1 Score: 399.053 bits (1024), Expect = 2.050e-122
Identity = 306/957 (31.97%), Postives = 481/957 (50.26%), Query Frame = 1
Query:  136 DINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIR----KQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXX-XXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIG-FIQPFT-QPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSE-NGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSK 2982
            DI +      G+FF DG R+ID++LVY + +       KR  F +++  EGL +E           KE+S  ++D          I+F+K+ A WE L RYAE++ +R    +++  L   Y F        L +    L+   I +L+     +T P+S+ + + F I  +  TFF  A R+                           +V  IL R                                   E+  NK    G+ +L++   +++A+ LHE      + ++       R+LL++ W S    ++ QPLD ++ YFGEK+  YFAWLG+YT  L P +++G+ V LY +    +  V +EI Q TNITMCPL    + C + +LSD+     +  L DN ATV  AV M++WA++FLE WKR++  +AY W++ D E E+E  RP+F A   K   ++ N ISGK EP+  F   +   +  + S +   I + +A + GI++Y++V+ S         I N S + T  T   ++  IIM L ++Y RVA++LT++E  RT+S++++S TLK++L +F+N  SS FYI  F+  FT +P    R  +  +   C   GCL+DL LQ+  IM+ KQ  ++  E   P + +   R KL+Q                  E  I  K  +  P+    + ++P               P  LF EYLEM++QFGF TIF+ AFPLAPLLAL NN+ EIR DA KF    RRP+A R KDIGIW  I+  +  ++V +NA +IA  + +I +L+Y   Y    G         + Y+N+S           L++     +  +S   HPP  +  EPY+YT  +W +LAA++ F+ +FE+LV+    +I+ +IPD+P  LR  M+RE  L  E++ +A+L +++ +   +
Sbjct:    3 DIGEIFPVCCGLFFNDGKRRIDYILVYRKTS---LQSEKREIFERNIRAEGLHLE-----------KESSIVNSD----------IIFVKLHAPWEVLGRYAELMNVRMPFRRKIYYLHRRYKFMSSRFRGLLPKKPMRLDKEKIPDLEE-NDCYTAPFSQQRIHHFII-NNKDTFFNNATRT--------------------------RIVHHILQR--------------------------------VKYEEGKNKI---GLNRLLTNCTYEAAFPLHEGSYRSKNSIKTHGAENHRHLLFECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAIVGLFVFLYGMFTLDSCQVSREICQATNITMCPL--CDKYCPYMRLSDSCIYAKVTHLFDNSATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERVNPISGKPEPYQAF-ADKCSRLVVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYERVALFLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGRPGAYLRLINKWRLEECHPSGCLIDLCLQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKLRQ------------------EHGIHGKTAL--PQWEKDYNLQP-------------INPYGLFEEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFITQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAVTSDFIPRLVYAYKYGPCAGQGRAGEKCMVGYVNAS-----------LSVFLVTDFENHSNSSHPP--SAPEPYAYTLQFWHVLAARLAFIIVFEHLVFFIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERVQKEKKER 821          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: ANO4 (major histocompatibility complex class I-related gene protein-like [Source:Xenbase;Acc:XB-GENE-5756215])

HSP 1 Score: 397.127 bits (1019), Expect = 9.422e-122
Identity = 305/950 (32.11%), Postives = 473/950 (49.79%), Query Frame = 1
Query:  148 DKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKPIPRGF--TTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXX-XXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIG-FIQPFT-QPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSK 2982
            +K   +G+FF DG R+ID++LVY + +       KR  F +++  EGL +E           KE+S  ++D          I+F+K+ A WE L RYAE++ +R           F RK  +  L   + F++ F         RG     P    KE + D+ E+N  +     +  I ++I+         D          +V  IL R                                   E+  NK    G+ +L++   +++A+ LHE      + ++       R+LL++ W S    ++ QPLD ++ YFGEK+  YFAWLG+YT  L P +++G+ V LY +    +  V +EI Q TNITMCPL    + C + +LSD+     +  L DN ATV  AV M++WA++FLE WKR++  +AY W++ D E E+E  RP+F A   K   ++ N ISGK EP+  F   +   +  + S +   I + +A + GI++Y++V+ S         I N S + T  T   ++  IIM L L Y RVA++LT++E  RT+S++++S TLK++L +F+N  SS FYI  F+  FT +P    R  +  +   C   GCL+DL LQ+  IM+ KQ  ++  E   P + +   R KL+Q                  E  I  K  +  P+    + ++P               P  LF EYLEM++QFGF TIF+ AFPLAPLLAL NN+ EIR DA KF    RRP+A R KDIGIW  I+  +  ++V +NA +IA  + +I +L+Y   Y                            G KL +  +    RY  +R PP  +  EPY+YT  +W +LAA++ F+ +FE+LV+    +I+ +IPD+P  LR  M+RE  L  E++ +A+L +++ +   +
Sbjct:   18 EKNKTSGLFFNDGKRRIDYILVYRKTS---LQSEKREIFERNIRAEGLHLE-----------KESSIVNSD----------IIFVKLHAPWEVLGRYAELMNVRM---------PFRRKIYY--LHRRYKFMSRF---------RGLLPKKPMRLDKEKIPDL-EENDCYTAPFSQQRIHHFIINN------KDTFFNNATRTRIVHHILQR--------------------------------VKYEEGKNKI---GLNRLLTNCTYEAAFPLHEGSYRSKNSIKTHGAENHRHLLFECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAIVGLFVFLYGMFTLDSCQVSREICQATNITMCPL--CDKYCPYMRLSDSCIYAKVTHLFDNSATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERVNPISGKPEPYQAF-ADKCSRLVVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNL-YERVALFLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGRPGAYLRLINKWRLEECHPSGCLIDLCLQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKLRQ------------------EHGIHGKTAL--PQWEKDYNLQP-------------INPYGLFEEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFITQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAVTSDFIPRLVYAYKYGPCA-------------------GQGRAGEKLIISFSS---RYRDYRDPP--SAPEPYAYTLQFWHVLAARLAFIIVFEHLVFFIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERVQKEKKER 818          
BLAST of Anoctamin vs. Ensembl Xenopus
Match: ANO5 (anoctamin 5 [Source:NCBI gene;Acc:100489787])

HSP 1 Score: 386.341 bits (991), Expect = 2.181e-117
Identity = 309/974 (31.72%), Postives = 465/974 (47.74%), Query Frame = 1
Query:  115 ILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVY--ERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ---GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA--RPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSF----SLMRMHHS-RTISNM--SSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSMIKPRG--CPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYS--ENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSK 2982
            +L    P I+   +  + +FF DG R+IDFVL Y  +   D      +R  F  +L K GLE+E +D                      S      F+K+ A WE L  YAEVL ++  + +   + D   + I   + + F          + P P  FT P+ K          D    F   ER        R                   +V  ILSR                       C        +  E+   K   FGI +L++ G +  AY LH+    +     +  N ER  LY HW      ++ QPLD I+ Y+GEK+  YFAWLG+YT  L   +++G    LY  +   + I  KEI     G  I MCPL C  R C FW+L+          + DN AT+  A+ M IW +LFLE WKR+Q +L Y W++ D E E +    RPE+ +   K   KK N ++ + EP++P    +     F+ +TVL  IA+ +A +  II+Y+L  +    S+M  + + + +SN+    + T+ T S+L+ V IM L  +Y RVA+W+TDME  RT  +Y++ +T+K++L +F+N YSS FY+ F +      P+  S    K R   C   GCL++L+ QL  +M GKQI  +I+E  +P   + +KR K +   + L +                                     R   D  L   G   LF EYLEM++QFGFIT+F+ +FPLAPLLAL NN+ EIR D+ K     +RPVA +   IG+W  I++ +A ++V +NA ++AF +  I +L+Y   YS  E   ++G+   SLS  N S+F         +    N   CRY  +R+PP   K   Y  T  YW ILAAK+ F+ + E++V+L    +A +IPDVP +++  +KRE  LT +I+ + +L ++K +  +K
Sbjct:   15 LLPPPPPQIDKHAQSKDSVFFWDGSRRIDFVLSYTEDTGKDAEKKAERRREFELNLQKSGLELETEDK-------------------KESENGKTYFVKIHAPWEVLTTYAEVLNLKMPLKADDLKDD--SENILSHVLKLFKLPQ----EVMYPEPDYFTAPFRK----------DKQELFRTEEREKFFTPSTRNR-----------------IVYYILSR-----------------------CH-------YGEEEGKKK---FGIKRLLTNGSYLDAYPLHD---CQYWKKTDERNCERYTLYTHWAKFTRFYKEQPLDLIRKYYGEKIGIYFAWLGFYTEMLFYAAVVGFFCFLYGWITMDDSISSKEICDPNIGGQIIMCPL-CDKR-CEFWRLNSTCEPSQYSHMFDNVATLFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYES---KCTEKKKNPVTQEMEPYLPA-TSKAARFCFSGATVLFWIALIIASIIAIIVYRLWVYAAFASIMDNNLALKPVSNLLTPQLATSVTASVLNFVTIMILNFLYERVAIWITDMEIPRTHLEYENRLTMKMFLFQFVNYYSSCFYVAFFKGKFVGYPADYSYLFGKWRNEECDPAGCLIELTTQLTIVMAGKQIWGNIQEAFVPWTWNWLKRRKARNHPQNLYS-------------------------------------RWEHDGDLQTFGGLGLFNEYLEMVVQFGFITLFVASFPLAPLLALLNNILEIRVDSWKLTTQFKRPVAAKAHSIGVWQEILNGIAILSVVTNAFIVAFTSDMIPRLVYYYAYSQDEGTPMSGYIGSSLSVFNVSDFKEQ---SMPMENDMNVISCRYRDYRYPPGHEK--EYQVTMQYWHILAAKMAFIIIMEHVVFLVKFFVAWLIPDVPSEVKARVKREKFLTQKILHEYELEKLKQKLCNK 852          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano1 (anoctamin 1, calcium activated chloride channel [Source:MGI Symbol;Acc:MGI:2142149])

HSP 1 Score: 417.542 bits (1072), Expect = 3.631e-128
Identity = 318/1006 (31.61%), Postives = 509/1006 (50.60%), Query Frame = 1
Query:   97 MSNEDEILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEI--------QDDGC--KVYPFKENS------YYDNDS-VGSPSHRSNIV------------------FIKVFATWETLCRYAEVLKIR---KQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKP-IPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIY-QGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVA-LIDKNYPKKTNLISGKEEPFIPF-WRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQII-SHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ 2970
            + +E  +L + + D + + KY  G++F DG RK+D++LVY           KR +  ++L + GL+ ++        QD     K  P    S      Y+++D       +  N++                  F+K+ A W  LCR AE LK++   K++  +  E     KTI   L +  D +    + E +P   +  + P+S+ K++LFD+  D  +FF +  RS I                          V +IL R                     T C              +      GI  L++ GV+ +AY LH+     D + +NVE N+R LLY+ W S    ++ QP+D ++ YFGEKV  YFAWLG YT  L+P S++G+IV LY       +I   E+  Q  NITMCPL    + C +WK+S A +      L DN ATV  +V M++WA+ F+E WKR+Q++L Y W++   E E++  R E+ A +++K+  K++     KE   +   WR R P  F    +++  IA+  A + G+I+Y++ + + + M+ S ++ +   +   AT  +++LV+I+ L  VY  +A WLT +E  +T+  ++  +T K +LL+F+N+Y+ IFY+ F +      P      FRS  M     C  GGCL++L +QL+ IM+GKQ+I +++ E  +P++   ++  KL++           +  +DR E   + +   +D      + +EP     +A           L  EY+EM+IQFGF+T+F+ +FPLAPL AL NN+ EIR DA KF   LRRPVA R KDIGIW +I+  V  +AV  NA +I+F + +I +L+Y+  YS+NG ++GF + +LS  N S+F         L LG     CRY  +R PPW      Y  +  +W +LAA++ FV +F+NLV      +  VIPD+P  +   + +E  L  E+ ++ +  Q K Q
Sbjct:   31 LPSEGTLLNSLSVDPDAECKY--GLYFRDGKRKVDYILVYHH---------KRASGSRTLARRGLQNDMVLGTRSVRQDQPLPGKGSPVDAGSPEVPMDYHEDDKRFRREEYEGNLLEAGLELENDEDTKIHGVGFVKIHAPWHVLCREAEFLKLKMPTKKVYHIS-ETRGLLKTINSVLQKITDPIQP-KVAEHRPQTTKRLSYPFSREKQHLFDL-TDRDSFFDSKTRSTI--------------------------VYEILKR---------------------TTC--------------TKAKYSMGITSLLANGVYSAAYPLHD----GDYEGDNVEFNDRKLLYEEWASYGVFYKYQPIDLVRKYFGEKVGLYFAWLGAYTQMLIPASIVGVIVFLYGCATVDENIPSMEMCDQRYNITMCPL--CDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEDHPRAEYEARVLEKSLRKESR---NKETDKVKLTWRDRFPAYFTNLVSIIFMIAVTFAIVLGVIIYRISTAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLTFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRM---EECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKFIRYLKLRR-----------QSPSDREEYVKRKQRYEVD------FNLEP-----FAG----------LTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAIRAKDIGIWYNILRGVGKLAVIINAFVISFTSDFIPRLVYLYMYSQNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSE--HKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREE--QGKQQ 913          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano1 (anoctamin 1, calcium activated chloride channel [Source:MGI Symbol;Acc:MGI:2142149])

HSP 1 Score: 418.313 bits (1074), Expect = 6.506e-128
Identity = 314/992 (31.65%), Postives = 502/992 (50.60%), Query Frame = 1
Query:  139 INDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEI--------QDDGC--KVYPFKENS------YYDNDS-VGSPSHRSNIV------------------FIKVFATWETLCRYAEVLKIR---KQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKP-IPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIY-QGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVA-LIDKNYPKKTNLISGKEEPFIPF-WRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQII-SHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ 2970
            ++ D +   G++F DG RK+D++LVY           KR +  ++L + GL+ ++        QD     K  P    S      Y+++D       +  N++                  F+K+ A W  LCR AE LK++   K++  +  E     KTI   L +  D +    + E +P   +  + P+S+ K++LFD+  D  +FF +  RS I                          V +IL R                     T C              +      GI  L++ GV+ +AY LH+     D + +NVE N+R LLY+ W S    ++ QP+D ++ YFGEKV  YFAWLG YT  L+P S++G+IV LY       +I   E+  Q  NITMCPL    + C +WK+S A +      L DN ATV  +V M++WA+ F+E WKR+Q++L Y W++   E E++  R E+ A +++K+  K++     KE   +   WR R P  F    +++  IA+  A + G+I+Y++ + + + M+ S ++ +   +   AT  +++LV+I+ L  VY  +A WLT +E  +T+  ++  +T K +LL+F+N+Y+ IFY+ F +      P      FRS  M +   C  GGCL++L +QL+ IM+GKQ+I +++ E  +P++   ++  KL++           +  +DR E   + +   +D      + +EP     +A           L  EY+EM+IQFGF+T+F+ +FPLAPL AL NN+ EIR DA KF   LRRPVA R KDIGIW +I+  V  +AV  NA +I+F + +I +L+Y+  YS+NG ++GF + +LS  N S+F         L LG     CRY  +R PPW      Y  +  +W +LAA++ FV +F+NLV      +  VIPD+P  +   + +E  L  E+ ++ +  Q K Q
Sbjct:  101 VDPDAECKYGLYFRDGKRKVDYILVYHH---------KRASGSRTLARRGLQNDMVLGTRSVRQDQPLPGKGSPVDAGSPEVPMDYHEDDKRFRREEYEGNLLEAGLELENDEDTKIHGVGFVKIHAPWHVLCREAEFLKLKMPTKKVYHIS-ETRGLLKTINSVLQKITDPIQP-KVAEHRPQTTKRLSYPFSREKQHLFDL-TDRDSFFDSKTRSTI--------------------------VYEILKR---------------------TTC--------------TKAKYSMGITSLLANGVYSAAYPLHD----GDYEGDNVEFNDRKLLYEEWASYGVFYKYQPIDLVRKYFGEKVGLYFAWLGAYTQMLIPASIVGVIVFLYGCATVDENIPSMEMCDQRYNITMCPL--CDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEDHPRAEYEARVLEKSLRKESR---NKETDKVKLTWRDRFPAYFTNLVSIIFMIAVTFAIVLGVIIYRISTAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLTFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEE---CAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKFIRYLKLRR-----------QSPSDREEYVKRKQRYEVD------FNLEP-----FAG----------LTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAIRAKDIGIWYNILRGVGKLAVIINAFVISFTSDFIPRLVYLYMYSQNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSE--HKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREE--QGKQQ 971          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano1 (anoctamin 1, calcium activated chloride channel [Source:MGI Symbol;Acc:MGI:2142149])

HSP 1 Score: 414.461 bits (1064), Expect = 1.649e-126
Identity = 315/996 (31.63%), Postives = 502/996 (50.40%), Query Frame = 1
Query:  139 INDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEI--------QDDGC--KVYPFKENS------YYDNDS-VGSPSHRSNIV------------------FIKVFATWETLCRYAEVLKIR---KQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKP-IPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIY-QGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA----RPEFVA-LIDKNYPKKTNLISGKEEPFIPF-WRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQII-SHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ 2970
            ++ D +   G++F DG RK+D++LVY           KR +  ++L + GL+ ++        QD     K  P    S      Y+++D       +  N++                  F+K+ A W  LCR AE LK++   K++  +  E     KTI   L +  D +    + E +P   +  + P+S+ K++LFD+  D  +FF +  RS I                          V +IL R                     T C              +      GI  L++ GV+ +AY LH+     D + +NVE N+R LLY+ W S    ++ QP+D ++ YFGEKV  YFAWLG YT  L+P S++G+IV LY       +I   E+  Q  NITMCPL    + C +WK+S A +      L DN ATV  +V M++WA+ F+E WKR+Q++L Y W++   E E+E      R E+ A +++K+  K++     KE   +   WR R P  F    +++  IA+  A + G+I+Y++ + + + M+ S ++ +   +   AT  +++LV+I+ L  VY  +A WLT +E  +T+  ++  +T K +LL+F+N+Y+ IFY+ F +      P      FRS  M +   C  GGCL++L +QL+ IM+GKQ+I +++ E  +P++   ++  KL++           +  +DR E   + +   +D      + +EP     +A           L  EY+EM+IQFGF+T+F+ +FPLAPL AL NN+ EIR DA KF   LRRPVA R KDIGIW +I+  V  +AV  NA +I+F + +I +L+Y+  YS+NG ++GF + +LS  N S+F         L LG     CRY  +R PPW      Y  +  +W +LAA++ FV +F+NLV      +  VIPD+P  +   + +E  L  E+ ++ +  Q K Q
Sbjct:  100 VDPDAECKYGLYFRDGKRKVDYILVYHH---------KRASGSRTLARRGLQNDMVLGTRSVRQDQPLPGKGSPVDAGSPEVPMDYHEDDKRFRREEYEGNLLEAGLELENDEDTKIHGVGFVKIHAPWHVLCREAEFLKLKMPTKKVYHIS-ETRGLLKTINSVLQKITDPIQP-KVAEHRPQTTKRLSYPFSREKQHLFDL-TDRDSFFDSKTRSTI--------------------------VYEILKR---------------------TTC--------------TKAKYSMGITSLLANGVYSAAYPLHD----GDYEGDNVEFNDRKLLYEEWASYGVFYKYQPIDLVRKYFGEKVGLYFAWLGAYTQMLIPASIVGVIVFLYGCATVDENIPSMEMCDQRYNITMCPL--CDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLRKESR---NKETDKVKLTWRDRFPAYFTNLVSIIFMIAVTFAIVLGVIIYRISTAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLTFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEE---CAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKFIRYLKLRR-----------QSPSDREEYVKRKQRYEVD------FNLEP-----FAG----------LTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAIRAKDIGIWYNILRGVGKLAVIINAFVISFTSDFIPRLVYLYMYSQNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSE--HKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREE--QGKQQ 974          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano4 (anoctamin 4 [Source:MGI Symbol;Acc:MGI:2443344])

HSP 1 Score: 411.379 bits (1056), Expect = 2.698e-126
Identity = 319/993 (32.12%), Postives = 496/993 (49.95%), Query Frame = 1
Query:   91 TIMSNEDEILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIR----KQMLSLGFEYDFNRK-----TIFQRLFET----FDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERP-XXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIG-FIQPFT-QPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQ--AEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIY------IIGYSENG--FLNGFTDFSLSYMNSSEF---NATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSK 2982
            T  S +   L A    + +  K +NG++F DG  +ID++LVY + N       KR  F +++  EGL++E           KE+S  ++D          I+F+K+ A WE L RYAE + +R    +++  L   Y F  +     + F+R         D   + ++ E       +T P+S+ + + F I  +  TFF  A RS I                          V  IL R                                   E+  NK    G+ +L++ G +++A+ LHE    +++    +   N R+LLY+ W S    ++ QPLD ++ YFGEK+  YFAWLG+YT  L P + +G+ V LY +    +  V KE+ Q T+I MCP+    + C F +LSD+     +  L DNGATV  AV M++WA++FLE WKR++  +AY W++ D E E+E  RP+F A   K   ++ N ISGK EP+  F   +   +  + S +   I + +A + GI++Y++V+ S         I N S + T  T   ++  IIM L ++Y +VA+ LT++E  RT+S++++S TLK++L +F+N  SS FYI  F+  FT  P    R  +  +   C   GCL+DL +Q+  IM+ KQ  ++  E   P + +   R K++Q    E+ IN    E + +            L P            +  Y            LF EYLEM++QFGF TIF+ AFPLAPLLAL NN+ EIR DA KF    RRP+A R KDIGIW  I+  +  ++V +NA +IA  + +I +L+Y        G  E G   + G+ + SLS    S+F   +     G + + GT   YCRY  +R PP      PY YT  +W +LAA++ F+ +FE+LV+    +I+ +IPD+P  LR  M+RE  L  E++ +A+L +++ +   +
Sbjct:   50 TSTSEDTSRLEAGGETVRERNK-SNGLYFRDGKCRIDYILVYRKSNPQTE---KREVFERNIRAEGLQME-----------KESSLINSD----------IIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEE----NDCYTAPFSQQRIHHF-IIHNKDTFFNNATRSRI--------------------------VHHILQR--------------------------------IKYEEGKNK---IGLNRLLTNGSYEAAFPLHEGSYRSKNSIKTHGAVNHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHCQVSKEVCQATDIIMCPV--CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERMNPISGKPEPYQAF-TDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEHGTERKINFPQWEKDYN------------LQP------------MNAYG-----------LFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFS-GTPLKYCRYRDYRDPP--HSLAPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQKERKER 908          
BLAST of Anoctamin vs. Ensembl Mouse
Match: Ano4 (anoctamin 4 [Source:MGI Symbol;Acc:MGI:2443344])

HSP 1 Score: 411.379 bits (1056), Expect = 2.698e-126
Identity = 319/993 (32.12%), Postives = 496/993 (49.95%), Query Frame = 1
Query:   91 TIMSNEDEILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIR----KQMLSLGFEYDFNRK-----TIFQRLFET----FDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERP-XXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIG-FIQPFT-QPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQ--AEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIY------IIGYSENG--FLNGFTDFSLSYMNSSEF---NATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSK 2982
            T  S +   L A    + +  K +NG++F DG  +ID++LVY + N       KR  F +++  EGL++E           KE+S  ++D          I+F+K+ A WE L RYAE + +R    +++  L   Y F  +     + F+R         D   + ++ E       +T P+S+ + + F I  +  TFF  A RS I                          V  IL R                                   E+  NK    G+ +L++ G +++A+ LHE    +++    +   N R+LLY+ W S    ++ QPLD ++ YFGEK+  YFAWLG+YT  L P + +G+ V LY +    +  V KE+ Q T+I MCP+    + C F +LSD+     +  L DNGATV  AV M++WA++FLE WKR++  +AY W++ D E E+E  RP+F A   K   ++ N ISGK EP+  F   +   +  + S +   I + +A + GI++Y++V+ S         I N S + T  T   ++  IIM L ++Y +VA+ LT++E  RT+S++++S TLK++L +F+N  SS FYI  F+  FT  P    R  +  +   C   GCL+DL +Q+  IM+ KQ  ++  E   P + +   R K++Q    E+ IN    E + +            L P            +  Y            LF EYLEM++QFGF TIF+ AFPLAPLLAL NN+ EIR DA KF    RRP+A R KDIGIW  I+  +  ++V +NA +IA  + +I +L+Y        G  E G   + G+ + SLS    S+F   +     G + + GT   YCRY  +R PP      PY YT  +W +LAA++ F+ +FE+LV+    +I+ +IPD+P  LR  M+RE  L  E++ +A+L +++ +   +
Sbjct:   50 TSTSEDTSRLEAGGETVRERNK-SNGLYFRDGKCRIDYILVYRKSNPQTE---KREVFERNIRAEGLQME-----------KESSLINSD----------IIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEE----NDCYTAPFSQQRIHHF-IIHNKDTFFNNATRSRI--------------------------VHHILQR--------------------------------IKYEEGKNK---IGLNRLLTNGSYEAAFPLHEGSYRSKNSIKTHGAVNHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHCQVSKEVCQATDIIMCPV--CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERMNPISGKPEPYQAF-TDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEHGTERKINFPQWEKDYN------------LQP------------MNAYG-----------LFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFS-GTPLKYCRYRDYRDPP--HSLAPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQKERKER 908          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|Q8C5H1|ANO4_MOUSE (Anoctamin-4 OS=Mus musculus OX=10090 GN=Ano4 PE=1 SV=2)

HSP 1 Score: 411.764 bits (1057), Expect = 3.720e-125
Identity = 318/994 (31.99%), Postives = 497/994 (50.00%), Query Frame = 1
Query:   88 FTIMSNEDEILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIR----KQMLSLGFEYDFNRK-----TIFQRLFET----FDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERP-XXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIG-FIQPFT-QPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQ--AEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIY------IIGYSENG--FLNGFTDFSLSYMNSSEF---NATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSK 2982
             T  S +   L A    + +  K +NG++F DG  +ID++LVY + N       KR  F +++  EGL++E           KE+S  ++D          I+F+K+ A WE L RYAE + +R    +++  L   Y F  +     + F+R         D   + ++ E       +T P+S+ + + F I  +  TFF  A RS I                          V  IL R                                   E+  NK    G+ +L++ G +++A+ LHE    +++    +   N R+LLY+ W S    ++ QPLD ++ YFGEK+  YFAWLG+YT  L P + +G+ V LY +    +  V KE+ Q T+I MCP+    + C F +LSD+     +  L DNGATV  AV M++WA++FLE WKR++  +AY W++ D E E+E  RP+F A   K   ++ N ISGK EP+  F   +   +  + S +   I + +A + GI++Y++V+ S         I N S + T  T   ++  IIM L ++Y +VA+ LT++E  RT+S++++S TLK++L +F+N  SS FYI  F+  FT  P    R  +  +   C   GCL+DL +Q+  IM+ KQ  ++  E   P + +   R K++Q    E+ IN                       P+    + ++P  +  Y            LF EYLEM++QFGF TIF+ AFPLAPLLAL NN+ EIR DA KF    RRP+A R KDIGIW  I+  +  ++V +NA +IA  + +I +L+Y        G  E G   + G+ + SLS    S+F   +     G + + GT   YCRY  +R PP      PY YT  +W +LAA++ F+ +FE+LV+    +I+ +IPD+P  LR  M+RE  L  E++ +A+L +++ +   +
Sbjct:   84 LTSTSEDTSRLEAGGETVRERNK-SNGLYFRDGKCRIDYILVYRKSNPQTE---KREVFERNIRAEGLQME-----------KESSLINSD----------IIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEE----NDCYTAPFSQQRIHHF-IIHNKDTFFNNATRSRI--------------------------VHHILQR--------------------------------IKYEEGKNK---IGLNRLLTNGSYEAAFPLHEGSYRSKNSIKTHGAVNHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHCQVSKEVCQATDIIMCPV--CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERMNPISGKPEPYQAF-TDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEHGTERKINF----------------------PQWEKDYNLQP--MNAYG-----------LFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFS-GTPLKYCRYRDYRDPP--HSLAPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQKERKER 943          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|Q32M45|ANO4_HUMAN (Anoctamin-4 OS=Homo sapiens OX=9606 GN=ANO4 PE=2 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 4.124e-125
Identity = 317/992 (31.96%), Postives = 496/992 (50.00%), Query Frame = 1
Query:   88 FTIMSNEDEILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIR----KQMLSLGFEYDFNRK-----TIFQRLFET----FDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERP-XXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIG-FIQPFT-QPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIY------IIGYSENG--FLNGFTDFSLSYMNSSEF---NATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSK 2982
             T  S++   L A    + +  K +NG++F DG  +ID++LVY + N       KR  F +++  EGL++E           KE+S  ++D          I+F+K+ A WE L RYAE + +R    +++  L   Y F  +     + F+R         D   + ++ E       +T P+S+ + + F I  +  TFF  A RS I                          V  IL R                                   E+  NK    G+ +L++ G +++A+ LHE    +++    +   N R+LLY+ W S    ++ QPLD ++ YFGEK+  YFAWLG+YT  L P + +G+ V LY +    +  V KE+ Q T+I MCP+    + C F +LSD+     +  L DNGATV  AV M++WA++FLE WKR++  +AY W++ D E E+E  RP+F A   K   ++ N ISGK EP+  F   +   +  + S +   I + +A + GI++Y++V+ S         I N S + T  T   ++  IIM L ++Y +VA+ LT++E  RT+S++++S TLK++L +F+N  SS FYI  F+  FT  P    R  +  +   C   GCL+DL +Q+  IM+ KQ  ++  E   P + +   R K++Q        S  + E D                    + ++P  +  Y            LF EYLEM++QFGF TIF+ AFPLAPLLAL NN+ EIR DA KF    RRP+A R KDIGIW  I+  +  ++V +NA +IA  + +I +L+Y        G  E G   + G+ + SLS    S+F   +     G + + GT   YCRY  +R PP      PY YT  +W +LAA++ F+ +FE+LV+    +I+ +IPD+P  LR  M+RE  L  E++ +A+L +++ +   +
Sbjct:   84 LTSTSDDASRLEAGGETVPERNK-SNGLYFRDGKCRIDYILVYRKSNPQTE---KREVFERNIRAEGLQME-----------KESSLINSD----------IIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEEND----CYTAPFSQQRIHHF-IIHNKETFFNNATRSRI--------------------------VHHILQR--------------------------------IKYEEGKNK---IGLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAENHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVTTLDHSQVSKEVCQATDIIMCPV--CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERMNPISGKPEPYQAF-TDKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEHGPERKISFPQWEKD--------------------YNLQP--MNAYG-----------LFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFS-GTPLKYCRYRDYRDPP--HSLVPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQKERKER 943          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|A6QLE6|ANO4_BOVIN (Anoctamin-4 OS=Bos taurus OX=9913 GN=ANO4 PE=2 SV=1)

HSP 1 Score: 410.223 bits (1053), Expect = 4.584e-125
Identity = 317/991 (31.99%), Postives = 496/991 (50.05%), Query Frame = 1
Query:   91 TIMSNEDEILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIR----KQMLSLGFEYDFNRK-----TIFQRLFET----FDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERP-XXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIG-FIQPFT-QPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIY------IIGYSENG--FLNGFTDFSLSYMNSSEF---NATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSK 2982
            T  S++   L A    + +  K N G++F DG  +ID++LVY + N       KR  F +++  EGL++E           KE+S  ++D          I+F+K+ A WE L RYAE + +R    +++  L   Y F  +     + F+R         D   + ++ E       +T P+S+ + + F I  +  TFF  A RS I                          V  IL R                                   E+  NK    G+ +L++ G +++A+ LHE    +++    +   N R+LLY+ W S    ++ QPLD ++ YFGEK+  YFAWLG+YT  L P + +G+ V LY ++   +  V KE+ Q T+I MCP+    + C F +LSD+     +  L DNGATV  AV M++WA++FLE WKR++  +AY W++ D E E+E  RP+F A   K   ++ N ISGK EP+  F   +   +  + S +   I + +A + GI++Y++V+ S         I N S + T  T   ++  IIM L ++Y +VA+ LT++E  RT+S++++S TLK++L +F+N  SS FYI  F+  FT  P    R  +  +   C   GCL+DL +Q+  IM+ KQ  ++  E   P + +   R K++Q        S  + E D                    + ++P  +  Y            LF EYLEM++QFGF TIF+ AFPLAPLLAL NN+ EIR DA KF    RRP+A R KDIGIW  I+  +  ++V +NA +IA  + +I +L+Y        G  E G   + G+ + SLS    S+F   +     G + + GT   YCRY  +R PP      PY YT  +W +LAA++ F+ +FE+LV+    +I+ +IPD+P  LR  M+RE  L  E++ +A+L +++ +   +
Sbjct:   50 TSTSDDASRLEAGGETVPEKNKLN-GLYFRDGKCRIDYILVYRKSNPQME---KREVFERNIRAEGLQME-----------KESSLINSD----------IIFVKLHAPWEVLGRYAEQMNVRMPFRRKIYYLPRRYKFMSRIDKQISRFRRWLPKKPMRLDKETLPDLEEND----CYTAPFSQQRIHHFII-HNKDTFFNNATRSRI--------------------------VHHILQR--------------------------------IKYEEGKNK---IGLNRLLTNGSYEAAFPLHEGSYRSKNSIRTHGAVNHRHLLYECWASWGVWYKYQPLDLVRRYFGEKIGLYFAWLGWYTGMLFPAAFIGLFVFLYGVITLDHCQVSKEVCQATDIIMCPV--CDKYCPFMRLSDSCVYAKVTHLFDNGATVFFAVFMAVWATVFLEFWKRRRAVIAYDWDLIDWEEEEEEIRPQFEAKYSKK--ERMNPISGKPEPYQAF-ADKCSRLIVSASGIFFMICVVIAAVFGIVIYRVVTVSTFAAFKWALIRNNSQVATTGTAVCINFCIIMLLNVLYEKVALLLTNLEQPRTESEWENSFTLKMFLFQFVNLNSSTFYIAFFLGRFTGHPGAYLRLINRWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGYPLIQNWWTRRKVRQEHGPERKISFPQWEKD--------------------YNLQP--MNAYG-----------LFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRPLASRAKDIGIWYGILEGIGILSVITNAFVIAITSDFIPRLVYAYKYGPCAGQGEAGQKCMVGYVNASLSVFRISDFENRSEPESDGSEFS-GTPLKYCRYRDYRDPP--HSLVPYGYTLQFWHVLAARLAFIIVFEHLVFCIKHLISYLIPDLPKDLRDRMRREKYLIQEMMYEAELERLQKERKER 908          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|Q8BHY3|ANO1_MOUSE (Anoctamin-1 OS=Mus musculus OX=10090 GN=Ano1 PE=1 SV=2)

HSP 1 Score: 404.06 bits (1037), Expect = 2.504e-122
Identity = 291/878 (33.14%), Postives = 457/878 (52.05%), Query Frame = 1
Query:  388 NIVFIKVFATWETLCRYAEVLKIR---KQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKP-IPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIY-QGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA----RPEFVA-LIDKNYPKKTNLISGKEEPFIPF-WRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQII-SHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ 2970
             + F+K+ A W  LCR AE LK++   K++  +  E     KTI   L +  D +    + E +P   +  + P+S+ K++LFD+  D  +FF +  RS I                          V +IL R                     T C              +      GI  L++ GV+ +AY LH+     D + +NVE N+R LLY+ W S    ++ QP+D ++ YFGEKV  YFAWLG YT  L+P S++G+IV LY       +I   E+  Q  NITMCPL    + C +WK+S A +      L DN ATV  +V M++WA+ F+E WKR+Q++L Y W++   E E+E      R E+ A +++K+  K++     KE   +   WR R P  F    +++  IA+  A + G+I+Y++ + + + M+ S ++ +   +   AT  +++LV+I+ L  VY  +A WLT +E  +T+  ++  +T K +LL+F+N+Y+ IFY+ F +      P      FRS  M     C  GGCL++L +QL+ IM+GKQ+I +++ E  +P++   ++  KL++           +  +DR E   + +   +D      + +EP     +A           L  EY+EM+IQFGF+T+F+ +FPLAPL AL NN+ EIR DA KF   LRRPVA R KDIGIW +I+  V  +AV  NA +I+F + +I +L+Y+  YS+NG ++GF + +LS  N S+F         L LG     CRY  +R PPW      Y  +  +W +LAA++ FV +F+NLV      +  VIPD+P  +   + +E  L  E+ ++ +  Q K Q
Sbjct:  152 GVGFVKIHAPWHVLCREAEFLKLKMPTKKVYHIS-ETRGLLKTINSVLQKITDPIQP-KVAEHRPQTTKRLSYPFSREKQHLFDL-TDRDSFFDSKTRSTI--------------------------VYEILKR---------------------TTC--------------TKAKYSMGITSLLANGVYSAAYPLHD----GDYEGDNVEFNDRKLLYEEWASYGVFYKYQPIDLVRKYFGEKVGLYFAWLGAYTQMLIPASIVGVIVFLYGCATVDENIPSMEMCDQRYNITMCPL--CDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLRKESR---NKETDKVKLTWRDRFPAYFTNLVSIIFMIAVTFAIVLGVIIYRISTAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLTFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRM---EECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKFIRYLKLRR-----------QSPSDREEYVKRKQRYEVD------FNLEP-----FAG----------LTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAIRAKDIGIWYNILRGVGKLAVIINAFVISFTSDFIPRLVYLYMYSQNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSE--HKYDISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREE--QGKQQ 917          
BLAST of Anoctamin vs. UniProt/SwissProt
Match: sp|Q5XXA6|ANO1_HUMAN (Anoctamin-1 OS=Homo sapiens OX=9606 GN=ANO1 PE=1 SV=1)

HSP 1 Score: 390.578 bits (1002), Expect = 4.240e-117
Identity = 291/937 (31.06%), Postives = 462/937 (49.31%), Query Frame = 1
Query:  388 NIVFIKVFATWETLCRYAEVLKIR---KQMLSLGFEYDFNRK--TIFQRLFETFDFLNIFNINELKP-IPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIY-QGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA----RPEFVA-LIDKNYPKKTNLISGKEEPFIP--------------------------FWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQII-SHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPW-ETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMK-----------------NQHTSKLVADSFKKSA 3012
             + F+K+ A W  LCR AE LK++   K+M  +       +K  ++ Q++ +         + E +P   +  + P+S+ K++LFD+  D  +FF +  RS I                          V +IL R                     T C              +      GI  L++ GV+ +AY LH+     D + ENVE N+R LLY+ W      ++ QP+D ++ YFGEK+  YFAWLG YT  L+P S++GIIV LY       +I   E+  Q  NITMCPL    + C +WK+S A +      L DN ATV  +V M++WA+ F+E WKR+Q++L Y W++   E E+E      R E+ A +++K+  K++   + ++   IP                           WR R P       +++  IA+  A + G+I+Y++   + + M+ S ++ +   +   AT  +++LV+I+ L  VY  +A WLT +E  +T+  ++  +  K +LL+F+N+Y+ IFY+ F +      P      FRS  M     C  GGCL++L +QL+ IM+GKQ+I +++ E  +P++   ++  KLKQ           +   D  E   + +   +D      + +EP     +A           L  EY+EM+IQFGF+T+F+ +FPLAPL AL NN+ EIR DA KF   LRRPVA R KDIGIW +I+  +  +AV  NA +I+F + +I +L+Y+  YS+NG ++GF + +LS  N S+F         L LG     CRY  +R PPW E KY+    +  +W +LAA++ FV +F+NLV      +  VIPD+P  +   + +E  L  E+ ++ +  + +                 N H +K   DS    A
Sbjct:  152 GVGFVKIHAPWNVLCREAEFLKLKMPTKKMYHINETRGLLKKINSVLQKITDPIQP----KVAEHRPQTMKRLSYPFSREKQHLFDL-SDKDSFFDSKTRSTI--------------------------VYEILKR---------------------TTC--------------TKAKYSMGITSLLANGVYAAAYPLHD----GDYNGENVEFNDRKLLYEEWARYGVFYKYQPIDLVRKYFGEKIGLYFAWLGVYTQMLIPASIVGIIVFLYGCATMDENIPSMEMCDQRHNITMCPL--CDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQMRLNYRWDLTGFEEEEEAVKDHPRAEYEARVLEKSLKKESR--NKEKRRHIPEESTNKWKQRVKTAMAGVKLTDKVKLTWRDRFPAYLTNLVSIIFMIAVTFAIVLGVIIYRISMAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLDEVYGCIARWLTKIEVPKTEKSFEERLIFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRM---EECAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKLIRYLKLKQ-----------QSPPDHEECVKRKQRYEVD------YNLEP-----FAG----------LTPEYMEMIIQFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAVRAKDIGIWYNILRGIGKLAVIINAFVISFTSDFIPRLVYLYMYSKNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKYD---ISKDFWAVLAARLAFVIVFQNLVMFMSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPA 976          
BLAST of Anoctamin vs. TrEMBL
Match: A0A5K4FF50 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 682.945 bits (1761), Expect = 0.000e+0
Identity = 380/885 (42.94%), Postives = 556/885 (62.82%), Query Frame = 1
Query:  388 NIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNI--NELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ-GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATI-LDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSKLVAD-SFKKSAVIAKK 3027
            N+VF+K+ A+WE +  YAE LK+RK +  L + +     T    +F+  DFL    +  N +KPI   +T P+S +++YLFDIPE+   FFTA ER+L++++ILRR  Y+   D    E +    + DI++         + DEN            + S ++  +L  ++ K  + GI KLIS+G+F +AY LHE P           N      Y  W S + +F+ QP+ +I+ YFGE VAFYFAWLG+YT WLLPI++LGIIV L+ ++   +D ++ E+   G NI MCPL C S  C+FW L  +  R  L+RL+D+  TVL AVVMS+WA +F EMWKR+QV LAY WNV+ +E  D+P RPEF+AL+ K  P+K N ++G  EPFIPFWRR++P++  ++STVLL++ + LAFL G++LYKLV   ++  HH+  + + + +I   TGSL++LV I  L LVY R+A  LTD+EHHRTQ +YD+S+TLKLYLL+F+N YSSIFYI FIQ  T  +P      +I+  GC  G CL +L +QL  IM+GKQI S I+E  +P L     +++   + ++  N +D     + +     +  T  L P    +  +    I C AD  + DPG RPLF EYLEM+IQ+GFIT+F+PAFPLAPL  L NNLFEIR DA K     RRPV +RV+ IGIW+SI++++A+IA+++NA +IAF T +ID+ +Y   YS +G + GF +F+LSYM+++ F+          + TNETYCRY  +R PPW +  EPY +T +Y+ +LAAK +FV+ FE +  +   +I   +PDVP ++R  +  E+ +TN IIL A++     Q+ + +  D +F+K  ++ ++
Sbjct:  151 NLVFVKLHASWEAMTYYAEYLKMRKPLRQLAYGWKLVNPTPKTSVFK--DFLKCLRMDKNIIKPIDTCYTWPFSMNRQYLFDIPENKDEFFTAVERALVLDHILRRTGYKS-EDLVNTEDLYEPSISDIVTSH------DLADEN------------SGSSNQANSLYVMATK--NLGITKLISDGIFSAAYPLHE-PAGSTLAPTEFNNRILLQRY--WASYKMLFKCQPISYIRYYFGEAVAFYFAWLGFYTAWLLPIAILGIIVFLFGLLDLKSDSIIHEVCDLGQNIYMCPL-CKSSKCKFWTLDTSCLRTKLMRLVDHEGTVLFAVVMSLWAVIFFEMWKRKQVSLAYRWNVYSLEPMDQPPRPEFMALLSKRCPRKVNSLTGYVEPFIPFWRRKVPIILVSFSTVLLTVILTLAFLVGVVLYKLVIKVILYRHHNPIVQSTAGMIATMTGSLVNLVTIFFLKLVYDRMATKLTDIEHHRTQVEYDNSLTLKLYLLQFVNYYSSIFYIAFIQGPTSAVPG-SEHILIQSTGCDQGDCLFELFIQLVIIMVGKQIFSFIQESLMPVLWKLFFKFR---SMKRSSNYADHNHNMNSINFNESNPVTTSLLPAKYSS--LSGRNILCRADFNMLDPGSRPLFNEYLEMMIQYGFITMFVPAFPLAPLFGLLNNLFEIRGDAKKLVNQYRRPVLERVQTIGIWLSIITVLASIAIRTNACIIAFTTQFIDRCVYRYTYSPDGTMKGFVNFTLSYMSTTRFD----------VPTNETYCRYDSYRSPPWSS--EPYVFTSIYYHVLAAKFIFVFTFETIATILTNVIMAAVPDVPKRVRRKIFHESNITNAIILNAEV--GNQQYNNAITKDVNFQKIVLLKQQ 988          
BLAST of Anoctamin vs. TrEMBL
Match: A0A5K4FDS2 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 380/904 (42.04%), Postives = 561/904 (62.06%), Query Frame = 1
Query:  388 NIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNI--NELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXY-------------------KHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ-GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATI-LDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSKLVAD-SFKKSAVIAKK 3027
            N+VF+K+ A+WE +  YAE LK+RK +  L + +     T    +F+  DFL    +  N +KPI   +T P+S +++YLFDIPE+   FFTA ER+L++++ILRR  Y+   D    E +    + DI++         + DEN            + S ++  +L  ++ K  + GI KLIS+G+F +AY LHE P  +   +   +N      Y                   ++W S + +F+ QP+ +I+ YFGE VAFYFAWLG+YT WLLPI++LGIIV L+ ++   +D ++ E+   G NI MCPL C S  C+FW L  +  R  L+RL+D+  TVL AVVMS+WA +F EMWKR+QV LAY WNV+ +E  D+P RPEF+AL+ K  P+K N ++G  EPFIPFWRR++P++  ++STVLL++ + LAFL G++LYKLV   ++  HH+  + + + +I   TGSL++LV I  L LVY R+A  LTD+EHHRTQ +YD+S+TLKLYLL+F+N YSSIFYI FIQ  T  +P      +I+  GC  G CL +L +QL  IM+GKQI S I+E  +P L     +++   + ++  N +D     + +     +  T  L P    +  +    I C AD  + DPG RPLF EYLEM+IQ+GFIT+F+PAFPLAPL  L NNLFEIR DA K     RRPV +RV+ IGIW+SI++++A+IA+++NA +IAF T +ID+ +Y   YS +G + GF +F+LSYM+++ F+          + TNETYCRY  +R PPW +  EPY +T +Y+ +LAAK +FV+ FE +  +   +I   +PDVP ++R  +  E+ +TN IIL A++     Q+ + +  D +F+K  ++ ++
Sbjct:  151 NLVFVKLHASWEAMTYYAEYLKMRKPLRQLAYGWKLVNPTPKTSVFK--DFLKCLRMDKNIIKPIDTCYTWPFSMNRQYLFDIPENKDEFFTAVERALVLDHILRRTGYKS-EDLVNTEDLYEPSISDIVTSH------DLADEN------------SGSSNQANSLYVMATK--NLGITKLISDGIFSAAYPLHE-PTKKLSLITLQQNIITPSCYGPAGSTLAPTEFNNRILLQRYWASYKMLFKCQPISYIRYYFGEAVAFYFAWLGFYTAWLLPIAILGIIVFLFGLLDLKSDSIIHEVCDLGQNIYMCPL-CKSSKCKFWTLDTSCLRTKLMRLVDHEGTVLFAVVMSLWAVIFFEMWKRKQVSLAYRWNVYSLEPMDQPPRPEFMALLSKRCPRKVNSLTGYVEPFIPFWRRKVPIILVSFSTVLLTVILTLAFLVGVVLYKLVIKVILYRHHNPIVQSTAGMIATMTGSLVNLVTIFFLKLVYDRMATKLTDIEHHRTQVEYDNSLTLKLYLLQFVNYYSSIFYIAFIQGPTSAVPG-SEHILIQSTGCDQGDCLFELFIQLVIIMVGKQIFSFIQESLMPVLWKLFFKFR---SMKRSSNYADHNHNMNSINFNESNPVTTSLLPAKYSS--LSGRNILCRADFNMLDPGSRPLFNEYLEMMIQYGFITMFVPAFPLAPLFGLLNNLFEIRGDAKKLVNQYRRPVLERVQTIGIWLSIITVLASIAIRTNACIIAFTTQFIDRCVYRYTYSPDGTMKGFVNFTLSYMSTTRFD----------VPTNETYCRYDSYRSPPWSS--EPYVFTSIYYHVLAAKFIFVFTFETIATILTNVIMAAVPDVPKRVRRKIFHESNITNAIILNAEV--GNQQYNNAITKDVNFQKIVLLKQQ 1009          
BLAST of Anoctamin vs. TrEMBL
Match: A0A5K4FBC0 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 671.389 bits (1731), Expect = 0.000e+0
Identity = 379/904 (41.92%), Postives = 560/904 (61.95%), Query Frame = 1
Query:  388 NIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNI--NELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXY-------------------KHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ-GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATI-LDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSKLVAD-SFKKSAVIAKK 3027
            N+VF+K+ A+WE +  YAE LK+RK +  L       + ++F+      DFL    +  N +KPI   +T P+S +++YLFDIPE+   FFTA ER+L++++ILRR  Y+   D    E +    + DI++         + DEN            + S ++  +L  ++ K  + GI KLIS+G+F +AY LHE P  +   +   +N      Y                   ++W S + +F+ QP+ +I+ YFGE VAFYFAWLG+YT WLLPI++LGIIV L+ ++   +D ++ E+   G NI MCPL C S  C+FW L  +  R  L+RL+D+  TVL AVVMS+WA +F EMWKR+QV LAY WNV+ +E  D+P RPEF+AL+ K  P+K N ++G  EPFIPFWRR++P++  ++STVLL++ + LAFL G++LYKLV   ++  HH+  + + + +I   TGSL++LV I  L LVY R+A  LTD+EHHRTQ +YD+S+TLKLYLL+F+N YSSIFYI FIQ  T  +P      +I+  GC  G CL +L +QL  IM+GKQI S I+E  +P L     +++   + ++  N +D     + +     +  T  L P    +  +    I C AD  + DPG RPLF EYLEM+IQ+GFIT+F+PAFPLAPL  L NNLFEIR DA K     RRPV +RV+ IGIW+SI++++A+IA+++NA +IAF T +ID+ +Y   YS +G + GF +F+LSYM+++ F+          + TNETYCRY  +R PPW +  EPY +T +Y+ +LAAK +FV+ FE +  +   +I   +PDVP ++R  +  E+ +TN IIL A++     Q+ + +  D +F+K  ++ ++
Sbjct:  151 NLVFVKLHASWEAMTYYAEYLKMRKPLRQLVNPTP--KTSVFK------DFLKCLRMDKNIIKPIDTCYTWPFSMNRQYLFDIPENKDEFFTAVERALVLDHILRRTGYKS-EDLVNTEDLYEPSISDIVTSH------DLADEN------------SGSSNQANSLYVMATK--NLGITKLISDGIFSAAYPLHE-PTKKLSLITLQQNIITPSCYGPAGSTLAPTEFNNRILLQRYWASYKMLFKCQPISYIRYYFGEAVAFYFAWLGFYTAWLLPIAILGIIVFLFGLLDLKSDSIIHEVCDLGQNIYMCPL-CKSSKCKFWTLDTSCLRTKLMRLVDHEGTVLFAVVMSLWAVIFFEMWKRKQVSLAYRWNVYSLEPMDQPPRPEFMALLSKRCPRKVNSLTGYVEPFIPFWRRKVPIILVSFSTVLLTVILTLAFLVGVVLYKLVIKVILYRHHNPIVQSTAGMIATMTGSLVNLVTIFFLKLVYDRMATKLTDIEHHRTQVEYDNSLTLKLYLLQFVNYYSSIFYIAFIQGPTSAVPG-SEHILIQSTGCDQGDCLFELFIQLVIIMVGKQIFSFIQESLMPVLWKLFFKFR---SMKRSSNYADHNHNMNSINFNESNPVTTSLLPAKYSS--LSGRNILCRADFNMLDPGSRPLFNEYLEMMIQYGFITMFVPAFPLAPLFGLLNNLFEIRGDAKKLVNQYRRPVLERVQTIGIWLSIITVLASIAIRTNACIIAFTTQFIDRCVYRYTYSPDGTMKGFVNFTLSYMSTTRFD----------VPTNETYCRYDSYRSPPWSS--EPYVFTSIYYHVLAAKFIFVFTFETIATILTNVIMAAVPDVPKRVRRKIFHESNITNAIILNAEV--GNQQYNNAITKDVNFQKIVLLKQQ 1003          
BLAST of Anoctamin vs. TrEMBL
Match: U6JHY6 (Anoctamin OS=Echinococcus granulosus OX=6210 GN=EGR_10154 PE=3 SV=1)

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 401/994 (40.34%), Postives = 572/994 (57.55%), Query Frame = 1
Query:  169 MFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQD--------DGCKVYPFKENSYYDNDSVGSPSHRSN--------------------------IVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTI-FQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILH---------------ERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIY-QGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDK-NYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRL-----VSTVKRYKLKQA---EEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ 2970
            MFF D  R+IDFVLVY+    +  ++ KR  FL +L ++ +EIE+++         G +   FK+ + +  DS+G PS  ++                          +VF+K+ A+W T+ R AEVL+ RK +     E    R+T    + FE  D  +IF +      P  +  P+S+++  LFDIPED   FF   ERSL+V+Y+L+R      +      PV             D     +T+E        D   +  +  +PF ++   +  VD GI  LI++ VF +A+ LH               E   +     E  E N R LL   W S++N+ + QPLD+++LYFGE +AFYFAWLG YTYWL+P+ + G++V   + +  S+D +V ++  +G+   MCP  CS RGC+FW L+ +     +  L+DN +TVL A+ MSIWA+LF+E WKR Q  L + WNV  +E  DEP RPEF+AL+ K  Y    NLI+G+EEP IPFW R++P    ++S+V+L + + LA L G+I Y+L+  +L+  H +  IS+M+ IIT  T S ++LV I  L LVY ++AV LTDME+HRTQS+YD S+TLKLYLL+F+N YSSIFYI FIQ  T  +P  RS   I+  GC  G CL  L +QLA IM+GKQ ++ + E  LP +     V    R  ++      EK+       ME+  +E   K   T  D +        P L  C A+  L D G RPLF EYLEMLIQ+GFIT+F+PAFP+APL AL NN+FE+R+DA KF R LRRPV +R   IGIW  I++ ++ +A+++NA LIAF + Y+ ++ YI+ YS N  L G+ DF+LSYMN+S F+ T        L  N TYCRY  FR PP  T  +PY+YTPVYW +LA K  FV++FEN+     A+IA  IPD+P  L I  + EA + NE++L+ + ++ K +
Sbjct:   45 MFFRDRKRRIDFVLVYKAEETDTVSKSKRFAFLSALAEQMIEIEVENCQGEILAKTGPQKPGFKDEAGFLLDSMGQPSSDADAVRGYAQTGDQEDRNPLETAILANDDLVFVKLHASWSTMIRVAEVLQFRKPLKQAKVERLEMRETAKCSKCFE-LDPKSIFKL------PSPYRAPFSRTRMNLFDIPEDYDNFFNPTERSLVVDYVLKRTGTCECTGPGTCPPVKGGD---------DASPHYVTEE--------DVEYERKTRARPFDVKLAEHGKVDLGIDHLINDKVFIAAFPLHDPSEELMNLLKQKEGEVAGSSRPKTEQTEVNMRTLLNDQWGSLKNMIKFQPLDYVRLYFGESIAFYFAWLGLYTYWLIPVGIFGLLVFCLSAIDISDDRIVDDVCNRGSEFVMCP-TCSQRGCKFWLLNASCLATKMTHLVDNISTVLFAIFMSIWATLFMENWKRYQNVLGHRWNVQHLEPVDEPPRPEFLALLKKRGYKTTVNLITGREEPSIPFWSRKLPCTVLSFSSVILGMVLCLAALIGVIFYRLIVNTLLLQHENVFISSMAGIITTVTSSCINLVCIFILKLVYDKIAVKLTDMENHRTQSEYDDSLTLKLYLLQFVNFYSSIFYIAFIQGTTAGLPGDRSIP-IRSSGCDNGNCLFQLFIQLAIIMVGKQFLNFVTENTLPPIKRCLVVYFAHRRSMRDRGALAEKVSGAQYGSMESGALE---KTPLTSGDGR--------PILYNCRANFTLLDGGSRPLFEEYLEMLIQYGFITMFVPAFPVAPLFALLNNMFELRTDAKKFLRLLRRPVRKRENGIGIWFGILTAISALAIRTNACLIAFTSEYLVRMTYILYYSPNRTLEGYLDFTLSYMNASRFDLT---PKDEVLLKNSTYCRYRDFREPP--TAPDPYAYTPVYWHVLAVKFAFVFIFENVALALTALIARCIPDMPQNLTIISRHEARVVNELLLQNEEIEDKEK 996          
BLAST of Anoctamin vs. TrEMBL
Match: A0A087W085 (Anoctamin OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000175600 PE=3 SV=1)

HSP 1 Score: 657.522 bits (1695), Expect = 0.000e+0
Identity = 399/994 (40.14%), Postives = 572/994 (57.55%), Query Frame = 1
Query:  169 MFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQD--------DGCKVYPFKENSYYDNDSVGSPSHRSN--------------------------IVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTI-FQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILH---------------ERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIY-QGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDK-NYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRL-----VSTVKRYKLKQA---EEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ 2970
            MFF D  R+IDFVLVY+    +  ++ KR  FL +L ++ +EIE+++         G +   FK+ + +  DS+G PS  ++                          +VF+K+ A+W T+ R AEVL+ RK +     E    R+T    + FE  D  +IF +      P  +  P+S+++  LFDIPED   FF   ERSL+V+Y+L+R      +      P+             D     +T+E        D   +  +  +PF ++   +  VD GI  LI++ +F +A+ LH               E   +     E  E N R LL   W S++N+ + QPLD+++LYFGE +AFYFAWLG YTYWL+P+ + G++V   + +  S+D +V ++  +G+   MCP  CS RGC+FW L+ +     +  L+DN +TVL A+ MSIWA+LF+E WKR Q  L + WNV  +E  DEP RPEF+AL+ K  Y    NLI+G+EEP IPFW R++P    ++S+V+L + + LA L G+I Y+L+  +L+  H +  IS+M+ IIT  T S ++LV I  L LVY ++AV LTDME+HRTQS+YD S+TLKLYLL+F+N YSSIFYI FIQ  T  +P  RS   I+  GC  G CL  L +QLA IM+GKQ ++ + E  LP +     V    R  ++      EK+       ME+  +E   K   T  D +        P L  C A+  L D G RPLF EYLEMLIQ+GFIT+F+PAFP+APL AL NN+FE+R+DA KF R LRRPV +R   IGIW  I++ ++ +A+++NA LIAF + Y+ ++ YI+ YS N  L G+ DF+LSYMN+S F+ T        L  N TYCRY  FR PP  T  +PY+YTPVYW +LA K  FV++FEN+     A+IA  IPD+P  L I  + EA + NE++L+ + ++ K +
Sbjct:   45 MFFRDRKRRIDFVLVYKAEETDIVSKSKRFAFLSALAEQMIEIEVENCQGEILAKTGPQKPGFKDEAGFLLDSMGQPSSDADAVRGYAQTGDQEDRNPLETAILANDDLVFVKLHASWSTMIRVAEVLQFRKPLKQAKVERLEMRETAKCSKCFE-LDPKSIFKL------PSPYRAPFSRTRMNLFDIPEDYDNFFNPTERSLVVDYVLKRTGTCECTALGTCPPIKGGD---------DASPHYVTEE--------DVEYERKTRARPFDVKLAEHGKVDLGIDHLINDKIFIAAFPLHDPSEELMNLLKQKEGEVAGSSRPKTEQTEVNMRTLLNDQWGSLKNMIKFQPLDYVRLYFGESIAFYFAWLGLYTYWLIPVGIFGLLVFCLSAIDISDDRIVDDVCNRGSEFVMCP-TCSQRGCKFWLLNASCLATKMTHLVDNISTVLFAIFMSIWATLFMENWKRYQNVLGHRWNVQHLEPVDEPPRPEFLALLKKRGYKTTVNLITGREEPSIPFWSRKLPCTVLSFSSVILGMVLCLAALIGVIFYRLIVNTLLLQHENVFISSMAGIITTVTSSCINLVCIFILKLVYDKIAVKLTDMENHRTQSEYDDSLTLKLYLLQFVNFYSSIFYIAFIQGTTASLPGDRSIP-IRSSGCDNGNCLFQLFIQLAIIMVGKQFLNFVTENTLPPIKRCLVVYFAHRRSMRDRGALAEKVSGAQYGSMESGALE---KTPLTSGDGR--------PTLYNCRANFTLLDGGSRPLFEEYLEMLIQYGFITMFVPAFPVAPLFALLNNMFELRTDAKKFLRLLRRPVRKRENGIGIWFGILTAISALAIRTNACLIAFTSEYLVRMTYILYYSPNRTLEGYLDFTLSYMNASRFDLT---PKDELLLKNSTYCRYRDFREPP--TAPDPYAYTPVYWHVLAVKFAFVFIFENVALALTALIARCIPDMPQNLTIISRHEARVVNELLLQNEEIEDKEK 996          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:103044829])

HSP 1 Score: 415.231 bits (1066), Expect = 6.199e-128
Identity = 309/979 (31.56%), Postives = 483/979 (49.34%), Query Frame = 1
Query:  115 ILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYD---FNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ---GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA--RPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSF----SLMRMHHSRTISNMSSIIT-----AATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFL--NGFTDFSLSYMNSSEFNA--TLYGGHKLTLGTNE--TYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ 2970
            +   D+  ++   +  + ++F DG R+IDFVL Y    ++R  Q +R  + +++ K GLE+E++D                    + S      F+K+ A WE L  YA+VLKI+     + F+ +    NR+     LF       +   + ++P P  FT+P+ KSK+  F I +D  T F  + R+ IV YIL R  Y R                                ++N+N+            DK              GI +L++ G + SA+ LH+         +    +ER  LY++W      ++ QPL+ I+ Y+GEK+  YFAWLG+YT  L   +L+G+I  +Y      + I  KEI     G  I MCPL    + C FWKL+   +  +   L DN ATV  A+ M IW +LFLE WKR+Q +L Y W++ D E E +    RPE+     K   ++ N ++ + EP+ P    +      + +TVL  I++ +A + G+I Y+L  F    S+M+   +  +  + S+IT     + T S ++ VIIM L   Y RVA+W+TDME  +T  +Y++ +T+K++L +F+N YSS FY+ F +      P       + S ++   C  GGCL++L+ QL  +M GKQ+  +I+E  LP L +     K +   E L +                                     R   D  L +     LF EYLEM+IQFGFIT+F+ +FPLAPLLAL NN+ E+R DA K     RRPVA +   IG W  I++M+A  +V +NA ++AF +  I +L+Y+  Y     L   G+ + SLS  N S+ ++  T   G       N   T CRY  +R+PP   +YE YS+T  +W ILAAK+ F+ + E++V++   ++A +IPDVP  ++  +KRE  L  E +   ++ ++K Q
Sbjct:   38 VFQLDDATVDKQHQSKDSVYFRDGKRRIDFVLSYIEDKEDR-KQERRKLYEENMQKAGLELELEDK-------------------TESEDGKTYFLKIHAPWEVLATYADVLKIK-----VPFKVNDIPENREIPVSWLFTPL----LLPDHVMRPDPDYFTSPFDKSKDDFFLI-DDKETLFPPSTRNRIVYYILSRCFYNR--------------------------------DDNINK------------DKR-------------GIKRLLNNGTYTSAFPLHD-CRYWTKSRDTHCESERYSLYRYWARFFRFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLFYAALVGLICFIYGAATYDDVIWTKEICDDDIGGQIVMCPL--CDKKCGFWKLNSTCNSTWQSHLFDNTATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYET---KCTSRRRNKVTQEMEPYFPV-TSKCARACLSGATVLFWISLIIASIIGVIAYRLAVFAALASVMKDSPTNKMELVGSLITPQLATSVTASCINFVIIMILNFFYERVAIWITDMEVPKTHLEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGKYTYMFNGSGLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALLPWLKNWWSSRKARSHPESLYS-------------------------------------RWEQDYDLQNFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKLTTQFRRPVAAKAHSIGAWDEILNMIAVFSVVTNAFIVAFTSDMIPRLVYLYAYHPGTELTMQGYVNNSLSIFNISQLHSDNTPDPGENPAWFNNSVITTCRYRDYRYPP-GHEYE-YSHTMQFWHILAAKMAFIIIMEHVVFVVKFLVAWLIPDVPSDVQARVKRERYLVQEYLHNYEVDKLKKQ 883          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:103044829])

HSP 1 Score: 413.305 bits (1061), Expect = 1.561e-127
Identity = 306/972 (31.48%), Postives = 483/972 (49.69%), Query Frame = 1
Query:  136 DINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYD---FNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ---GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA--RPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSF----SLMRMHHSRTISNMSSIIT-----AATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFL--NGFTDFSLSYMNSSEFNA--TLYGGHKLTLGTNE--TYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ 2970
            +++   +  + ++F DG R+IDFVL Y    ++R  Q +R  + +++ K GLE+E++D                    + S      F+K+ A WE L  YA+VLKI+     + F+ +    NR+     LF       +   + ++P P  FT+P+ KSK+  F I +D  T F  + R+ IV YIL R  Y R                                ++N+N+            DK              GI +L++ G + SA+ LH+         +    +ER  LY++W      ++ QPL+ I+ Y+GEK+  YFAWLG+YT  L   +L+G+I  +Y      + I  KEI     G  I MCPL    + C FWKL+   +  +   L DN ATV  A+ M IW +LFLE WKR+Q +L Y W++ D E E +    RPE+     K   ++ N ++ + EP+ P    +      + +TVL  I++ +A + G+I Y+L  F    S+M+   +  +  + S+IT     + T S ++ VIIM L   Y RVA+W+TDME  +T  +Y++ +T+K++L +F+N YSS FY+ F +      P       + S ++   C  GGCL++L+ QL  +M GKQ+  +I+E  LP L +     K +   E L ++ + + +                                     L +     LF EYLEM+IQFGFIT+F+ +FPLAPLLAL NN+ E+R DA K     RRPVA +   IG W  I++M+A  +V +NA ++AF +  I +L+Y+  Y     L   G+ + SLS  N S+ ++  T   G       N   T CRY  +R+PP   +YE YS+T  +W ILAAK+ F+ + E++V++   ++A +IPDVP  ++  +KRE  L  E +   ++ ++K Q
Sbjct:   16 EVDKQHQSKDSVYFRDGKRRIDFVLSYIEDKEDR-KQERRKLYEENMQKAGLELELEDK-------------------TESEDGKTYFLKIHAPWEVLATYADVLKIK-----VPFKVNDIPENREIPVSWLFTPL----LLPDHVMRPDPDYFTSPFDKSKDDFFLI-DDKETLFPPSTRNRIVYYILSRCFYNR--------------------------------DDNINK------------DKR-------------GIKRLLNNGTYTSAFPLHD-CRYWTKSRDTHCESERYSLYRYWARFFRFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLFYAALVGLICFIYGAATYDDVIWTKEICDDDIGGQIVMCPL--CDKKCGFWKLNSTCNSTWQSHLFDNTATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYET---KCTSRRRNKVTQEMEPYFPV-TSKCARACLSGATVLFWISLIIASIIGVIAYRLAVFAALASVMKDSPTNKMELVGSLITPQLATSVTASCINFVIIMILNFFYERVAIWITDMEVPKTHLEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGKYTYMFNGSGLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALLPWLKNWWSSRKARSHPESLYSRWEQDYD-------------------------------------LQNFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKLTTQFRRPVAAKAHSIGAWDEILNMIAVFSVVTNAFIVAFTSDMIPRLVYLYAYHPGTELTMQGYVNNSLSIFNISQLHSDNTPDPGENPAWFNNSVITTCRYRDYRYPP-GHEYE-YSHTMQFWHILAAKMAFIIIMEHVVFVVKFLVAWLIPDVPSDVQARVKRERYLVQEYLHNYEVDKLKKQ 854          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:103044829])

HSP 1 Score: 413.305 bits (1061), Expect = 1.714e-127
Identity = 306/972 (31.48%), Postives = 483/972 (49.69%), Query Frame = 1
Query:  136 DINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYD---FNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ---GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA--RPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSF----SLMRMHHSRTISNMSSIIT-----AATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFL--NGFTDFSLSYMNSSEFNA--TLYGGHKLTLGTNE--TYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ 2970
            +++   +  + ++F DG R+IDFVL Y    ++R  Q +R  + +++ K GLE+E++D                    + S      F+K+ A WE L  YA+VLKI+     + F+ +    NR+     LF       +   + ++P P  FT+P+ KSK+  F I +D  T F  + R+ IV YIL R  Y R                                ++N+N+            DK              GI +L++ G + SA+ LH+         +    +ER  LY++W      ++ QPL+ I+ Y+GEK+  YFAWLG+YT  L   +L+G+I  +Y      + I  KEI     G  I MCPL    + C FWKL+   +  +   L DN ATV  A+ M IW +LFLE WKR+Q +L Y W++ D E E +    RPE+     K   ++ N ++ + EP+ P    +      + +TVL  I++ +A + G+I Y+L  F    S+M+   +  +  + S+IT     + T S ++ VIIM L   Y RVA+W+TDME  +T  +Y++ +T+K++L +F+N YSS FY+ F +      P       + S ++   C  GGCL++L+ QL  +M GKQ+  +I+E  LP L +     K +   E L ++ + + +                                     L +     LF EYLEM+IQFGFIT+F+ +FPLAPLLAL NN+ E+R DA K     RRPVA +   IG W  I++M+A  +V +NA ++AF +  I +L+Y+  Y     L   G+ + SLS  N S+ ++  T   G       N   T CRY  +R+PP   +YE YS+T  +W ILAAK+ F+ + E++V++   ++A +IPDVP  ++  +KRE  L  E +   ++ ++K Q
Sbjct:   11 EVDKQHQSKDSVYFRDGKRRIDFVLSYIEDKEDR-KQERRKLYEENMQKAGLELELEDK-------------------TESEDGKTYFLKIHAPWEVLATYADVLKIK-----VPFKVNDIPENREIPVSWLFTPL----LLPDHVMRPDPDYFTSPFDKSKDDFFLI-DDKETLFPPSTRNRIVYYILSRCFYNR--------------------------------DDNINK------------DKR-------------GIKRLLNNGTYTSAFPLHD-CRYWTKSRDTHCESERYSLYRYWARFFRFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLFYAALVGLICFIYGAATYDDVIWTKEICDDDIGGQIVMCPL--CDKKCGFWKLNSTCNSTWQSHLFDNTATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYET---KCTSRRRNKVTQEMEPYFPV-TSKCARACLSGATVLFWISLIIASIIGVIAYRLAVFAALASVMKDSPTNKMELVGSLITPQLATSVTASCINFVIIMILNFFYERVAIWITDMEVPKTHLEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGKYTYMFNGSGLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALLPWLKNWWSSRKARSHPESLYSRWEQDYD-------------------------------------LQNFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKLTTQFRRPVAAKAHSIGAWDEILNMIAVFSVVTNAFIVAFTSDMIPRLVYLYAYHPGTELTMQGYVNNSLSIFNISQLHSDNTPDPGENPAWFNNSVITTCRYRDYRYPP-GHEYE-YSHTMQFWHILAAKMAFIIIMEHVVFVVKFLVAWLIPDVPSDVQARVKRERYLVQEYLHNYEVDKLKKQ 849          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:103044829])

HSP 1 Score: 412.535 bits (1059), Expect = 8.246e-127
Identity = 306/971 (31.51%), Postives = 482/971 (49.64%), Query Frame = 1
Query:  139 INDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYD---FNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ---GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA--RPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSF----SLMRMHHSRTISNMSSIIT-----AATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFL--NGFTDFSLSYMNSSEFNA--TLYGGHKLTLGTNE--TYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ 2970
            ++   +  + ++F DG R+IDFVL Y    ++R  Q +R  + +++ K GLE+E++D                    + S      F+K+ A WE L  YA+VLKI+     + F+ +    NR+     LF       +   + ++P P  FT+P+ KSK+  F I +D  T F  + R+ IV YIL R  Y R                                ++N+N+            DK              GI +L++ G + SA+ LH+         +    +ER  LY++W      ++ QPL+ I+ Y+GEK+  YFAWLG+YT  L   +L+G+I  +Y      + I  KEI     G  I MCPL    + C FWKL+   +  +   L DN ATV  A+ M IW +LFLE WKR+Q +L Y W++ D E E +    RPE+     K   ++ N ++ + EP+ P    +      + +TVL  I++ +A + G+I Y+L  F    S+M+   +  +  + S+IT     + T S ++ VIIM L   Y RVA+W+TDME  +T  +Y++ +T+K++L +F+N YSS FY+ F +      P       + S ++   C  GGCL++L+ QL  +M GKQ+  +I+E  LP L +     K +   E L ++ + + +                                     L +     LF EYLEM+IQFGFIT+F+ +FPLAPLLAL NN+ E+R DA K     RRPVA +   IG W  I++M+A  +V +NA ++AF +  I +L+Y+  Y     L   G+ + SLS  N S+ ++  T   G       N   T CRY  +R+PP   +YE YS+T  +W ILAAK+ F+ + E++V++   ++A +IPDVP  ++  +KRE  L  E +   ++ ++K Q
Sbjct:   60 VDKQHQSKDSVYFRDGKRRIDFVLSYIEDKEDR-KQERRKLYEENMQKAGLELELEDK-------------------TESEDGKTYFLKIHAPWEVLATYADVLKIK-----VPFKVNDIPENREIPVSWLFTPL----LLPDHVMRPDPDYFTSPFDKSKDDFFLI-DDKETLFPPSTRNRIVYYILSRCFYNR--------------------------------DDNINK------------DKR-------------GIKRLLNNGTYTSAFPLHD-CRYWTKSRDTHCESERYSLYRYWARFFRFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLFYAALVGLICFIYGAATYDDVIWTKEICDDDIGGQIVMCPL--CDKKCGFWKLNSTCNSTWQSHLFDNTATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYET---KCTSRRRNKVTQEMEPYFPV-TSKCARACLSGATVLFWISLIIASIIGVIAYRLAVFAALASVMKDSPTNKMELVGSLITPQLATSVTASCINFVIIMILNFFYERVAIWITDMEVPKTHLEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGKYTYMFNGSGLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALLPWLKNWWSSRKARSHPESLYSRWEQDYD-------------------------------------LQNFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKLTTQFRRPVAAKAHSIGAWDEILNMIAVFSVVTNAFIVAFTSDMIPRLVYLYAYHPGTELTMQGYVNNSLSIFNISQLHSDNTPDPGENPAWFNNSVITTCRYRDYRYPP-GHEYE-YSHTMQFWHILAAKMAFIIIMEHVVFVVKFLVAWLIPDVPSDVQARVKRERYLVQEYLHNYEVDKLKKQ 897          
BLAST of Anoctamin vs. Ensembl Cavefish
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:103044829])

HSP 1 Score: 413.305 bits (1061), Expect = 1.364e-126
Identity = 308/971 (31.72%), Postives = 480/971 (49.43%), Query Frame = 1
Query:  139 INDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYD---FNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ---GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA--RPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSF----SLMRMHHSRTISNMSSIIT-----AATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFL--NGFTDFSLSYMNSSEFNA--TLYGGHKLTLGTNE--TYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ 2970
            ++   +  + ++F DG R+IDFVL Y    ++R  Q +R  + +++ K GLE+E++D                    + S      F+K+ A WE L  YA+VLKI+     + F+ +    NR+     LF       +   + ++P P  FT+P+ KSK+  F I +D  T F  + R+ IV YIL R  Y R                                ++N+N+            DK              GI +L++ G + SA+ LH+         +    +ER  LY++W      ++ QPL+ I+ Y+GEK+  YFAWLG+YT  L   +L+G+I  +Y      + I  KEI     G  I MCPL    + C FWKL+   +  +   L DN ATV  A+ M IW +LFLE WKR+Q +L Y W++ D E E +    RPE+     K   ++ N ++ + EP+ P    +      + +TVL  I++ +A + G+I Y+L  F    S+M+   +  +  + S+IT     + T S ++ VIIM L   Y RVA+W+TDME  +T  +Y++ +T+K++L +F+N YSS FY+ F +      P       + S ++   C  GGCL++L+ QL  +M GKQ+  +I+E  LP L +     K +   E L +                                     R   D  L +     LF EYLEM+IQFGFIT+F+ +FPLAPLLAL NN+ E+R DA K     RRPVA +   IG W  I++M+A  +V +NA ++AF +  I +L+Y+  Y     L   G+ + SLS  N S+ ++  T   G       N   T CRY  +R+PP   +YE YS+T  +W ILAAK+ F+ + E++V++   ++A +IPDVP  ++  +KRE  L  E +   ++ ++K Q
Sbjct:  104 VDKQHQSKDSVYFRDGKRRIDFVLSYIEDKEDR-KQERRKLYEENMQKAGLELELEDK-------------------TESEDGKTYFLKIHAPWEVLATYADVLKIK-----VPFKVNDIPENREIPVSWLFTPL----LLPDHVMRPDPDYFTSPFDKSKDDFFLI-DDKETLFPPSTRNRIVYYILSRCFYNR--------------------------------DDNINK------------DKR-------------GIKRLLNNGTYTSAFPLHD-CRYWTKSRDTHCESERYSLYRYWARFFRFYKEQPLNLIRKYYGEKIGIYFAWLGFYTEMLFYAALVGLICFIYGAATYDDVIWTKEICDDDIGGQIVMCPL--CDKKCGFWKLNSTCNSTWQSHLFDNTATVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYET---KCTSRRRNKVTQEMEPYFPV-TSKCARACLSGATVLFWISLIIASIIGVIAYRLAVFAALASVMKDSPTNKMELVGSLITPQLATSVTASCINFVIIMILNFFYERVAIWITDMEVPKTHLEYENKLTIKMFLFQFVNYYSSCFYVAFFKGKFVGYPGKYTYMFNGSGLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALLPWLKNWWSSRKARSHPESLYS-------------------------------------RWEQDYDLQNFSQFGLFYEYLEMVIQFGFITLFVASFPLAPLLALMNNILEVRVDAWKLTTQFRRPVAAKAHSIGAWDEILNMIAVFSVVTNAFIVAFTSDMIPRLVYLYAYHPGTELTMQGYVNNSLSIFNISQLHSDNTPDPGENPAWFNNSVITTCRYRDYRYPP-GHEYE-YSHTMQFWHILAAKMAFIIIMEHVVFVVKFLVAWLIPDVPSDVQARVKRERYLVQEYLHNYEVDKLKKQ 941          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 353.214 bits (905), Expect = 7.153e-107
Identity = 269/859 (31.32%), Postives = 435/859 (50.64%), Query Frame = 1
Query:  376 SHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXX-XXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWL-GYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ-GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYK-LVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIP-SFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEII 2937
              + NI ++K+ A W+ L  YAE + +R  +      +   +    +RL +     NI + +  +     +   + KSK   F   +   TFF++ +R +I                          V++IL+                           P G +         K  + G+ +++ + +F +A+ LHE   +         +   R +LYK+W      F+ QPLDHI+ YFGEK+AFYFAWL G+YT WLLP +L+G++V     +   ND  VKEI + G++  MCPL C +  C+ W LS+  +   +  + D   T+  ++ +S+W+  FLE WKR+   L YHW    + +E+E  RPE+ AL       + N I+G++EP+      R P        + L I++ L FL  +ILY+ L+S S+ +   +  ++  ++ I   TG+L+ LV+I+ +  +Y+ +A +LT  E HRTQS++++++T+K+++ + +N YSS  Y+GF +      P ++ +    +   CP GGCL++L+ QL  IM+GKQI+++++E  LP +    +R KL +   K + Q                         ++ W+ + EL        L + G   LF EYLEM++QFGFITIF+ AFPLAPL AL NN  EIR DA KF    RR V +RV+ IG+W  I+S +A I++ SNA LIAF + ++ +L+Y   Y  +  L+G+ DF+L+Y       A            N T CRY  FR        +  + T  YW++LA ++ FV +FE+LV+L    I  +I DV   L++ +KRE  L  + +
Sbjct:   51 GEKINIHYLKLHAPWQVLQCYAEEINLRMPLQI----HPMTKTHFSERLLKFLHLPNIMHADLPRQPQEYYNCFFRKSKLDRFLGSDHPETFFSSTQRHVI--------------------------VKEILN-------------------------TTPYGKR---------KKAEVGLDRMLRDHIFSAAFPLHEGSYDGTYLGLAPEQMTRRQVLYKYWARWGCWFKYQPLDHIREYFGEKIAFYFAWLLGFYTCWLLPPALVGLVVFFVGWLTLHNDSTVKEICENGSHYQMCPL-CDT--CKVWNLSNTCNMAKMGHIFDYPGTIFYSIFISLWSVSFLEYWKRKSSSLTYHWGC-TLVHEEERPRPEYAALAPL---IRENPITGEKEPYFSE-DDRTPRTVTGSIVLFLMISVVLIFLVTVILYQALLSISIFKTG-NWFLATQATNIANMTGTLVFLVLIVIMARLYTTIADYLTRWEMHRTQSEHENALTVKVFIFQLVNYYSSPVYVGFFKGKFNGYPGNYGNLFGTRNENCPQGGCLIELAQQLFIIMVGKQILNNLQELILPIIQQWRQRRKLDEIRGKRLVQE------------------------LNIWEDDYEL--------LHNTG---LFDEYLEMVMQFGFITIFVMAFPLAPLFALMNNWVEIRLDARKFVCRYRRSVVERVRGIGVWFDILSGLAHISIISNAFLIAFTSDFLPRLLYRYTYKSS--LDGYVDFTLAYAPRDYVVA------------NHTMCRYRDFRD-------QDGNLTLFYWKLLAVRLSFVIIFEHLVFLVARAIDWLIVDVAPDLKVKIKREEYLAKQAL 780          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000399.1 (pep scaffold:Pmarinus_7.0:GL477564:2673:43187:-1 gene:ENSPMAG00000000358.1 transcript:ENSPMAT00000000399.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 312.383 bits (799), Expect = 4.785e-92
Identity = 217/614 (35.34%), Postives = 340/614 (55.37%), Query Frame = 1
Query:  913 GIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ-GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVA-LIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQ--------PFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQII-SHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRY 2721
            GI  LI+ GV+ SA+ LH+       +L   E N+R LL+  W S    ++ QPL+ IK YFGEK+  YFAWLG YT  L+P S++GI V LY  +    DI   E    G NITMCP     + C++ +LS+   R     L DN  TVL ++ M++WA+ FLE WKR + +L Y W+++ ME  ++  RPE+ A L++K       L   + E +   WR ++P      S +L  + ++ A + G+I Y++    L+       + +  S I  AT  L++LVII+ L  +Y  +A WLT +E  +T+ ++++ +  K ++L+F+N+Y+SI Y+ F++         +   +P++R         C  GGCL +L+LQL  IM+GKQ++ +++ E  +P+ +  + RY  K+   K   ++    E D +E+  KD            +++EP              G  P   EY+EM+IQFGF+T+F+ +FPLAP  AL NN+ EIR D  KF   LRRP A R KDIG W  I++ VA +AV  NA++IA  + ++ +LIY+  YS +G L G+ +++LSY N S++         + + +N T CRY
Sbjct:  228 GITSLIANGVYTSAFPLHD------GELHGSEVNDRKLLHDEWASYNKFYKYQPLELIKKYFGEKIGLYFAWLGVYTQMLIPPSVVGIAVFLYGWLAAEKDIPGFETCVIGQNITMCP--TCDKLCKYKRLSENCDRVRSSHLFDNITTVLFSIFMALWATTFLEHWKRIETRLNYTWDLNGMEESEQQLRPEYEAKLLEKKRKVDIKLAKTQTEEYGLSWRDQLPSFLINCSCILFMVLLSFAIVVGMIFYRITMNVLLANSTDPYLKSNRSAIIMATAFLINLVIILILDEIYGSIARWLTVIEVPKTEEEFETRLIFKSFMLKFVNSYTSIIYVAFLKGRITGYPKKYYYILPNYRMEE------CAPGGCLQELALQLCIIMLGKQLLQNNLFEVGIPK-IKKLCRYLHKKDHHK---KASHLKEEDGMELGCKD------------YELEP------------FTGLNP---EYMEMVIQFGFVTLFVASFPLAPFFALLNNVIEIRLDGKKFVTELRRPTAVRAKDIGTWYVILNGVAKLAVIINALVIALTSDFVPRLIYMYFYSPDGSLRGYVNYTLSYFNVSDYAPG------IIIESNYTLCRY 790          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ano3 (anoctamin 3 [Source:ZFIN;Acc:ZDB-GENE-111031-3])

HSP 1 Score: 259.225 bits (661), Expect = 7.872e-76
Identity = 188/538 (34.94%), Postives = 293/538 (54.46%), Query Frame = 1
Query: 1387 ASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIG-FIQPFT-QPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGY--------SENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ 2970
            A++FLE WKR++ +LAY W++ D E E+E  RP+F A   +   ++ N ISGK EP+  F   +   +  + S + L I + +  + G+++Y++V  S+        + + S   TA TG  ++ VIIM L ++Y +VAV+LT++E  RT++++++S TLK++L +F+N  SSIFY+  F+  FT  P    +   + +   C   GCL+DL +Q+  IM+ KQ  ++  E   P L +   + KL+            EME    ++A+           +  W+          D  L       LF EYLEM++QFGF TIF+ AFPLAPLLAL NN+ EIR DA KF    RR +A R KDIG+W  I+  +  ++V +NA +IA  + +I +L+Y   Y        SE   L G+ + SLS  N S +   +           + YC Y  +R  P   + EPY +T  +W +LAA++ F+ +FE+LVY    IIA +IPD+P  L+  M RE  L  E++ +ADL  ++ +
Sbjct:    7 ATVFLEFWKRRKSELAYEWDLLDWEEEEEEIRPQFEAKYSQK--ERLNAISGKPEPYQSF-HDKCSRLVVSASGIFLMICLVIVAVFGVVVYRVVMLSVFTTSELVFVRSYSQFFTAGTGVCINFVIIMLLNMIYEKVAVFLTNLEQCRTEAEWENSFTLKMFLFQFVNLNSSIFYVAFFLGRFTGHPGKYEKLFHIWRLEECHPSGCLIDLCMQMGIIMVLKQTWNNFMELGFPLLQNWWAKKKLQH-----------EMETTEDDMAL-----------LPQWE---------QDYSLQQINTYGLFDEYLEMILQFGFTTIFVAAFPLAPLLALLNNIIEIRLDAYKFVTQWRRSLACRAKDIGVWYGILEGIGVVSVITNAFVIAVTSDFIPRLVYFYQYGPCARMRESERDCLEGYVNSSLSVFNPSTYCQII-----------KCYCIYRDYREAPSTHREEPYKFTLQFWHVLAARLAFIIVFEHLVYFIKLIIAYMIPDIPKGLKERMHREKFLVQEMVHEADLDALRKE 499          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 223.402 bits (568), Expect = 1.525e-64
Identity = 150/445 (33.71%), Postives = 242/445 (54.38%), Query Frame = 1
Query: 1606 TVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEM--LIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNE 2931
             ++L +++ + FL  +I+Y+ +   +M    +  +   ++ I   + S+++L++I+ +  VYS +A  LT  E HRTQ+QY+ + T K+++ +F+N YSS FY+ F +      P  ++     +   C  GGCL++L+ QL  IM+GKQ+I++I+E+  P++ + +++ KL       +  S    E+ R                   W+ + ELI C             LF EYLEM  ++QFGFITIF+ AFPLAPL AL NN  E+R DA KF    RRPVA+R +DIG+W +I+  +  I+V  NA LIAF + ++ KL+Y   Y  N  L G+ +F+LSY                 +  N T+CRY  +R        +   +T  YW++LA ++ F+  FE++V+    +I  ++PDVP+ L I MKRE  L  +
Sbjct:    4 VIILMLSVVMIFLVTVIMYRGIVSVVMYKTGNAVLMTQAANIANISSSMVNLILILVMGQVYSSLAEQLTKWEMHRTQTQYEDAFTFKVFVFQFVNFYSSPFYVAFFKGRFVGYPGHYKKLLGTRNEDCGPGGCLIELAQQLIIIMVGKQVINNIQEFVFPKIKAWLQKRKLAA-----LRGSHVAPESSR-------------------WEEDYELIPC-----------EGLFEEYLEMGPVLQFGFITIFVAAFPLAPLFALLNNWVELRLDAQKFVCEYRRPVAERAQDIGVWFNILDALVNISVIINAFLIAFTSNFLPKLLYQYTYDRN--LRGYINFTLSYAPDD------------YVVNNYTHCRYKDYRD-------QDGKHTLFYWKLLAIRLGFIIAFEHVVFFISRMIDWLVPDVPESLEIKMKRERYLAKQ 392          
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Match: ano11 (anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245])

HSP 1 Score: 219.935 bits (559), Expect = 2.976e-63
Identity = 152/444 (34.23%), Postives = 243/444 (54.73%), Query Frame = 1
Query: 1615 LSIAMALAFLGGIILYK-LVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALP-RLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEM--LIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNE 2931
            L +++ + FL  +I+Y+ +VS  + +  ++  ++  ++ I   + S+++L++I+ +  VYS +A  LT  E HRTQ+QY+ + T K+++ +F+N YSS FY+ F +      P  ++     +   C  GGCL++L+ QL  IM+GKQ+I++I+E+  P  L     R   ++ +  L  +  A +    V            P+    W+ + ELI C             LF EYLEM  ++QFGFITIF+ AFPLAPL AL NN  E+R DA KF    RRPVA+R +DIG+W +I+  +  I+V  NA LIAF + ++ KL+Y   Y  N  L G+ +F+LSY                 +  N T+CRY  +R        +   +T  YW++LA ++ F+  FE++V+    +I  ++PDVP+ L I MKRE  L  +
Sbjct:    1 LQLSVVMIFLVTVIMYRGIVSVVMYKTGNAVLMTQQAANIANISSSMVNLILILVMGQVYSSLAEQLTKWEMHRTQTQYEDAFTFKVFVFQFVNFYSSPFYVAFFKGRFVGYPGHYKKLLGTRNEDCGPGGCLIELAQQLIIIMVGKQVINNIQEFVFPLTLPPPAPRSCRRKIKAWLQKRKLAALRGSHVA-----------PES-SRWEEDYELIPCEG-----------LFEEYLEMGPVLQFGFITIFVAAFPLAPLFALLNNWVELRLDAQKFVCEYRRPVAERAQDIGVWFNILDALVNISVIINAFLIAFTSNFLPKLLYQYTYDRN--LRGYINFTLSYAPDD------------YVVNNYTHCRYKDYRD-------QDGKHTLFYWKLLAIRLGFIIAFEHVVFFISRMIDWLVPDVPESLEIKMKRERYLAKQ 400          
BLAST of Anoctamin vs. Ensembl Nematostella
Match: EDO49855 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7REV0])

HSP 1 Score: 424.476 bits (1090), Expect = 3.568e-133
Identity = 309/923 (33.48%), Postives = 454/923 (49.19%), Query Frame = 1
Query:  199 DFVLVYERINDNRTNQI--KRMTFLKSLLKEGLEIE---IQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNI--VYTSNDIVVKEIYQGTNIT--MCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEII 2937
            DFVLVYE    +   Q    R  FL++L K  LE E    QD   K++                       FIK+   WE L  YAE L  R   L +G     N     +R+ E F   NIF      P P  FT  +  +K   F   +D  ++FT  ER+        R +Y              +++E                              AP G +         +  + GI +L+ EGVF + Y LH                   +L ++W       + QPLDHI+ YFGEK+  YFAWLG YT WL+  S LG++V LY +  + +S++    E+      T  MCPL     GC++W L  +     +  L DN +TV  AV +S W+  FLE WKR++V LAYHW+V + E E E  RP F AL       + N ++G  EP  P   +R P +F   + V   +++ L F+ G+I+YKL+ +  +  + S     +   I  +TG+ ++L IIM L+ VY RVA+ LT  E HRTQ++Y+ S+T K+++ +F N YSSIFY+ F +      P  +R    ++   C  GGCL++L+ QL  IM+GKQ+I++++E A+P +   +KR K   ++++                        + P+    W+ + EL+               LF EYLEM++QFGFITIF+ AFPLAP  AL NN+FEIR D+ KF   +RRP+A R +DIGIW +I+  VA IAV SNA LIAF +T++ KL+Y    SEN  L G+T+++L++      N TL              CRY  FR P          +T  YW +LA ++ FV +FE++V+  M +I +++PD+P +L I +KREA L  + +
Sbjct:    1 DFVLVYEEGEKDPPPQSIEYRQKFLENLAKSQLEFEEEITQDKKVKLH-----------------------FIKIHVPWEVLLFYAEELSFRAP-LEVGLNTKVNWS---ERMLEKFHMPNIFKEEVPNPPPDFFTCTFQANKLNKFIGSDDPDSYFTDVERT--------RVAY--------------EILET-----------------------------APYGKR---------QRGEIGIERLVEEGVFKAGYPLHVNCYLNQQGYSPFLIYVSQVLKEYWGRWGKWLKYQPLDHIRDYFGEKIGIYFAWLGQYTAWLIMPSFLGLLVFLYGVATINSSDNKPALEVCDNPPWTFRMCPLCDEELGCQYWDLHISCKSGKIAYLFDNASTVFFAVFVSFWSCFFLEYWKRKEVTLAYHWDVLEYEEEAERPRPTFAALAPT---VERNPVTGILEPHFPD-EKRKPRLFSGIAIVFTMVSLVLVFMVGVIVYKLLVYRPLARNPSTRAYALQ--IANSTGAFVNLTIIMILSRVYERVALALTHWEMHRTQTEYEDSLTFKVFVFQFANFYSSIFYVAFFKGKLVGYPGHYRRLFGLRQEECSPGGCLMELAQQLVIIMVGKQMINNVQEIAIPLVKQWIKRKKRGTSKDE------------------------IKPR----WEQDFELVENEG-----------LFQEYLEMILQFGFITIFVAAFPLAPFFALANNIFEIRIDSDKFVCEVRRPIADRAQDIGIWFNILDSVAKIAVISNAFLIAFTSTFLPKLLYRYAVSENFSLEGYTNYTLAWAPR---NTTL------------KPCRYQEFRDPEGH-------FTVFYWHLLALRLGFVIMFEHVVFFVMRLIDMMVPDIPTELEIIIKREAYLAKQAL 769          
BLAST of Anoctamin vs. Ensembl Nematostella
Match: EDO48050 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RKU9])

HSP 1 Score: 375.17 bits (962), Expect = 1.565e-114
Identity = 233/697 (33.43%), Postives = 368/697 (52.80%), Query Frame = 1
Query:  883 EDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGT---NITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISG--KEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQ---PFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTN---------ETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATL 2922
            +    +  D GI +LI +G + +AY LH  P             ++    + W      F+ QP D IK YFG ++  YFAWLG+Y   L+P ++ G+ V +Y I  ++    VK+I          MCPL    + C +W L         +   DN +TV+ A+ MSIWA++FLE WKR+Q  LAY W++   E ++E  RPEF+  +      K +   G     P +  +R+   V+    S V   IA+ L+ + G+++Y+   +  +  +    +   + + T+ T ++L+L+ I  L  VY ++A++LT+ E+ RT++ +  S T K+YL +F+NNY+SIFYI F +       P    R +   +  GC +GGCL+DL +QL  IM+G+QII +I E A+P L   +K +K++QA+++   +                         I  W+V+      Y  N L +     LF EYLE+++QFGF+T+F+ AFPLAPL AL N +FE+R DA+ F    RRP  +R +DIG W+SIM  +A I+V  NA +IAF + +I +L+Y   YS +G L G+ + SLSY N  +++     G +   G N           YCRY G+  P +     PY  +  YW ++AA++ FV+ F+ +VY     +A ++PD P  L + +KR+  L
Sbjct:  162 QRFGEERFDQGIKRLIHQGTYTAAYPLHSGPEEVSRKGHPSNERQKLR--RDWARFGRWFKYQPYDAIKDYFGTEIGLYFAWLGFYAAMLVPAAIFGVAVFIYGIAQSTIFPPVKDICNKAYEAEFYMCPL--CDKQCPYWSLVVNCPYAIWVHAFDNDSTVVFAIFMSIWATVFLEFWKRRQAVLAYEWHMMHYEDQEEQPRPEFIVTVTTLKKDKASQWGGMVPHVPKLQQYRKLAGVV----SLVAFMIALVLSAVVGVVIYRASVYGSLMAYPDPQVRKQAKMTTSITAAILNLICINLLKFVYEKLAMFLTEWENPRTETDFKDSFTYKMYLFQFVNNYASIFYIAFFKLNLVIGTPGNYRRFAGEYRLDGCSSGGCLMDLCIQLVIIMVGQQIIGNITEIAIPGL---LKWWKMRQAQKEAFEE-------------------------IPRWEVD------YKLNTLPE---HHLFWEYLEVVLQFGFVTMFVAAFPLAPLFALVNAVFELRVDAINFVCQFRRPTPRRAQDIGAWMSIMQGLANISVLVNAFVIAFTSDFIPRLVYTTAYSPDGTLRGYLNNSLSYFNVKDYDRMGAIGAREKPGDNYAYTVLNYTREYCRYPGYHEPEF-----PYEVSKQYWHVIAARLAFVFAFQYIVYAVTKFVAWLVPDRPRHLELRIKRQEYL 808          
BLAST of Anoctamin vs. Ensembl Nematostella
Match: EDO49854 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7REU8])

HSP 1 Score: 356.295 bits (913), Expect = 1.249e-108
Identity = 238/687 (34.64%), Postives = 374/687 (54.44%), Query Frame = 1
Query:  907 DFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYF-----GEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNI--VYTSNDIVVKEI--YQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQ-PFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEII 2937
            + GI++L+ EG + +AY LH  P   D+   N+    +    ++W      ++ QPLDHI+  +     G K+A YFAWLG YT WL+  S++G+IV +Y+   +   N++   E+  +      MCP  C   GC  W L  + SR     L DN  TV  ++ +S WA LFLE WKR++V + + W+V + E E+E  RP F AL       + N I+G  EP+ P   +R P +    + +   +++ + F+ G+I+YKL+   +  ++ +  +   ++   + TG++L+L+IIM L+ VY ++A+ L   E HRTQ++Y+ ++TLK+++ +F N YSSIFYI F +  F     ++ +   ++   C  GGCL++L+ QLA IMIGKQ+I +I+E  +P L   +K  K + +++               E  IK +           W+ + EL+    DN         LF EYLEM+IQ+GFIT+F+ AFPLAP  AL NN+FEIR DA KF   LRR  A R +DIG+W +I+  +  +AV SNA LIAF + ++ KL+Y    S N  L G+ ++SL++   +               T    CRY GFR        E  ++T  +W +L  ++VFV LFE+ V+    +I V +PD+P  L   +KRE  +  + +
Sbjct:   70 EIGISRLVDEGTYSAAYPLHVGPHGPDEMKLNMRQVLK----EYWARWGAWYKYQPLDHIRQAYEREGGGLKIAIYFAWLGQYTAWLIMPSVVGLIVFIYSFATINGPNNMPALEMCDHPAWTYPMCP-NCEV-GCSVWDLKKSCSRAKHAYLFDNPMTVAYSIFVSFWAVLFLEFWKRKEVTIGHAWDVLEFESEEERPRPTFAALAPA---VERNPITGLLEPYFPD-EKRSPRVLSGIAIICGMVSLVMLFMVGVIVYKLLV--IHPLYKNPNLQPYANQFASGTGAVLNLIIIMILSRVYEKLALLLNHWEMHRTQTEYEDNLTLKVFIFQFTNFYSSIFYIAFFKGKFVGYPGNYGTIFGLRNEECSPGGCLIELAQQLAVIMIGKQVIGNIQEVFIPELKKYLKNRKRQNSKD---------------EDEIKPR-----------WEADYELL----DN-------EGLFQEYLEMVIQYGFITLFVAAFPLAPFFALANNVFEIRIDADKFVNDLRRSTADRAQDIGVWFTILDSITKLAVISNAFLIAFTSEFLPKLLYAGVVSPNQSLEGYLNYSLAWAPPN---------------TTSQPCRYRGFRD-------EDGNFTRFFWHLLTMRLVFVILFEHFVFGISTLIDVAVPDIPRALEDTIKREKYVATQAL 685          
BLAST of Anoctamin vs. Ensembl Nematostella
Match: EDO48048 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RKU7])

HSP 1 Score: 353.214 bits (905), Expect = 6.020e-106
Identity = 242/697 (34.72%), Postives = 377/697 (54.09%), Query Frame = 1
Query:  913 GIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTN-ITMCPLMCSSRGCRFWKLSDA---YSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVL-LSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNM-------SSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQP---FTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYS---ENGFLNGFTDFSLSYMNSSEFNATLYGGHKL----TLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEII 2937
            G+ +L+ EG + + Y LH+   +   +     N+ + L  K W SM+ IF+ QPLD +K Y+G  +A YFAWLG+YT  L+P++++G++V +Y I  ++    V++     N   MCPL    R C +W L      Y+R  +    DN  TV +A+  S+WA+LFLE WKR+Q  LAY W+V + E E+E  RPEF A        K N+I+GK EP IP  RR +   +    +V+   I + +A + G+++Y+   F+ +  +   TI          S IIT+ T +L++L+ I  L L Y+R+AVWLT+ E+ RT++ Y+ S T K+YL +F+N Y+SIFYI F +       P    R +   +  GC A GC L+L +Q+  IM+G+QII +I E A+P +++ +K  K    E K  N+   + E D                    + ++P+                 LF EYLE+++Q+GF+T+FI AFPLAPL +L N++ EIR DA+ F    RRP     +DIG W  I+  +  ++V  NA +++F + +I KL+Y + Y+     G L G+ + SLS +N +       G   L     L   ET+CRY G+    +     P+ +   YW ++AA++ FV++F+  VY   + IA  +PD P  L +  KRE  LT +I+
Sbjct:  188 GLKQLVYEGAYCANYPLHDGDDDVIGESSYPSNDRQRLK-KDWSSMKRIFKYQPLDTVKGYYGTAIALYFAWLGFYTAMLIPLAIVGLLVFIYGIGSSATSPTVRDACDTNNKFYMCPL--CDRTCSYWDLVSTTCMYAR--VTHFFDNDGTVFLAIFTSVWATLFLEFWKRRQAVLAYEWHVANFEEEEEQIRPEFAATAPT---LKKNIITGKLEPHIP--RRTLYQRYGAIGSVVAFMILLVIAAVIGVVVYRAAVFAALSGNSDSTIRARYAMIAIGSRIITSMTAALINLLCINILKLFYNRLAVWLTNWENPRTKTDYEDSFTYKMYLFQFVNTYASIFYIAFFKSEIVVGTPGRYKRIAGKYRLEGCSAQGCFLELCVQMLIIMVGQQIIGNITEVAIPAIMTWIKERK----EPK--NKQLPQFEQD--------------------YNLQPQ-------------EEHNLFWEYLEIVLQYGFVTMFIAAFPLAPLFSLLNSIVEIRVDAINFVSQFRRPDTMIAEDIGAWYRILETLTRLSVLINAFVLSFTSEFIPKLVYKLKYAPEGSEGTLEGYLNNSLSAINVTVMEEWEPGTAPLNPTKNLNYTETFCRYKGYHDNTY-----PFKFNKQYWHVIAARLAFVFVFQYTVYAITSFIAWAVPDQPRSLELRSKREEHLTKKIL 830          
BLAST of Anoctamin vs. Ensembl Nematostella
Match: EDO48049 (Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RKU8])

HSP 1 Score: 329.717 bits (844), Expect = 1.914e-98
Identity = 223/689 (32.37%), Postives = 368/689 (53.41%), Query Frame = 1
Query:  910 FGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTN---ITMCPLMCSSRGCRFWKLSDAYSRF-FLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAM-ALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQP---FTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSEN----GFLNGFTDFSLSYMNSSEFNATLYGGHKL-TLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEII 2937
             G+ +L+ EG +   Y LH+      +      + +R    + W S    F+ QP D IK YFG ++  YFAWLG+YT  L+P+++ G++V +Y IV  +    V+++    N     MCPL    + C +W L+     + ++    DN  TV +AVV SIWA+LFLE+WKR+Q  LA  W+V D E E+E  RPEF A   +    K N ++G +EP++P  +R +   + T  ++++ + +  +A + G+++Y+   F+ +      TI   +  +T+ T ++++L+ I  L  VYS +AV LT+ E+ RT++ Y+ S T K+YL +F+N Y+SIFYI F +       P    R +   +  GC   GC L+L +QL  IM+G+QII +I E A+P L+  +KR K                                +PK       + +L +   D  L+  G   +F EYLE+++Q+GF+T+F+ AFPLAPL +L N++ EIR DA+ F R  RRP A R +DIG W  I+  +  ++V  NA +++F + ++ +L+Y + Y+ +    G L G+ + SL+    +         + L ++    T CRY G+      +   P+ +   YW ++A ++ FV++F+  VY F   +A +IPD    L + +KRE  L  ++I
Sbjct:  116 LGLKQLLYEGAYIGNYPLHDGDDEVKEGETISNDRQRLR--RDWASFGRCFKYQPYDAIKSYFGTEIGLYFAWLGFYTGMLVPLAIAGLVVFIYGIVDATMSPPVRDVCDSKNEGRWIMCPL--CDKQCSYWDLAKTTCAYAYVTHFFDNSLTVALAVVSSIWATLFLELWKRRQASLANKWHVSDFE-EEETIRPEFAATAPR---LKKNPVTGLQEPYVP--KRTLYQRYGTTGSIIVMMCLLVIAAVVGVVIYRAAVFASLSGSEILTIRMRARTVTSITAAIINLICINILKFVYSWLAVKLTNWENPRTRTDYEDSFTYKMYLFQFVNTYASIFYIAFFKSGLVIGTPGRYKRIAGKYRLDGCSEQGCFLELCIQLIIIMVGQQIIGNITEIAIPALMEWMKRRK--------------------------------EPK-------DKQLPQYQQDFDLNSLGEHNMFWEYLEVVLQYGFVTMFVAAFPLAPLFSLLNSIVEIRVDAINFVRQFRRPDAARAEDIGAWSRILEGLTKLSVLVNAFVLSFTSDFVPRLLYRLKYAPDRDSGGSLEGYLNNSLAVFEVAYLEPGTEPENPLQSINYTVTTCRYPGY-----HSNTAPFKFNKQYWHVIAGRLAFVFVFQYTVYAFTQFLAWLIPDRTKTLDLKIKREQYLAKQLI 750          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:101164640])

HSP 1 Score: 421.394 bits (1082), Expect = 1.110e-130
Identity = 315/976 (32.27%), Postives = 480/976 (49.18%), Query Frame = 1
Query:  136 DINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNI-FNINE--LKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ---GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA--RPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSF----SLMRMHHSRTISNMSSIIT-----AATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLN--GFTDFSLSYMNSSEF---NATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSK 2982
            +I   ++  + +FF DGVR+IDFVL Y    D    Q +R  F  +L+K GLE+EI+D                    S S      F+K+ A WE L  YA+VLKI+           F    I        ++L+  F + E  ++P P  FT P+ KSK   F I ED   FF  + R+ IV Y                          ILSR      + I DE    +                            GI +L++   + +A+ LH+         +   +++R  LYK+W    + F+ QPL+ I+ Y+GEK+  YFAWLG+YT  L   +++G +  +Y ++   ++   KEI     G NI MCPL    + C FWKL+   +  +   L DN  TV  A+ M IW +LFLE WKR+Q +L Y W++ D E E +    RPE+     K   +K N I+ + EP++P    +   +  + +TVLL I++ +A + G+I Y+L  +    S+M+   +  +  +   IT     + T S ++ VIIM L L+Y RVAVW+TDME  +T  +Y++ +T+K++L +F+N YSS FY+ F +      P      F   S ++   C  GGCL++L+ QL  +M GKQ+  +I+E  +P L++     K +   E L +                                     R   D+ L   G   LF EYLEM+IQFGFIT+F+ +FPLAPLLAL NN+ EIR DA K     RRPVA +   IG W  I++ +A ++V +NA ++AF +  I +L+Y+  Y   G +N  G+ + SLS  N SE    N    G + L   ++ T CRY  +R+PP       YS+T  +W ILAAK+ F+ + E++V+L    +A +IPDVP  ++  +KRE  L  E +   ++ ++K Q + +
Sbjct:    2 EIQKQQQSKDSVFFRDGVRRIDFVLSYVDDKDGERKQERRRVFEANLVKVGLELEIEDK-------------------SESDDRKTYFVKIHAPWEVLATYADVLKIK---------VPFKANDIPDNSEMPMNWLSTPFRLPEPIMQPEPDFFTAPFDKSKSDFFLI-EDRDKFFLPSTRNRIVYY--------------------------ILSR-----CSYIRDECGERDKK--------------------------GIKRLLNNSTYTAAFPLHDS-RYWTKSKDVNCDSDRYNLYKYWAGFFSFFKEQPLNLIRKYYGEKIGLYFAWLGFYTEMLFFAAVVGTLCFVYGVLTYDDNEWSKEICSDEIGGNIVMCPL--CDKKCGFWKLNTTCNSSWQSHLFDNVGTVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYET---KCNSRKLNRITQEMEPYLPI-TSKCARICLSGATVLLWISLIIACIIGVIAYRLAVYAAFASIMKDSPTSNLEVVGPYITPQLATSVTASCINFVIIMILNLMYERVAVWITDMEIPKTHLEYENKLTVKMFLFQFVNYYSSCFYVAFFKGKFVGYPGDYAYMFGKWSKLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALVPWLMNWWASRKARSYPESLYS-------------------------------------RWEQDHDLQGFGQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALFNNIIEIRVDAWKLTTQFRRPVAAKAHCIGAWEEILNGMAVLSVVTNAFIVAFTSDMIPRLVYMYAYQPEGEMNMKGYINNSLSVFNISEIPLPNRPEDGENPLWFNSSITTCRYRDYRNPP--GHENQYSHTMQFWHILAAKLAFIIIMEHVVFLVKYFVAWMIPDVPSDVKARVKRERYLVQEYLHNYEVEKLKIQLSQQ 845          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:101164640])

HSP 1 Score: 421.394 bits (1082), Expect = 3.877e-130
Identity = 315/975 (32.31%), Postives = 479/975 (49.13%), Query Frame = 1
Query:  139 INDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNI-FNINE--LKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ---GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA--RPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSF----SLMRMHHSRTISNMSSIIT-----AATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLN--GFTDFSLSYMNSSEF---NATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSK 2982
            I   ++  + +FF DGVR+IDFVL Y    D    Q +R  F  +L+K GLE+EI+D                    S S      F+K+ A WE L  YA+VLKI+           F    I        ++L+  F + E  ++P P  FT P+ KSK   F I ED   FF  + R+ IV Y                          ILSR      + I DE    +                            GI +L++   + +A+ LH+         +   +++R  LYK+W    + F+ QPL+ I+ Y+GEK+  YFAWLG+YT  L   +++G +  +Y ++   ++   KEI     G NI MCPL    + C FWKL+   +  +   L DN  TV  A+ M IW +LFLE WKR+Q +L Y W++ D E E +    RPE+     K   +K N I+ + EP++P    +   +  + +TVLL I++ +A + G+I Y+L  +    S+M+   +  +  +   IT     + T S ++ VIIM L L+Y RVAVW+TDME  +T  +Y++ +T+K++L +F+N YSS FY+ F +      P      F   S ++   C  GGCL++L+ QL  +M GKQ+  +I+E  +P L++     K +   E L +                                     R   D+ L   G   LF EYLEM+IQFGFIT+F+ +FPLAPLLAL NN+ EIR DA K     RRPVA +   IG W  I++ +A ++V +NA ++AF +  I +L+Y+  Y   G +N  G+ + SLS  N SE    N    G + L   ++ T CRY  +R+PP       YS+T  +W ILAAK+ F+ + E++V+L    +A +IPDVP  ++  +KRE  L  E +   ++ ++K Q + +
Sbjct:   47 IQKQQQSKDSVFFRDGVRRIDFVLSYVDDKDGERKQERRRVFEANLVKVGLELEIEDK-------------------SESDDRKTYFVKIHAPWEVLATYADVLKIK---------VPFKANDIPDNSEMPMNWLSTPFRLPEPIMQPEPDFFTAPFDKSKSDFFLI-EDRDKFFLPSTRNRIVYY--------------------------ILSR-----CSYIRDECGERDKK--------------------------GIKRLLNNSTYTAAFPLHDS-RYWTKSKDVNCDSDRYNLYKYWAGFFSFFKEQPLNLIRKYYGEKIGLYFAWLGFYTEMLFFAAVVGTLCFVYGVLTYDDNEWSKEICSDEIGGNIVMCPL--CDKKCGFWKLNTTCNSSWQSHLFDNVGTVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYET---KCNSRKLNRITQEMEPYLPI-TSKCARICLSGATVLLWISLIIACIIGVIAYRLAVYAAFASIMKDSPTSNLEVVGPYITPQLATSVTASCINFVIIMILNLMYERVAVWITDMEIPKTHLEYENKLTVKMFLFQFVNYYSSCFYVAFFKGKFVGYPGDYAYMFGKWSKLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALVPWLMNWWASRKARSYPESLYS-------------------------------------RWEQDHDLQGFGQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALFNNIIEIRVDAWKLTTQFRRPVAAKAHCIGAWEEILNGMAVLSVVTNAFIVAFTSDMIPRLVYMYAYQPEGEMNMKGYINNSLSVFNISEIPLPNRPEDGENPLWFNSSITTCRYRDYRNPPGHEN--QYSHTMQFWHILAAKLAFIIIMEHVVFLVKYFVAWMIPDVPSDVKARVKRERYLVQEYLHNYEVEKLKIQLSQQ 889          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:101164640])

HSP 1 Score: 421.779 bits (1083), Expect = 1.239e-129
Identity = 315/975 (32.31%), Postives = 479/975 (49.13%), Query Frame = 1
Query:  139 INDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNI-FNINE--LKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ---GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA--RPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSF----SLMRMHHSRTISNMSSIIT-----AATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLN--GFTDFSLSYMNSSEF---NATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSK 2982
            I   ++  + +FF DGVR+IDFVL Y    D    Q +R  F  +L+K GLE+EI+D                    S S      F+K+ A WE L  YA+VLKI+           F    I        ++L+  F + E  ++P P  FT P+ KSK   F I ED   FF  + R+ IV Y                          ILSR      + I DE    +                            GI +L++   + +A+ LH+         +   +++R  LYK+W    + F+ QPL+ I+ Y+GEK+  YFAWLG+YT  L   +++G +  +Y ++   ++   KEI     G NI MCPL    + C FWKL+   +  +   L DN  TV  A+ M IW +LFLE WKR+Q +L Y W++ D E E +    RPE+     K   +K N I+ + EP++P    +   +  + +TVLL I++ +A + G+I Y+L  +    S+M+   +  +  +   IT     + T S ++ VIIM L L+Y RVAVW+TDME  +T  +Y++ +T+K++L +F+N YSS FY+ F +      P      F   S ++   C  GGCL++L+ QL  +M GKQ+  +I+E  +P L++     K +   E L +                                     R   D+ L   G   LF EYLEM+IQFGFIT+F+ +FPLAPLLAL NN+ EIR DA K     RRPVA +   IG W  I++ +A ++V +NA ++AF +  I +L+Y+  Y   G +N  G+ + SLS  N SE    N    G + L   ++ T CRY  +R+PP       YS+T  +W ILAAK+ F+ + E++V+L    +A +IPDVP  ++  +KRE  L  E +   ++ ++K Q + +
Sbjct:  107 IQKQQQSKDSVFFRDGVRRIDFVLSYVDDKDGERKQERRRVFEANLVKVGLELEIEDK-------------------SESDDRKTYFVKIHAPWEVLATYADVLKIK---------VPFKANDIPDNSEMPMNWLSTPFRLPEPIMQPEPDFFTAPFDKSKSDFFLI-EDRDKFFLPSTRNRIVYY--------------------------ILSR-----CSYIRDECGERDKK--------------------------GIKRLLNNSTYTAAFPLHDS-RYWTKSKDVNCDSDRYNLYKYWAGFFSFFKEQPLNLIRKYYGEKIGLYFAWLGFYTEMLFFAAVVGTLCFVYGVLTYDDNEWSKEICSDEIGGNIVMCPL--CDKKCGFWKLNTTCNSSWQSHLFDNVGTVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYET---KCNSRKLNRITQEMEPYLPI-TSKCARICLSGATVLLWISLIIACIIGVIAYRLAVYAAFASIMKDSPTSNLEVVGPYITPQLATSVTASCINFVIIMILNLMYERVAVWITDMEIPKTHLEYENKLTVKMFLFQFVNYYSSCFYVAFFKGKFVGYPGDYAYMFGKWSKLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALVPWLMNWWASRKARSYPESLYS-------------------------------------RWEQDHDLQGFGQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALFNNIIEIRVDAWKLTTQFRRPVAAKAHCIGAWEEILNGMAVLSVVTNAFIVAFTSDMIPRLVYMYAYQPEGEMNMKGYINNSLSVFNISEIPLPNRPEDGENPLWFNSSITTCRYRDYRNPPGHEN--QYSHTMQFWHILAAKLAFIIIMEHVVFLVKYFVAWMIPDVPSDVKARVKRERYLVQEYLHNYEVEKLKIQLSQQ 949          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:101164640])

HSP 1 Score: 421.394 bits (1082), Expect = 4.469e-129
Identity = 315/971 (32.44%), Postives = 477/971 (49.12%), Query Frame = 1
Query:  139 INDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNI-FNINE--LKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ---GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA--RPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSF----SLMRMHHSRTISNMSSIIT-----AATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLN--GFTDFSLSYMNSSEF---NATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ 2970
            I   ++  + +FF DGVR+IDFVL Y    D    Q +R  F  +L+K GLE+EI+D                    S S      F+K+ A WE L  YA+VLKI+           F    I        ++L+  F + E  ++P P  FT P+ KSK   F I ED   FF  + R+ IV Y                          ILSR      + I DE    +                            GI +L++   + +A+ LH+         +   +++R  LYK+W    + F+ QPL+ I+ Y+GEK+  YFAWLG+YT  L   +++G +  +Y ++   ++   KEI     G NI MCPL    + C FWKL+   +  +   L DN  TV  A+ M IW +LFLE WKR+Q +L Y W++ D E E +    RPE+     K   +K N I+ + EP++P    +   +  + +TVLL I++ +A + G+I Y+L  +    S+M+   +  +  +   IT     + T S ++ VIIM L L+Y RVAVW+TDME  +T  +Y++ +T+K++L +F+N YSS FY+ F +      P      F   S ++   C  GGCL++L+ QL  +M GKQ+  +I+E  +P L++     K +   E L +                                     R   D+ L   G   LF EYLEM+IQFGFIT+F+ +FPLAPLLAL NN+ EIR DA K     RRPVA +   IG W  I++ +A ++V +NA ++AF +  I +L+Y+  Y   G +N  G+ + SLS  N SE    N    G + L   ++ T CRY  +R+PP       YS+T  +W ILAAK+ F+ + E++V+L    +A +IPDVP  ++  +KRE  L  E +   ++ ++K Q
Sbjct:  158 IQKQQQSKDSVFFRDGVRRIDFVLSYVDDKDGERKQERRRVFEANLVKVGLELEIEDK-------------------SESDDRKTYFVKIHAPWEVLATYADVLKIK---------VPFKANDIPDNSEMPMNWLSTPFRLPEPIMQPEPDFFTAPFDKSKSDFFLI-EDRDKFFLPSTRNRIVYY--------------------------ILSR-----CSYIRDECGERDKK--------------------------GIKRLLNNSTYTAAFPLHDS-RYWTKSKDVNCDSDRYNLYKYWAGFFSFFKEQPLNLIRKYYGEKIGLYFAWLGFYTEMLFFAAVVGTLCFVYGVLTYDDNEWSKEICSDEIGGNIVMCPL--CDKKCGFWKLNTTCNSSWQSHLFDNVGTVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYET---KCNSRKLNRITQEMEPYLPI-TSKCARICLSGATVLLWISLIIACIIGVIAYRLAVYAAFASIMKDSPTSNLEVVGPYITPQLATSVTASCINFVIIMILNLMYERVAVWITDMEIPKTHLEYENKLTVKMFLFQFVNYYSSCFYVAFFKGKFVGYPGDYAYMFGKWSKLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALVPWLMNWWASRKARSYPESLYS-------------------------------------RWEQDHDLQGFGQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALFNNIIEIRVDAWKLTTQFRRPVAAKAHCIGAWEEILNGMAVLSVVTNAFIVAFTSDMIPRLVYMYAYQPEGEMNMKGYINNSLSVFNISEIPLPNRPEDGENPLWFNSSITTCRYRDYRNPP--GHENQYSHTMQFWHILAAKLAFIIIMEHVVFLVKYFVAWMIPDVPSDVKARVKRERYLVQEYLHNYEVEKLKIQ 996          
BLAST of Anoctamin vs. Ensembl Medaka
Match: ano5a (anoctamin 5 [Source:NCBI gene;Acc:101164640])

HSP 1 Score: 421.394 bits (1082), Expect = 5.722e-129
Identity = 315/971 (32.44%), Postives = 479/971 (49.33%), Query Frame = 1
Query:  139 INDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNI-FNINE--LKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQ---GTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPA--RPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSF----SLMRMHHSRTISNMSSIIT-----AATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPS-----FRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLN--GFTDFSLSYMNSSEF---NATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQ 2970
            I   ++  + +FF DGVR+IDFVL Y    D    Q +R  F  +L+K GLE+EI+D                    S S      F+K+ A WE L  YA+VLKI+           F    I        ++L+  F + E  ++P P  FT P+ KSK   F I ED   FF  + R+ IV Y                          ILSR      + I DE    +                            GI +L++   + +A+ LH+         +   +++R  LYK+W    + F+ QPL+ I+ Y+GEK+  YFAWLG+YT  L   +++G +  +Y ++   ++   KEI     G NI MCPL    + C FWKL+   +  +   L DN  TV  A+ M IW +LFLE WKR+Q +L Y W++ D E E +    RPE+     K   +K N I+ + EP++P    +   +  + +TVLL I++ +A + G+I Y+L  +    S+M+   +  +  +   IT     + T S ++ VIIM L L+Y RVAVW+TDME  +T  +Y++ +T+K++L +F+N YSS FY+ F +      P      F   S ++   C  GGCL++L+ QL  +M GKQ+  +I+E  +P L++     K +   E L ++                            W+          D+ L   G   LF EYLEM+IQFGFIT+F+ +FPLAPLLAL NN+ EIR DA K     RRPVA +   IG W  I++ +A ++V +NA ++AF +  I +L+Y+  Y   G +N  G+ + SLS  N SE    N    G + L   ++ T CRY  +R+PP       YS+T  +W ILAAK+ F+ + E++V+L    +A +IPDVP  ++  +KRE  L  E +   ++ ++K Q
Sbjct:  172 IQKQQQSKDSVFFRDGVRRIDFVLSYVDDKDGERKQERRRVFEANLVKVGLELEIEDK-------------------SESDDRKTYFVKIHAPWEVLATYADVLKIK---------VPFKANDIPDNSEMPMNWLSTPFRLPEPIMQPEPDFFTAPFDKSKSDFFLI-EDRDKFFLPSTRNRIVYY--------------------------ILSR-----CSYIRDECGERDKK--------------------------GIKRLLNNSTYTAAFPLHDS-RYWTKSKDVNCDSDRYNLYKYWAGFFSFFKEQPLNLIRKYYGEKIGLYFAWLGFYTEMLFFAAVVGTLCFVYGVLTYDDNEWSKEICSDEIGGNIVMCPL--CDKKCGFWKLNTTCNSSWQSHLFDNVGTVFFAIFMGIWVTLFLEFWKRRQARLEYEWDLVDFEEEQQQLQLRPEYET---KCNSRKLNRITQEMEPYLPI-TSKCARICLSGATVLLWISLIIACIIGVIAYRLAVYAAFASIMKDSPTSNLEVVGPYITPQLATSVTASCINFVIIMILNLMYERVAVWITDMEIPKTHLEYENKLTVKMFLFQFVNYYSSCFYVAFFKGKFVGYPGDYAYMFGKWSKLRNEECDPGGCLIELTTQLVIVMTGKQVWGNIQEALVPWLMNWWASRKARSYPESLYSR----------------------------WE---------QDHDLQGFGQLGLFYEYLEMVIQFGFITLFVASFPLAPLLALFNNIIEIRVDAWKLTTQFRRPVAAKAHCIGAWEEILNGMAVLSVVTNAFIVAFTSDMIPRLVYMYAYQPEGEMNMKGYINNSLSVFNISEIPLPNRPEDGENPLWFNSSITTCRYRDYRNPP--GHENQYSHTMQFWHILAAKLAFIIIMEHVVFLVKYFVAWMIPDVPSDVKARVKRERYLVQEYLHNYEVEKLKIQ 1010          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000033728.1 (SMESG000033728.1)

HSP 1 Score: 1713.74 bits (4437), Expect = 0.000e+0
Identity = 865/867 (99.77%), Postives = 865/867 (99.77%), Query Frame = 1
Query:   97 MSNEDEILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLG 2697
            MSNEDEILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFA EDISNKTVDFGIAKLISEGVFDSAYILHERPLNEDDDLENVENNERNLLYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITIFIPAFPLAPLLALTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLT G
Sbjct:    1 MSNEDEILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFAFEDISNKTVDFGIAKLISEGVFDSAYILHERPLNEDDDLENVENNERNLLYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITIFIPAFPLAPLLALTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTWG 867          

HSP 2 Score: 92.8189 bits (229), Expect = 9.472e-19
Identity = 43/43 (100.00%), Postives = 43/43 (100.00%), Query Frame = 2
Query: 2693 WGLMKRIADILDFGIRHGKRNMNLIHIHLSIGKYSLQKLYSFT 2821
            WGLMKRIADILDFGIRHGKRNMNLIHIHLSIGKYSLQKLYSFT
Sbjct:  866 WGLMKRIADILDFGIRHGKRNMNLIHIHLSIGKYSLQKLYSFT 908          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000033732.1 (SMESG000033732.1)

HSP 1 Score: 936.406 bits (2419), Expect = 0.000e+0
Identity = 507/969 (52.32%), Postives = 678/969 (69.97%), Query Frame = 1
Query:  142 NDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETF---DFLNIFNIN--ELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTW------KVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSKLVADSFKKSAV 3015
            N+ +K N GMFF D VR+IDFVLVY+++ D+   + KR++F++SL+ EGLEIEIQ+ G ++    ++   ++D +   S   N+VF+K+ A+W+TLCRYAE++KIRK +++ G +Y++    IFQ  FE F   DF  IF+I+   LKPI +G+T P+SK K YLFDIP + + FFT  ERSLIVNYIL+R  Y     K   +P+      ++ + +  VE+  I  +   N  +  TN    +G             ++FGIAKLISE VF++A+ILHE+      + +  + N R LLYKHW ++ NIFR QPLDHI+LYFGE VAFYFAWLG+YT+WL PI+L G+ V++YN+     DI+++EI +  NITMCP+ C    C  WKLS  Y +F+LIRL+DNGATV++A V+S+W  LFLEMW+R+Q  LA+ WNVHD+E EDEP RPE+ AL++KNY  + N ISGKEEPFI FW+  +P+   T ST+L SI + LA L GI + K +  +L+R+  +  +S +S   TAA GSL+SL+ I+ LT VYSRVAVWLTD+EHHRTQSQYD+SVT KLY+LEFINNYSS+FYIGF  P+T+  P   S SMIKP+GC  G CLLDLS+QL FI++GKQIIS+I  +++PRL S++K Y++K+A+ K I +             I D   I + +C D +      K++ EL  CY DNILSDP PRPLF EYLEM+IQFGFITIFI  FPLAPLLA+ NNL EIRSDA KF    RRPVAQRVKDIGIW+ I++ +A I VKSNA+LIAFAT+YID++IYII +S N  L GF DFSLS+MN++EFN +       +  +NET+C Y GFR+PPW+   EP SYTPV+WQ+LAAK+ FVYLFE  V LF+ I  ++IP++PD+ RIAMKREA +TNE ILK +L + +N + +  +A S KK+ +
Sbjct:   18 NEKEKNNKGMFFTDRVRRIDFVLVYQQLLDSEEKRNKRISFIESLIDEGLEIEIQNIGGRIINIADSVNENSDDITCES--KNLVFVKIHASWDTLCRYAEIMKIRKSIMNAGVDYNY----IFQSFFEKFVDFDFFRIFSIDNKRLKPIAQGYTYPFSKQKYYLFDIPVNRSEFFTPVERSLIVNYILKRKGY-----KSNHKPIS-----NLSNEKMLVELEPIHSDKRSNSNDSITNEVEENGS-----------NLNFGIAKLISEKVFETAFILHEK----FSNGKYKKENMRVLLYKHWATLTNIFRHQPLDHIRLYFGEMVAFYFAWLGFYTFWLFPIALFGVCVTIYNLATIPRDIIIQEISERNNITMCPVFCIEGSCESWKLSAGYVQFYLIRLIDNGATVILAGVVSVWVFLFLEMWERKQFTLAFRWNVHDLEVEDEPLRPEYAALLEKNYISQFNKISGKEEPFISFWKNTLPIQMLTISTILFSIVLTLACLTGITVTKTIIRNLLRLQLTYVMSKLS---TAAIGSLISLITIIILTSVYSRVAVWLTDLEHHRTQSQYDNSVTGKLYILEFINNYSSMFYIGFAHPYTKVKPGSDSFSMIKPQGCLTGDCLLDLSMQLIFILVGKQIISNIINFSIPRLCSSIKEYRIKRADSKFIKRRSVH------RPTITD-YEISEVECSDIYTDCNGVKLQSELKICYQDNILSDPEPRPLFKEYLEMIIQFGFITIFILPFPLAPLLAIINNLMEIRSDAKKFVTVYRRPVAQRVKDIGIWMDILTTIAKIVVKSNALLIAFATSYIDRMIYIIVHSRNFDLGGFVDFSLSFMNTTEFNIS-------SSISNETHCSYIGFRYPPWDVHNEPMSYTPVFWQMLAAKIAFVYLFETFVSLFVKIFLMIIPNIPDEYRIAMKREAAITNEFILKIELEEHRNIYEANNLAKSLKKTII 938          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000033730.1 (SMESG000033730.1)

HSP 1 Score: 857.055 bits (2213), Expect = 0.000e+0
Identity = 466/931 (50.05%), Postives = 631/931 (67.78%), Query Frame = 1
Query:  160 NNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMN--FDTNCQAPSGDKPFA-LEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILK 2943
            NNG+FF DG+R+IDFVL Y+++NDN  N+  R  FLK L+K+GLE EIQD+   ++  +    +DN           IVFIK+FA WETLC YAE+L+IRK +L       + +   F++ F  FD  N++  N        FT P+S SKEYLFDIP +   FF   ERSLIVNYILR  + +   +KC I   +I   +   S   D+EM T +  N+ +E +     N +   G      L   ++K  +  +  LISE VF+SAY LHE       +    + ++R  LYK W   RNI R QPLD I+ YFGEK+AFYF+WLG+YTYWL   SLLG++++++NI++ S+DI+V EI +G NITMCPL+C+S+ C+FWKLSD Y +FF+IR+LDN   VLMA  MSIWASLFLEMWKR+Q +LA+HWNV+D++ + EP +PEFVA I +N   K N      E  +PFWRR +P MFF +STVL S+ +ALAFL GIILY++V ++L+ MH S  ++ MS++I + TGS++SL++I+ LT+VY+++A WLT +E++ TQS+YD SVT+KLYLLEFINNYS +FY GFI P  QPIP F++ S +KP GCP GGCL  LS+QLAFIMIG+Q+ISH  EY+ P L S++K+YKL++               ++V+   K+              V  E+IRCY D +L+D   +P+F EYLEMLIQFGFIT+FIPAFPLAPLLAL NNL EIR+DA KF  A +RPVAQRVKDIG W++I+S+VA +AVKSNAILIAF T +I++L+YI+ YS  G L GF+DF+LSY+ SSEF ++          TNETYCRY  FR+ P + K  P + T +YW+ILAAKV+FVYLFEN+VY  M II+  IP+  +++   + +E T++ +++LK
Sbjct:   20 NNGLFFTDGIRQIDFVLAYQKLNDNERNRKIRSKFLKILMKQGLEFEIQDEEGNLFSLEN---FDNQD-----DTKKIVFIKLFAKWETLCHYAELLRIRKPILHPPSSIKYEQSLSFRKYFRKFDIFNLYFGNSFHSRTHTFTMPFSSSKEYLFDIPANRQYFFIQTERSLIVNYILRSITLQCNRNKCNI-LANILHPKSTPSSITDMEMRTFSTINSESECSKSHSNNDETDEGLTEIQHLIQTNDKLTNMSLHNLISEQVFESAYCLHE--SFIVQNSLKRDESDRVNLYKCWGLTRNICRSQPLDSIRSYFGEKIAFYFSWLGFYTYWLFFPSLLGLVITVFNILHASSDIIVNEIKEGGNITMCPLLCNSKQCKFWKLSDVYYKFFVIRILDNKTMVLMAFSMSIWASLFLEMWKREQFRLAFHWNVYDLQNQYEPQKPEFVAFITQNQTDKGN------ESSVPFWRRTVPFMFFKFSTVLFSVILALAFLVGIILYEIVIYALLMMHPSPLVTQMSNVIISVTGSIISLIVILLLTMVYAKLAHWLTGLENNETQSEYDDSVTMKLYLLEFINNYSYLFYFGFILPLIQPIPGFKAMSDLKPIGCPTGGCLFGLSVQLAFIMIGRQLISHFTEYSYPLLCSSIKKYKLRK--------------CNKVKYRSKNITN-----------VNAEIIRCYDDLLLADLESQPVFYEYLEMLIQFGFITMFIPAFPLAPLLALFNNLLEIRNDATKFLTAYKRPVAQRVKDIGTWINILSVVAGLAVKSNAILIAFTTFFIERLLYILKYSPTGDLKGFSDFTLSYLKSSEFASS----------TNETYCRYMDFRYHPLDIKNGPLTLTSIYWEILAAKVIFVYLFENVVYTIMKIISATIPNQNERITKEITKEVTISRKLLLK 898          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000033730.1 (SMESG000033730.1)

HSP 1 Score: 530.406 bits (1365), Expect = 2.655e-175
Identity = 285/584 (48.80%), Postives = 391/584 (66.95%), Query Frame = 1
Query:  160 NNGMFFVDGVRKIDFVLVYERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMN--FDTNCQAPSGDKPFA-LEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYS 1902
            NNG+FF DG+R+IDFVL Y+++NDN  N+  R  FLK L+K+GLE EIQD+   ++  +    +DN           IVFIK+FA WETLC YAE+L+IRK +L       + +   F++ F  FD  N++  N        FT P+S SKEYLFDIP +   FF   ERSLIVNYILR  + +   +KC I   +I   +   S   D+EM T +  N+ +E +     N +   G      L   ++K  +  +  LISE VF+SAY LHE       +    + ++R  LYK W   RNI R QPLD I+ YFGEK+AFYF+WLG+YTYWL   SLLG++++++NI++ S+DI+V EI +G NITMCPL+C+S+ C+FWKLSD Y +FF+IR+LDN   VLMA  MSIWASLFLEMWKR+Q +LA+HWNV+D++ + EP +PEFVA I +N   K N      E  +PFWRR +P MFF +STVL S+ +ALAFL GIILY++V ++L+ MH S  ++ MS++I + TGS++SL++I+ LT+VY+++A WLT +E++ TQS+YD SVT+KLYLLEFINNYS
Sbjct:   20 NNGLFFTDGIRQIDFVLAYQKLNDNERNRKIRSKFLKILMKQGLEFEIQDEEGNLFSLEN---FDNQD-----DTKKIVFIKLFAKWETLCHYAELLRIRKPILHPPSSIKYEQSLSFRKYFRKFDIFNLYFGNSFHSRTHTFTMPFSSSKEYLFDIPANRQYFFIQTERSLIVNYILRSITLQCNRNKCNI-LANILHPKSTPSSITDMEMRTFSTINSESECSKSHSNNDETDEGLTEIQHLIQTNDKLTNMSLHNLISEQVFESAYCLHE--SFIVQNSLKRDESDRVNLYKCWGLTRNICRSQPLDSIRSYFGEKIAFYFSWLGFYTYWLFFPSLLGLVITVFNILHASSDIIVNEIKEGGNITMCPLLCNSKQCKFWKLSDVYYKFFVIRILDNKTMVLMAFSMSIWASLFLEMWKREQFRLAFHWNVYDLQNQYEPQKPEFVAFITQNQTDKGN------ESSVPFWRRTVPFMFFKFSTVLFSVILALAFLVGIILYEIVIYALLMMHPSPLVTQMSNVIISVTGSIISLIVILLLTMVYAKLAHWLTGLENNETQSEYDDSVTMKLYLLEFINNYS 586          
BLAST of Anoctamin vs. Planmine SMEST
Match: SMESG000006381.1 (SMESG000006381.1)

HSP 1 Score: 385.185 bits (988), Expect = 1.253e-117
Identity = 297/944 (31.46%), Postives = 460/944 (48.73%), Query Frame = 1
Query:  163 NGMFFVDGVRKIDFVLVY-ERINDNRTNQIKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIVFIKVFATWETLCRYAEVLKIRKQMLSL-GFEYDFNRKTIFQRLFETFDFLNIFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILRRASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTNCQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPXXXXXXXXXXXXXXXXXXYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTYWLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTN-ITMCPLMCSSRGCRFWKLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWNVHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFFTYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATGSLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINNYSSIFYIGFIQPFTQPIPSFRSSSM-IKPRGCPAGGCLLDLSLQLAFIMIGKQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKDKATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFITXXXXXXXXXXXXXXTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSIMSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMNSSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQILAAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKADLLQMKNQHTSK 2982
            +G +F DG  KIDF+L + E+  +  +  + R  F  +L K GLE+E                 D D  G         +IK++  WE +CR+AE L +R  + +      D++ K +           NI  ++     P  +T  + +SK + F    +  T+F++ +R  +VN IL    Y R                    R+ ++ +  + D+   +          P  + P+      +KT      +L      +S  IL+E                      +W      ++ QPLDHI+ YFGEK+ FYFAW+G YT WLLP S++GI V LY +     +I  KEI  G N   MCPL     GC++W+L D      +  L D+  T+  ++ M++WA  FLE WKR+   LA+HW+V D E E+E  R ++ AL       + N ++G  EP+ P   RR+P +      +LL + + + F+  +I+Y+++    + M  +  + N +      T ++++LV+IM L  VY  +A+ LT+ E HRTQS +D+ +  K++L +F+N YSSIFYI F +      P   S    ++   C  GGCL++L++QLA IM+GKQIIS+I+E  +P+L +   R+     E+    Q D+                     C ++      LI    DN L       L  EYLE+++QFGFITIF+ AFPLAP  AL NN  EIR DA K     +RPVA+R KDIG+W  I+  + TIA  SNA L+AF + ++ KL Y   +     L+G+T+ SLS+   S  N+T+              CRY G+R      K         +W++LA ++ FV +FE+ V     ++ ++IPDVP +L I +KRE  L  + +  ADL+  +     K
Sbjct:   36 SGYYFNDGKSKIDFILAWSEKEKEPHSKALYRKKFESNLKKAGLELE----------------EDFDETGK------FHYIKIYVPWEIMCRFAEKLALRAPLQAHPNPSDDWSMKAL-----NCLHIPNIMYLDAPNKPPDFYTCEFKQSKIHRFLGSNNKLTYFSSTQRHQVVNEILETQLYGR-------------------RRKGEIGIKRMVDDEIYDSA-------YPLHEGPYE----CSKT------ELEQPEKLNSRQILYE----------------------YWARYGRWYQYQPLDHIREYFGEKIGFYFAWMGLYTAWLLPASIIGIFVFLYGVFTFDRNISAKEICAGNNSFYMCPLCDEKIGCQYWELKDVCMFIKIAYLFDHPGTIFYSIFMAMWAVTFLEYWKRKNASLAHHWDVMDYEEEEERPRAQYAALCSIF---QKNPVTGVIEPYFPK-ERRLPRILTGIVCILLMMTVVIIFIIAVIIYRVL--IEIPMFQNPLLRNNAVTFANGTAAIVNLVLIMCLAKVYEIIALKLTEWEMHRTQSDFDNQLIFKVFLFQFVNFYSSIFYIAFFKGRFVGYPGNYSYFFGLRNEDCQNGGCLIELAMQLAIIMVGKQIISNIQEVIVPKLQTWFYRFSKGLGEQV---QHDS---------------------CSNS-----GLIIYKEDNKLIP--YEGLLDEYLEIVLQFGFITIFVAAFPLAPFFALLNNWMEIRLDAQKLVCETQRPVAERAKDIGVWFVILESITTIACISNAFLLAFTSEFLPKLYYRYRFDS---LDGYTNHSLSW---SPKNSTVIP------------CRYPGYRDNDGILK-------QYFWELLAVRLGFVIVFEHTVAGIGKLLDLLIPDVPKELYIKIKRETYLAKQALQDADLITWETFENEK 832          
The following BLAST results are available for this feature:
BLAST of Anoctamin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANO42.854e-12631.99anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837][more]
ANO48.587e-12631.96anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837][more]
ANO15.464e-12531.28anoctamin 1 [Source:HGNC Symbol;Acc:HGNC:21625][more]
ANO49.030e-12531.96anoctamin 4 [Source:HGNC Symbol;Acc:HGNC:23837][more]
ANO12.549e-12229.51anoctamin 1 [Source:HGNC Symbol;Acc:HGNC:21625][more]
back to top
BLAST of Anoctamin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
anoh-12.648e-3825.22Anoctamin [Source:UniProtKB/TrEMBL;Acc:C0P286][more]
anoh-12.750e-3825.22Anoctamin [Source:UniProtKB/TrEMBL;Acc:C0P286][more]
anoh-23.689e-2527.92Anoctamin [Source:UniProtKB/TrEMBL;Acc:H2L2L3][more]
anoh-24.734e-2527.92Anoctamin [Source:UniProtKB/TrEMBL;Acc:H2L2L3][more]
back to top
BLAST of Anoctamin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
subdued4.584e-15335.42gene:FBgn0038721 transcript:FBtr0083806[more]
subdued4.584e-15335.42gene:FBgn0038721 transcript:FBtr0334921[more]
subdued2.732e-15135.42gene:FBgn0038721 transcript:FBtr0083805[more]
subdued6.377e-14934.64gene:FBgn0038721 transcript:FBtr0334922[more]
subdued2.753e-14734.64gene:FBgn0038721 transcript:FBtr0302492[more]
back to top
BLAST of Anoctamin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ano35.138e-12732.60anoctamin 3 [Source:ZFIN;Acc:ZDB-GENE-111031-3][more]
ano5a6.887e-12230.85anoctamin 5a [Source:ZFIN;Acc:ZDB-GENE-091013-2][more]
ano5b6.340e-12130.89anoctamin 5b [Source:ZFIN;Acc:ZDB-GENE-061215-108][more]
ano5a1.114e-11930.78anoctamin 5a [Source:ZFIN;Acc:ZDB-GENE-091013-2][more]
ano111.999e-11634.53anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
back to top
BLAST of Anoctamin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANO51.153e-12232.24anoctamin 5 [Source:NCBI gene;Acc:100489787][more]
ANO51.748e-12232.24anoctamin 5 [Source:NCBI gene;Acc:100489787][more]
ANO42.050e-12231.97major histocompatibility complex class I-related g... [more]
ANO49.422e-12232.11major histocompatibility complex class I-related g... [more]
ANO52.181e-11731.72anoctamin 5 [Source:NCBI gene;Acc:100489787][more]
back to top
BLAST of Anoctamin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ano13.631e-12831.61anoctamin 1, calcium activated chloride channel [S... [more]
Ano16.506e-12831.65anoctamin 1, calcium activated chloride channel [S... [more]
Ano11.649e-12631.63anoctamin 1, calcium activated chloride channel [S... [more]
Ano42.698e-12632.12anoctamin 4 [Source:MGI Symbol;Acc:MGI:2443344][more]
Ano42.698e-12632.12anoctamin 4 [Source:MGI Symbol;Acc:MGI:2443344][more]
back to top
BLAST of Anoctamin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8C5H1|ANO4_MOUSE3.720e-12531.99Anoctamin-4 OS=Mus musculus OX=10090 GN=Ano4 PE=1 ... [more]
sp|Q32M45|ANO4_HUMAN4.124e-12531.96Anoctamin-4 OS=Homo sapiens OX=9606 GN=ANO4 PE=2 S... [more]
sp|A6QLE6|ANO4_BOVIN4.584e-12531.99Anoctamin-4 OS=Bos taurus OX=9913 GN=ANO4 PE=2 SV=... [more]
sp|Q8BHY3|ANO1_MOUSE2.504e-12233.14Anoctamin-1 OS=Mus musculus OX=10090 GN=Ano1 PE=1 ... [more]
sp|Q5XXA6|ANO1_HUMAN4.240e-11731.06Anoctamin-1 OS=Homo sapiens OX=9606 GN=ANO1 PE=1 S... [more]
back to top
BLAST of Anoctamin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4FF500.000e+042.94Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4FDS20.000e+042.04Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4FBC00.000e+041.92Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
U6JHY60.000e+040.34Anoctamin OS=Echinococcus granulosus OX=6210 GN=EG... [more]
A0A087W0850.000e+040.14Anoctamin OS=Echinococcus multilocularis OX=6211 G... [more]
back to top
BLAST of Anoctamin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ano5a6.199e-12831.56anoctamin 5 [Source:NCBI gene;Acc:103044829][more]
ano5a1.561e-12731.48anoctamin 5 [Source:NCBI gene;Acc:103044829][more]
ano5a1.714e-12731.48anoctamin 5 [Source:NCBI gene;Acc:103044829][more]
ano5a8.246e-12731.51anoctamin 5 [Source:NCBI gene;Acc:103044829][more]
ano5a1.364e-12631.72anoctamin 5 [Source:NCBI gene;Acc:103044829][more]
back to top
BLAST of Anoctamin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ano117.153e-10731.32anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
ENSPMAT00000000399.14.785e-9235.34pep scaffold:Pmarinus_7.0:GL477564:2673:43187:-1 g... [more]
ano37.872e-7634.94anoctamin 3 [Source:ZFIN;Acc:ZDB-GENE-111031-3][more]
ano111.525e-6433.71anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
ano112.976e-6334.23anoctamin 11 [Source:ZFIN;Acc:ZDB-GENE-090313-245][more]
back to top
BLAST of Anoctamin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Anoctamin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO498553.568e-13333.48Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7REV0][more]
EDO480501.565e-11433.43Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RKU9][more]
EDO498541.249e-10834.64Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7REU8][more]
EDO480486.020e-10634.72Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RKU7][more]
EDO480491.914e-9832.37Anoctamin [Source:UniProtKB/TrEMBL;Acc:A7RKU8][more]
back to top
BLAST of Anoctamin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ano5a1.110e-13032.27anoctamin 5 [Source:NCBI gene;Acc:101164640][more]
ano5a3.877e-13032.31anoctamin 5 [Source:NCBI gene;Acc:101164640][more]
ano5a1.239e-12932.31anoctamin 5 [Source:NCBI gene;Acc:101164640][more]
ano5a4.469e-12932.44anoctamin 5 [Source:NCBI gene;Acc:101164640][more]
ano5a5.722e-12932.44anoctamin 5 [Source:NCBI gene;Acc:101164640][more]
back to top
BLAST of Anoctamin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033728.19.472e-1999.77SMESG000033728.1[more]
SMESG000033732.10.000e+052.32SMESG000033732.1[more]
SMESG000033730.10.000e+050.05SMESG000033730.1[more]
SMESG000033730.12.655e-17548.80SMESG000033730.1[more]
SMESG000006381.11.253e-11731.46SMESG000006381.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016964 ID=SMED30016964|Name=Anoctamin|organism=Schmidtea mediterranea sexual|type=transcript|length=3498bp
TAGTTTTATTTAAATTGCAATTTCAGAAACTGAAATTTTTATAAATCTAA
TTTTATAAAACTATTTAACTTTGTTAAATATTTTTTATTTACCATTATGT
CAAATGAAGATGAAATTCTAGCTGCTGATAATCCTGATATCAATGATGAT
AAAAAATATAATAATGGAATGTTTTTCGTTGATGGTGTTAGGAAAATTGA
TTTTGTTCTAGTATATGAAAGAATAAATGACAATCGAACAAATCAAATAA
AGCGAATGACCTTTCTAAAATCTTTATTGAAAGAGGGTTTAGAAATAGAA
ATTCAAGATGACGGATGTAAAGTTTATCCATTTAAAGAGAATAGTTACTA
TGACAATGATAGTGTCGGATCTCCAAGTCATCGTAGCAATATCGTTTTCA
TTAAAGTTTTTGCAACCTGGGAAACTCTTTGTCGTTATGCAGAAGTTTTG
AAAATTCGAAAGCAAATGTTAAGTCTTGGATTCGAATATGATTTTAATCG
GAAAACAATATTCCAAAGGCTATTTGAAACGTTTGATTTCCTTAATATTT
TTAATATTAATGAATTGAAACCGATTCCTCGAGGTTTCACTACTCCTTAT
TCCAAATCTAAGGAATATTTATTCGATATTCCCGAAGACAATGCGACATT
CTTCACTGCAGCTGAGCGAAGTTTAATTGTAAATTATATATTGAGACGTG
CATCTTATCGTCGGATATCGGACAAATGTGCAATTGAACCTGTCGACATA
GATGTTGTTGAAGACATTTTATCAAGGCGCTGTGATGTAGAAATGGCAAC
AATTACTGATGAAAATAATGTCAATGAAATGAATTTTGACACAAATTGTC
AAGCTCCCTCAGGAGATAAACCCTTTGCACTTGAGGATATATCTAACAAG
ACTGTCGATTTTGGAATAGCCAAACTCATTTCAGAAGGTGTATTTGACAG
TGCATATATTCTTCACGAGAGACCCTTGAATGAAGATGATGATCTTGAAA
ATGTTGAAAATAATGAACGGAATTTGCTCTATAAACATTGGGTTTCTATG
CGAAACATTTTCAGGCTTCAGCCCTTGGATCATATTAAACTTTACTTTGG
TGAAAAGGTTGCATTCTATTTTGCTTGGCTAGGATACTATACTTATTGGC
TGCTGCCTATTTCACTTCTGGGAATTATTGTTAGCTTATATAATATCGTT
TATACCTCAAACGATATAGTTGTAAAAGAAATTTATCAGGGAACTAATAT
AACTATGTGCCCGTTAATGTGCTCTTCAAGAGGATGTCGGTTTTGGAAAC
TCTCAGACGCTTATAGTCGATTTTTTTTAATTCGTCTGTTGGATAATGGA
GCGACAGTATTAATGGCTGTGGTCATGTCAATATGGGCATCTTTATTTCT
GGAAATGTGGAAGCGACAACAGGTCCAATTGGCATATCACTGGAATGTCC
ATGATATGGAATATGAGGATGAACCTGCTAGGCCAGAATTTGTTGCGTTA
ATTGATAAAAACTACCCGAAAAAAACTAATCTAATATCAGGAAAAGAAGA
GCCATTTATTCCATTTTGGAGAAGAAGAATGCCCGTTATGTTTTTCACAT
ATTCAACTGTTTTATTATCTATTGCAATGGCACTAGCCTTTCTCGGGGGA
ATTATACTTTATAAGCTGGTTTCATTCTCATTGATGAGAATGCATCATAG
CCGCACGATTTCAAACATGTCAAGTATAATAACCGCAGCAACTGGTTCAC
TATTGTCTCTTGTTATCATAATGAGTTTAACTTTGGTGTACTCCAGAGTA
GCGGTTTGGCTTACCGATATGGAACATCACCGGACCCAGTCACAATATGA
TAGCAGTGTGACACTTAAACTCTACCTACTTGAATTTATCAATAACTATT
CATCTATTTTTTACATTGGTTTCATTCAACCATTTACTCAACCAATTCCA
AGTTTCAGATCTAGCTCTATGATCAAACCGAGAGGCTGCCCTGCCGGTGG
ATGCTTGCTAGATCTTTCTCTACAATTGGCTTTTATCATGATTGGTAAAC
AAATAATCAGTCACATTAAAGAATATGCCCTACCTCGTTTGGTATCTACG
GTGAAAAGATATAAACTAAAGCAAGCAGAAGAGAAACTAATCAACCAAAG
TGATGCAGAAATGGAAGCAGACAGAGTTGAAGTGGCTATCAAAGACAAGG
CAACAATCCTTGACCCTAAATGCATTGACACGTGGAAAGTCGAGCCTGAG
TTGATTCGTTGTTATGCGGATAACATTCTATCTGACCCCGGGCCTAGGCC
TCTATTTGGTGAATATCTTGAAATGTTAATTCAATTTGGTTTTATAACAA
TTTTTATTCCGGCTTTTCCTCTTGCACCTCTGTTGGCGTTGACAAATAAT
TTGTTTGAAATCCGCAGCGATGCGCTGAAATTCGCGAGAGCTCTGAGACG
TCCTGTTGCACAGCGGGTCAAAGACATCGGGATCTGGGTGAGCATCATGT
CGATGGTGGCAACCATTGCCGTTAAATCAAATGCAATATTAATCGCTTTT
GCAACGACCTATATCGATAAACTCATTTACATTATTGGTTACAGTGAAAA
CGGATTTTTAAATGGATTCACAGATTTTTCATTGTCTTATATGAATTCAT
CGGAATTCAACGCCACACTTTATGGTGGCCATAAGTTGACATTGGGGACT
AATGAAACGTATTGCAGATATTCTGGATTTCGGCATCCGCCATGGGAAAC
GAAATATGAACCTTATTCATATACACCTGTCTATTGGCAAATACTCGCTG
CAAAAGTTGTATTCGTTTACCTCTTTGAAAATCTTGTCTATCTCTTTATG
GCTATTATCGCTGTCGTGATTCCCGACGTACCTGATAAACTTCGGATCGC
AATGAAACGAGAAGCTACCTTAACAAACGAGATAATCCTGAAGGCTGATT
TGTTACAAATGAAAAATCAACACACATCTAAACTAGTCGCAGATTCCTTT
AAAAAGTCGGCAGTAATTGCGAAAAAGGATTCAACAGTCTTTTCAAAAAG
TCATAAATCATTTTTTCATGGTTTTAAATTTCACAACCAGCATAAGCCCA
GTCCGCCGTTATTGGGGAAGTCTCAAATCTCTCAGTCAGAAGAAGAACCA
GTTTAGAATCTCAAATTCTTTACTTTGGTTATTTTTATTTCAGTTTAATA
GAGAATTGTATCATTTTTAGATGTGTTGATTTTTTATGGTTTTTTAATGT
TCTATTGTATTTTTGGGCTTGAATTTATTTCTTTCAGTATTTAATCCTTT
TCTTTCTCTATTCTCAGTTTGTTCGTTTGATTTATTGTGACTTCTAGGAA
TATGAATGAGCTGTTTGTTAAATTTTGATTTTGTGGAGAAAAATTTGTAC
TTTTTTATAACAAATTTCTTTTATTGTATTTGACTGGTTTTGATTTTATT
GTTGTTTTTAATGCAATTATATTGATTATATTGTGCAAAGTATTTCAC
back to top

protein sequence of SMED30016964-orf-1

>SMED30016964-orf-1 ID=SMED30016964-orf-1|Name=SMED30016964-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1020bp
MSNEDEILAADNPDINDDKKYNNGMFFVDGVRKIDFVLVYERINDNRTNQ
IKRMTFLKSLLKEGLEIEIQDDGCKVYPFKENSYYDNDSVGSPSHRSNIV
FIKVFATWETLCRYAEVLKIRKQMLSLGFEYDFNRKTIFQRLFETFDFLN
IFNINELKPIPRGFTTPYSKSKEYLFDIPEDNATFFTAAERSLIVNYILR
RASYRRISDKCAIEPVDIDVVEDILSRRCDVEMATITDENNVNEMNFDTN
CQAPSGDKPFALEDISNKTVDFGIAKLISEGVFDSAYILHERPLNEDDDL
ENVENNERNLLYKHWVSMRNIFRLQPLDHIKLYFGEKVAFYFAWLGYYTY
WLLPISLLGIIVSLYNIVYTSNDIVVKEIYQGTNITMCPLMCSSRGCRFW
KLSDAYSRFFLIRLLDNGATVLMAVVMSIWASLFLEMWKRQQVQLAYHWN
VHDMEYEDEPARPEFVALIDKNYPKKTNLISGKEEPFIPFWRRRMPVMFF
TYSTVLLSIAMALAFLGGIILYKLVSFSLMRMHHSRTISNMSSIITAATG
SLLSLVIIMSLTLVYSRVAVWLTDMEHHRTQSQYDSSVTLKLYLLEFINN
YSSIFYIGFIQPFTQPIPSFRSSSMIKPRGCPAGGCLLDLSLQLAFIMIG
KQIISHIKEYALPRLVSTVKRYKLKQAEEKLINQSDAEMEADRVEVAIKD
KATILDPKCIDTWKVEPELIRCYADNILSDPGPRPLFGEYLEMLIQFGFI
TIFIPAFPLAPLLALTNNLFEIRSDALKFARALRRPVAQRVKDIGIWVSI
MSMVATIAVKSNAILIAFATTYIDKLIYIIGYSENGFLNGFTDFSLSYMN
SSEFNATLYGGHKLTLGTNETYCRYSGFRHPPWETKYEPYSYTPVYWQIL
AAKVVFVYLFENLVYLFMAIIAVVIPDVPDKLRIAMKREATLTNEIILKA
DLLQMKNQHTSKLVADSFKKSAVIAKKDSTVFSKSHKSFFHGFKFHNQHK
PSPPLLGKSQISQSEEEPV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR007632Anoctamin
IPR032394Anoct_dimer
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane