Dimer_Tnp_hAT domain-containing protein

Overview
NameDimer_Tnp_hAT domain-containing protein
Smed IDSMED30016961
Length (bp)1133
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dimer_Tnp_hAT domain-containing protein (SMED30016961) t-SNE clustered cells

Violin plots show distribution of expression levels for Dimer_Tnp_hAT domain-containing protein (SMED30016961) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dimer_Tnp_hAT domain-containing protein (SMED30016961) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dimer_Tnp_hAT domain-containing protein (SMED30016961) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016961

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30016961SMESG000079481.1 SMESG000064306.1 SMESG000055041.1 SMESG000052607.1 SMESG000047756.1 SMESG000036787.1 SMESG000035547.1 SMESG000026972.1 SMESG000026708.1 SMESG000025874.1 SMESG000023292.1 SMESG000007438.1 dd_Smed_v4_17002_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016961SMESG000079481.1 SMESG000064306.1 SMESG000055041.1 SMESG000052607.1 SMESG000047756.1 SMESG000036787.1 SMESG000035547.1 SMESG000026972.1 SMESG000026708.1 SMESG000025874.1 SMESG000023292.1 SMESG000007438.1 dd_Smed_v4_17002_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016961SMESG000079481.1 SMESG000064306.1 SMESG000055041.1 SMESG000052607.1 SMESG000047756.1 SMESG000036787.1 SMESG000035547.1 SMESG000026972.1 SMESG000026708.1 SMESG000025874.1 SMESG000023292.1 SMESG000007438.1 dd_Smed_v4_17002_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016961SMESG000079481.1 SMESG000064306.1 SMESG000055041.1 SMESG000052607.1 SMESG000047756.1 SMESG000036787.1 SMESG000035547.1 SMESG000026972.1 SMESG000026708.1 SMESG000025874.1 SMESG000023292.1 SMESG000007438.1 dd_Smed_v4_17002_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016961SMESG000064306.1 SMESG000047756.1 SMESG000079481.1 SMESG000055041.1 SMESG000052607.1 SMESG000036787.1 SMESG000035547.1 SMESG000026972.1 SMESG000026708.1 SMESG000025874.1 SMESG000023292.1 SMESG000016835.1 SMESG000007438.1 Contig40747uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016961SMESG000064306.1 SMESG000047756.1 SMESG000079481.1 SMESG000055041.1 SMESG000052607.1 SMESG000036787.1 SMESG000035547.1 SMESG000026972.1 SMESG000026708.1 SMESG000025874.1 SMESG000023292.1 SMESG000016835.1 SMESG000007438.1 Contig40747newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
reproductive organSMED30016961SMESG000081008.1 SMESG000080953.1 SMESG000080618.1 SMESG000079481.1 SMESG000078433.1 SMESG000069970.1 SMESG000064426.1 SMESG000062593.1 SMESG000062578.1 SMESG000062150.1 SMESG000061060.1 SMESG000055041.1 SMESG000054362.1 SMESG000052607.1 SMESG000050768.1 SMESG000043762.1 SMESG000041318.1 SMESG000039279.1 SMESG000036787.1 SMESG000035547.1 SMESG000028578.1 SMESG000028198.1 SMESG000026972.1 SMESG000026708.1 SMESG000025874.1 SMESG000023292.1 SMESG000023025.1 SMESG000021897.1 SMESG000020915.1 SMESG000018410.1 SMESG000018119.1 SMESG000017430.1 SMESG000017236.1 SMESG000014142.1 SMESG000010653.1 SMESG000007438.1 Contig52489uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016961SMESG000081008.1 SMESG000080953.1 SMESG000080618.1 SMESG000079481.1 SMESG000078433.1 SMESG000069970.1 SMESG000064426.1 SMESG000062593.1 SMESG000062578.1 SMESG000062150.1 SMESG000061060.1 SMESG000055041.1 SMESG000054362.1 SMESG000052607.1 SMESG000050768.1 SMESG000043762.1 SMESG000041318.1 SMESG000039279.1 SMESG000036787.1 SMESG000035547.1 SMESG000028578.1 SMESG000028198.1 SMESG000026972.1 SMESG000026708.1 SMESG000025874.1 SMESG000023292.1 SMESG000023025.1 SMESG000021897.1 SMESG000020915.1 SMESG000018410.1 SMESG000018119.1 SMESG000017430.1 SMESG000017236.1 SMESG000014142.1 SMESG000010653.1 SMESG000007438.1 Contig52489newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000043280.1 (uncharacterized LOC100492546 [Source:NCBI gene;Acc:100492546])

HSP 1 Score: 119.013 bits (297), Expect = 8.378e-53
Identity = 52/124 (41.94%), Postives = 83/124 (66.94%), Query Frame = 2
Query:  761 LSKNNCNTNFGGLKRSGKNNVCCLLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
            +S +N N++FGGLKR G NNV   ++    +++I +GC  HIVHN AQ   D + +D++ ++ K++ FF ++++R E LK FCEF   Q+K +  +S  R LSL P + +VL+ Y ALK++FL+
Sbjct:  230 MSADNMNSDFGGLKRKGTNNVVNRIRESLKRNVIAIGCITHIVHNCAQCSVDMIPLDIQGMVTKIFGFFHVFSVRAECLKEFCEFTSQQWKEIQSYSNVRCLSLLPFLGKVLQHYAALKSFFLA 353          

HSP 2 Score: 84.7297 bits (208), Expect = 8.378e-53
Identity = 42/141 (29.79%), Postives = 78/141 (55.32%), Query Frame = 1
Query:  373 EGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFF--------DKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK 771
            EG  AFHT++HH S+ S  C+  L+   ++     ++ S  KTK   I  +V+A +  + ++Q + K+ ++++ TD SN G +K +PVL+++         D    I TK++D +    ET ET+S+++   + K  + +K
Sbjct:   91 EGTFAFHTIRHHQSFLSMDCSAGLIKRFYE-----RKFSCSKTKCETIITDVLAKWAEDTVLQDIDKVSYVTLLTDASNSGQVKRYPVLLRYVIIDTKPMGDCKVQIKTKLVDCFETDGETTETLSEDVLQVIRKVLVEDK 226          

HSP 3 Score: 45.0542 bits (105), Expect = 8.378e-53
Identity = 21/61 (34.43%), Postives = 37/61 (60.66%), Query Frame = 2
Query:   98 LAPNMSKRKCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKH 280
            +A    KRKC+ TE +   F   +  P +++ A CT+C T  ++A+ G+  +++H ASK+H
Sbjct:    1 MATKPKKRKCVLTESILIDFPFIRPGP-TENYAFCTLCQTAFTIASGGRSTVKEHSASKRH 60          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: J9L0G9 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 1.148e-85
Identity = 77/135 (57.04%), Postives = 101/135 (74.81%), Query Frame = 2
Query:  749 KNTILSK------NNCNTNFGGLKRSGKNNVCCLLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMTV-DLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
            KN I SK      +N NTNFGG+ R    N+   LK    K+L+G+GCPAHI+HN+  HG D   + D+ESIILK+YN+FSIYT+RTESL++FCEF  I Y+ LL HSKTRWLSL+PA+ R+L+++PALK+YF+S
Sbjct:  304 KNNIKSKCVAFVGDNTNTNFGGINRKSGQNIFSKLKSSVNKNLLGIGCPAHILHNAIHHGVDQFDMFDIESIILKIYNYFSIYTVRTESLRDFCEF--ITYRELLYHSKTRWLSLFPAINRILQMFPALKSYFVS 436          

HSP 2 Score: 150.214 bits (378), Expect = 1.148e-85
Identity = 77/139 (55.40%), Postives = 99/139 (71.22%), Query Frame = 1
Query:  358 KVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDK-NNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK 771
            KVSAVEG LAFHT+ HH+SY S  CT  +L  MFDDS  AK+IS  +TKT  I NNV+AP+ ++ +++ L  IPFIS++TD SNHG  KMFPVLIQ++D  N GI  K+IDL +  NET++T+S+ L   L K NI  K
Sbjct:  172 KVSAVEGTLAFHTVVHHHSYRSMDCTPAILHCMFDDSNTAKKISCARTKTEAIVNNVLAPHSLKVMIECLKSIPFISIATDASNHGNTKMFPVLIQYYDYLNGGINVKLIDLKNTKNETSDTVSELLLESLNKNNIKSK 310          

HSP 3 Score: 56.9954 bits (136), Expect = 1.148e-85
Identity = 27/57 (47.37%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  110 MSKRKCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKH 280
            M KRKC+F + L+  + CF    +  SEA C +C+  VSVANKG YDL+ H+ + KH
Sbjct:   88 MPKRKCVFNDRLKESYKCFVDGRDV-SEAKCIICDCYVSVANKGSYDLKAHLDTTKH 143          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A498M1P1 (Golgin subfamily A member 6C OS=Labeo rohita OX=84645 GN=ROHU_009933 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 7.661e-83
Identity = 71/126 (56.35%), Postives = 98/126 (77.78%), Query Frame = 2
Query:  761 LSKNNCNTNFGGLKRS--GKNNVCCLLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
             + +NCNTNFGG++R   G+N    L ++   K LIGVGCPAHI++N   HG D++ V+ E+I+ K+Y +F IYT+RTESLK +CEFVDIQY+ LL H+KTRWLSL+P + R+L+++PALKA+FLS
Sbjct:  209 FTGDNCNTNFGGVRRDKGGRNVFANLKRILQNKTLIGVGCPAHILNNCVHHGADTLDVETENILFKIYQYFHIYTVRTESLKEYCEFVDIQYRTLLSHTKTRWLSLFPGIHRLLQMFPALKAFFLS 334          

HSP 2 Score: 143.28 bits (360), Expect = 7.661e-83
Identity = 65/149 (43.62%), Postives = 98/149 (65.77%), Query Frame = 1
Query:  328 FYKKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFD-KNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK 771
            F+ +    +    A EG  AFHT+KHH+SY S  CT+ LL   F DS   K+ SS +TKT  I N+V AP+ ++  +++L  IP++ ++TDGSNHGA+K+FP++IQ+F+ K  G+ +K+I++   P+ETAETI+  L   L K  + EK
Sbjct:   57 FFVQPGKTEDAAHAAEGVFAFHTVKHHHSYRSMDCTSALLKRTFTDSANVKKFSSARTKTEAIVNSVFAPHSVDTTLEALQDIPYLGIATDGSNHGAVKIFPIMIQYFNWKQGGVQSKLIEVKDTPDETAETIAQYLIETLRKKQLTEK 205          

HSP 3 Score: 54.6842 bits (130), Expect = 7.661e-83
Identity = 28/58 (48.28%), Postives = 38/58 (65.52%), Query Frame = 2
Query:  170 STPNSKSEAICTVC--NTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTK 337
            S    K EA+CT+C  +T VSVANKG  DLE HI + KH + +R GE S+ + +FF +
Sbjct:    3 SRGRDKWEALCTICKASTYVSVANKGCGDLETHIVTAKHRDAVRGGEGSSKLTDFFVQ 60          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A1Y1MAZ3 (Uncharacterized protein (Fragment) OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 4.912e-81
Identity = 69/122 (56.56%), Postives = 96/122 (78.69%), Query Frame = 2
Query:  761 LSKNNCNTNFGGLKRSGKNNVCCLLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYF 1126
             S +NCNTNFGG  R GKNNV   LK K  +D++G+GCPAHI++N+   G D  +VD+ESI++K++N FS++T+RTE+LK+FCE  +++Y  LL HSKTRWLSLYPA++R+L++Y  LK YF
Sbjct:  223 FSGDNCNTNFGGKDRLGKNNVYAKLKHKLQRDIVGIGCPAHIINNAVHKGCDIFSVDIESIVMKIHNHFSVFTVRTEALKDFCEQSEVEYSKLLYHSKTRWLSLYPAIERILKLYEPLKHYF 344          

HSP 2 Score: 128.257 bits (321), Expect = 4.912e-81
Identity = 66/149 (44.30%), Postives = 100/149 (67.11%), Query Frame = 1
Query:  328 FYKKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNN-GIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK 771
            F+KK    D+KV A EG +A+HT+ HH+S+ S  CT  L   +F DS +AK  +  +TK   I  NV++P     IM+ L  I FIS+S D SN+GA K+ P+LIQ+FD++N GI TK++++ S+PNET+++ISD + + L+ +N+  K
Sbjct:   72 FFKKCGD-DYKVRAAEGTMAYHTINHHFSFLSLDCTMDLNKLIFSDSSIAKDATCNRTKATAIVKNVLSPLSTLQIMKDLENIAFISISCDTSNYGATKLLPILIQYFDESNGGIKTKILEIVSIPNETSDSISDLIVSKLDHHNLTLK 219          

HSP 3 Score: 65.0846 bits (157), Expect = 4.912e-81
Identity = 31/76 (40.79%), Postives = 50/76 (65.79%), Query Frame = 2
Query:  110 MSKRKCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTK 337
            M KRKC+F +ELQ K+   +S   S  E +CT+C++T+S+ANKG +D+++H+ + KH    +   S++ I  FF K
Sbjct:    1 MPKRKCIFNDELQKKYPFLRSGKYS-WEVVCTLCSSTISIANKGSHDIQEHLDTNKHKKWDQNQASTSKIDTFFKK 75          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A1W7R439 (Putative viral polyprotein (Fragment) OS=Aedes albopictus OX=7160 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 3.234e-80
Identity = 72/121 (59.50%), Postives = 96/121 (79.34%), Query Frame = 2
Query:  770 NNCNTNFGGLKRSGKNNVCCLLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
            +NC+TNFGG+ R G+NNV   +K     +L+GVGCPAH++HN+A+HGFD + VD+E+ +LK+Y  FSIYT+RTE LK FC FVD +YK +LKHSKTRWLSL P V+R+L ++ ALK+YF S
Sbjct:  222 DNCSTNFGGINRGGQNNVYYHMKQATQSNLVGVGCPAHLLHNTARHGFDRLDVDIEAFVLKIYGHFSIYTVRTEELKKFCTFVDTEYKKVLKHSKTRWLSLMPTVERILYLFAALKSYFKS 342          

HSP 2 Score: 120.168 bits (300), Expect = 3.234e-80
Identity = 64/152 (42.11%), Postives = 93/152 (61.18%), Query Frame = 1
Query:  322 QFFYKKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSK--IPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK 771
            Q F  + S L+ KV A E  L +H ++H+YS+ S  C NKL   +F DSEVA +    +TKT  I N V+AP+ ++  ++ L +  + +I  STDGSNHG+ KMFPVLIQ+F    GI   ++   SL NETA  IS+ L   L+ + +++K
Sbjct:   64 QMFAVQKSPLELKVLAAEATLTYHVVQHNYSFLSCDCGNKLYKKVFPDSEVAAKFGCARTKTEAIVNEVLAPHSVQIRLKELRELDVQYIGASTDGSNHGSTKMFPVLIQYFHPLKGIQHVVLSFESLENETAVRISELLVQNLKNHELLDK 215          

HSP 3 Score: 63.929 bits (154), Expect = 3.234e-80
Identity = 30/68 (44.12%), Postives = 44/68 (64.71%), Query Frame = 2
Query:  131 FTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFT 334
            F++ LQ +F  FK+T N +SE  C VC   +S+ANKG+ DL QH+AS+KH+  I+   SS+ +   F 
Sbjct:    1 FSDNLQKEFPQFKATTN-ESEVFCEVCQNKISIANKGRTDLTQHLASQKHSANIKSAGSSHKLTQMFA 67          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A498M8V7 (Galectin-3-binding A-like protein OS=Labeo rohita OX=84645 GN=ROHU_037089 PE=4 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 8.750e-80
Identity = 71/123 (57.72%), Postives = 97/123 (78.86%), Query Frame = 2
Query:  770 NNCNTNFGGLKRS--GKNNVCCLLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
            +NCNTNFGG++R   G+N    L ++   K LIGVGCPAHI++N   HG D++ V++E+I+ K+Y +F IYT+ TESLK +CEFVDIQY+ LL HSKTRWLSL+P + R+L+++PALKA+FLS
Sbjct:  212 DNCNTNFGGVRRDEGGRNVFANLKRILQNKTLIGVGCPAHILNNCVHHGADTLDVEIENILFKIYQYFHIYTVHTESLKEYCEFVDIQYRTLLSHSKTRWLSLFPGIHRLLQMFPALKAFFLS 334          

HSP 2 Score: 133.65 bits (335), Expect = 8.750e-80
Identity = 59/129 (45.74%), Postives = 89/129 (68.99%), Query Frame = 1
Query:  388 FHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFD-KNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK 771
            FHT+KHH+SY S  CT+ LL   F DS   K+ SS +TKT  I   V+AP+ ++  +++L  IP++ ++TDGSNHGA+K+FP+++Q+FD K  G+ +K+I++   P+ETAETI+  L   L K  + EK
Sbjct:   77 FHTVKHHHSYRSMDCTSALLKRTFTDSANVKKFSSARTKTEAIVYGVLAPHSVDTTLEALQDIPYLGIATDGSNHGAVKIFPIMVQYFDWKQGGVQSKLIEVKDTPDETAETIAQYLIETLRKNQLTEK 205          

HSP 3 Score: 55.0694 bits (131), Expect = 8.750e-80
Identity = 28/58 (48.28%), Postives = 37/58 (63.79%), Query Frame = 2
Query:  170 STPNSKSEAICTVC--NTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTK 337
            S    K EA+CT+C   T VSVANKG  DLE HI + KH + +R GE S+ + +FF +
Sbjct:    3 SRGRDKWEALCTICKAGTYVSVANKGCGDLETHIVTAKHRDAVRGGEGSSKLTDFFVQ 60          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000051257.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001235.1:256137:262891:1 gene:ENSAMXG00000033420.1 transcript:ENSAMXT00000051257.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.301 bits (264), Expect = 2.007e-51
Identity = 55/140 (39.29%), Postives = 90/140 (64.29%), Query Frame = 1
Query:  334 KKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEK 753
            K+ S++D KV+A E    +HT+KH  SY S  C NKL S +F DSE+AK++S G+TK   +  +V+AP  +E+  +  +  PF SV++D SNHG  K+FP+ ++++    G+ +K++D Y   +E+A TI   + + LE+
Sbjct:   86 KQDSNVD-KVTAAELTSVYHTVKHSLSYRSEDCGNKLTSAIFPDSEIAKKMSCGRTKAASLVTDVLAPASVESCDKK-AHTPFFSVASDASNHGTTKLFPLSLRYWTPKLGLKSKILDFYEDSHESAATIHCQITSKLEE 223          

HSP 2 Score: 95.9005 bits (237), Expect = 2.007e-51
Identity = 49/109 (44.95%), Postives = 70/109 (64.22%), Query Frame = 2
Query:  809 GKNNVCCLLKLKFGKD-LIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
            GKNN     KLK     +I   C AHIVHN A+H  D + VD++S++ K+++ FS+   RTE LK    FV+  Y  + +H  TRWLSL+PAV+R+ + + A+K+YFLS
Sbjct:  244 GKNN-SVFQKLKADNSGIIKANCVAHIVHNCAKHAGDMLNVDIDSVVNKIFSHFSVSAQRTEELKEVFAFVEEDYHVVRRHVPTRWLSLWPAVQRLHDSWAAIKSYFLS 351          

HSP 3 Score: 40.817 bits (94), Expect = 2.007e-51
Identity = 20/74 (27.03%), Postives = 37/74 (50.00%), Query Frame = 2
Query:  116 KRKCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTK 337
            KRKC + ++ +  +   K       + +C VC +  SV++ G+YD+++H   + H   +   E S S+  F  K
Sbjct:   11 KRKCSYNKDWETIYPWVKPVQGESGKVLCEVCLSHFSVSHGGEYDVKRHRQCETHKKRVAQKEVSQSMHTFLLK 84          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000048878.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:18990267:18996294:-1 gene:ENSAMXG00000041866.1 transcript:ENSAMXT00000048878.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.071 bits (266), Expect = 4.598e-49
Identity = 55/140 (39.29%), Postives = 90/140 (64.29%), Query Frame = 1
Query:  334 KKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEK 753
            K+ S++D KV+A E    +HT+KH  SY S  C NKL S +F DSE+AK++S G+TK   +  +V+AP  +E+  +  +  PF SV++D SNHG  K+FP+ ++++    G+ +K++D Y   +E+A TI   + + LE+
Sbjct:   67 KQDSNVD-KVTAAELTSVYHTVKHSLSYRSEDCGNKLTSAIFPDSEIAKKMSCGRTKAASLVTDVLAPASVESCDKK-AHTPFFSVASDASNHGTTKLFPLSLRYWTPKLGLKSKILDFYEDSHESAATIHCQITSKLEE 204          

HSP 2 Score: 96.6709 bits (239), Expect = 4.598e-49
Identity = 49/109 (44.95%), Postives = 70/109 (64.22%), Query Frame = 2
Query:  809 GKNNVCCLLKLKFGKD-LIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
            GKNN     KLK     +I   C AHIVHN A+H  D + VD++S++ K+++ FS+   RTE LK    FV+  Y  + +H  TRWLSL+PAV+R+ + + A+K+YFLS
Sbjct:  225 GKNN-SVFQKLKADNSGIIKANCVAHIVHNCAKHAGDMLNVDIDSVVNKIFSHFSVSAQRTEELKEVFAFVEEDYHVVRRHVPTRWLSLWPAVQRLHDSWAAIKSYFLS 332          

HSP 3 Score: 31.5722 bits (70), Expect = 4.598e-49
Identity = 15/47 (31.91%), Postives = 26/47 (55.32%), Query Frame = 2
Query:  197 ICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTK 337
            +C VC +  SV++ G+YD+++H   + H   +   E S S+  F  K
Sbjct:   19 LCEVCLSHFSVSHGGEYDVKRHRQCETHKKRVAQKEVSQSMHTFLLK 65          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000041838.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:29525919:29530293:-1 gene:ENSAMXG00000031975.1 transcript:ENSAMXT00000041838.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.138 bits (248), Expect = 4.012e-47
Identity = 54/140 (38.57%), Postives = 89/140 (63.57%), Query Frame = 1
Query:  334 KKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEK 753
            K+ S++D KV+A E    +HT+KH  SY S  C NKL S +F DSE+AK++S G+TK   +  +V+AP  +E+  +  +  PF SV++D SNHG  K+FP+ ++++     + +K++D Y   +E+A TI   + + LE+
Sbjct:   84 KQDSNVD-KVTAAELTSVYHTVKHSLSYRSEDCGNKLTSAIFPDSEIAKKMSCGRTKAASLVTDVLAPASVESCDKK-AHTPFFSVASDASNHGTTKLFPLSLRYW--TPKLESKILDFYEDSHESAATIHCQITSKLEE 219          

HSP 2 Score: 96.6709 bits (239), Expect = 4.012e-47
Identity = 49/109 (44.95%), Postives = 70/109 (64.22%), Query Frame = 2
Query:  809 GKNNVCCLLKLKFGKD-LIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
            GKNN     KLK     +I   C AHIVHN A+H  D + VD++S++ K+++ FS+   RTE LK    FV+  Y  + +H  TRWLSL+PAV+R+ + + A+K+YFLS
Sbjct:  240 GKNN-SVFQKLKADNSGIIKANCVAHIVHNCAKHAGDMLNVDIDSVVNKIFSHFSVSAQRTEELKEVFAFVEEDYHVVRRHVPTRWLSLWPAVQRLHDSWAAIKSYFLS 347          

HSP 3 Score: 31.5722 bits (70), Expect = 4.012e-47
Identity = 15/47 (31.91%), Postives = 26/47 (55.32%), Query Frame = 2
Query:  197 ICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTK 337
            +C VC +  SV++ G+YD+++H   + H   +   E S S+  F  K
Sbjct:   36 LCEVCLSHFSVSHGGEYDVKRHRQCETHKKRVAQKEVSQSMHTFLLK 82          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000029907.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:33864003:33865857:-1 gene:ENSAMXG00000029392.1 transcript:ENSAMXT00000029907.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.916 bits (263), Expect = 1.381e-45
Identity = 55/140 (39.29%), Postives = 86/140 (61.43%), Query Frame = 1
Query:  334 KKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEK 753
            K+ S++D KV+A E    +HT+KH  SY S  C NKL S +F DSE+AK++S G+TK   +  +V+AP  +E+  +  +  PF SV++D SNHG  K  P + +  D   G+ +K++D Y   +E+A TI   + + LE+
Sbjct:   72 KQDSNVD-KVTAAELTSVYHTVKHSLSYRSEDCGNKLTSAIFPDSEIAKKMSCGRTKAASLVTDVLAPASVESCDKK-AHTPFFSVASDASNHGTTKTLPTVFEILDTKAGLKSKILDFYEDSHESAATIHCQITSKLEE 209          

HSP 2 Score: 97.0561 bits (240), Expect = 1.381e-45
Identity = 49/109 (44.95%), Postives = 70/109 (64.22%), Query Frame = 2
Query:  809 GKNNVCCLLKLKFGKD-LIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
            GKNN     KLK     +I   C AHIVHN A+H  D + VD++S++ K+++ FS+   RTE LK    FV+  Y  + +H  TRWLSL+PAV+R+ + + A+K+YFLS
Sbjct:  230 GKNN-SVFQKLKADNSGIIKANCVAHIVHNCAKHAGDMLNVDIDSVVNKIFSHFSVSAQRTEELKEVFAFVEEDYHVVRRHVPTRWLSLWPAVQRLHDSWAAIKSYFLS 337          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000030070.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001920.1:87523:93776:-1 gene:ENSAMXG00000033236.1 transcript:ENSAMXT00000030070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.679 bits (252), Expect = 5.505e-24
Identity = 47/133 (35.34%), Postives = 80/133 (60.15%), Query Frame = 1
Query:  325 FFYKKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETI 723
            F  KK S  D K++  E    +H ++H ++Y ST C NK+ + +F DS +A ++S G+TK+  +  NV+AP+  E +   L K+ + +V +D SN G  K+FP  +Q+F  + G+   ++D Y  P+E++E I
Sbjct:   70 FMIKKDSEED-KIAVAELTSTYHGVRHGHNYLSTDCGNKVSAKIFSDSNIATKMSCGRTKSEALVENVLAPFSQERLAAELQKVHYFAVCSDASNSGHTKLFPYTVQYFCASEGVKCGLLDFYEDPDESSEAI 201          

HSP 2 Score: 28.8758 bits (63), Expect = 5.505e-24
Identity = 12/41 (29.27%), Postives = 22/41 (53.66%), Query Frame = 2
Query:  215 TTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTK 337
            T + + ++GK  L+ H  +KKH N ++    +  I +F  K
Sbjct:   33 TKIVIKHEGKTALDDHAKTKKHLNRMQTTRQTRGISSFMIK 73          

HSP 3 Score: 91.6633 bits (226), Expect = 8.698e-20
Identity = 42/91 (46.15%), Postives = 61/91 (67.03%), Query Frame = 2
Query:  869 GCPAHIVHN---SAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
             C  H+++N   +A   F S   D+E+ +LK+Y+ FS    + E LK FCEF   +Y+ +L+H  TRWLSL PA++R+LE +PALK+YFLS
Sbjct:  252 NCKCHMINNAVKTANRVFSSSGCDVEAFVLKVYSEFSCSAKKVEVLKEFCEFTSTKYREILRHVPTRWLSLLPAIQRILECWPALKSYFLS 342          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Nematostella
Match: EDO43282 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ18])

HSP 1 Score: 85.1149 bits (209), Expect = 5.689e-36
Identity = 41/92 (44.57%), Postives = 58/92 (63.04%), Query Frame = 2
Query:  869 GCPAHIVHNSAQHGF----DSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
            GCP HIVHN+A +G     ++   DL   ++ +Y +F   T R  SLK+FC+F D  Y+ +LK+  TRWLS    V RVL+ YP+L++YF S
Sbjct:  225 GCPCHIVHNTASYGAKAYAEAAGFDLGDFLVDIYYYFDNSTKRQASLKDFCDFCDQDYRKILKYGATRWLSRELCVSRVLKQYPSLQSYFAS 316          

HSP 2 Score: 70.0922 bits (170), Expect = 5.689e-36
Identity = 43/148 (29.05%), Postives = 78/148 (52.70%), Query Frame = 1
Query:  334 KKFSSLDHKVSAVEGALAFHT---LKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDG-SNHGAIKMFPVLIQFFDKNNG-IMTKMIDLYSLPNETAETISDNLNTCLEKYNI 762
            K F   D +  AV  A   +T   L+H+  + ST    +L   MF DSE+AK+     TKT  I N  +AP  ++ ++Q +   PF S++ DG S+ G   M+P++++ +D N G + ++   +  + + TA+ I ++++     Y +
Sbjct:   41 KSFFVADKQKDAVTNAEVLYTGYILEHNLPFESTAHAGELFRKMFPDSEIAKKYGCAPTKTAAIVNYALAPEMLDPVVQYIKTQPF-SLAIDGSSDTGTASMYPLVVRIYDVNRGEVASQFWHMCLISDCTAQGIFNSVSDVFRDYEV 187          

HSP 3 Score: 34.2686 bits (77), Expect = 5.689e-36
Identity = 13/45 (28.89%), Postives = 26/45 (57.78%), Query Frame = 2
Query:  206 VCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTKN 340
            VC+ + SV ++GK D+++H+A  +H    +      S+ +FF  +
Sbjct:    3 VCDASFSVCHQGKRDVDRHLAGTEHKRASKTTSEHKSVKSFFVAD 47          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Nematostella
Match: EDO46688 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPH8])

HSP 1 Score: 85.1149 bits (209), Expect = 2.762e-18
Identity = 41/92 (44.57%), Postives = 58/92 (63.04%), Query Frame = 2
Query:  869 GCPAHIVHNSAQHGF----DSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
            GCP HIVHN+A +G     ++   DL   ++ +Y +F   T R  SLK+FC+F D  Y+ +LK+  TRWLS    V RVL+ YP+L++YF S
Sbjct:   22 GCPCHIVHNTASYGAKAYAEAAGFDLGDFLVDIYYYFDNSTKRQASLKDFCDFCDQDYRKILKYGATRWLSRELCVSRVLKQYPSLQSYFAS 113          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Nematostella
Match: EDO32936 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STN6])

HSP 1 Score: 84.7297 bits (208), Expect = 7.137e-18
Identity = 41/92 (44.57%), Postives = 58/92 (63.04%), Query Frame = 2
Query:  869 GCPAHIVHNSAQHGF----DSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
            GCP HIVHN+A +G     ++   DL   ++ +Y +F   T R  SLK+FC+F D  Y+ +LK+  TRWLS    V RVL+ YP+L++YF S
Sbjct:  455 GCPCHIVHNTASYGAKAYAEAAGFDLGDFLVDIYYYFDNSTKRQASLKDFCDFCDQDYRKILKYGATRWLSRELCVSRVLKQYPSLQSYFAS 546          

HSP 2 Score: 48.9062 bits (115), Expect = 2.910e-6
Identity = 24/80 (30.00%), Postives = 41/80 (51.25%), Query Frame = 2
Query:  101 APNMSKR---KCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFF 331
            +P   KR   + +F  E    F C +S      +A CTVC+ + SV ++GK D+++H+A  +H    +      S+ +FF
Sbjct:  344 SPPKKKRLHSQTVFNREWSRLFPCIQSVKGQPHKAHCTVCDASFSVCHQGKRDVDRHLAGTEHKRASKTTSEHKSVKSFF 423          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Nematostella
Match: EDO36298 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIX5])

HSP 1 Score: 63.5438 bits (153), Expect = 1.214e-13
Identity = 30/92 (32.61%), Postives = 54/92 (58.70%), Query Frame = 2
Query:  869 GCPAHIVHNSAQHGFDSMT----VDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
            GC  H+VH++A     ++T     D++ +++ ++ +F   T R   L  + +F D +Y+ +LK+  TRWLS+   V  +L+ Y  L++YFLS
Sbjct:  254 GCQCHVVHSTAMEASTALTEATGFDVQDLMVDVFYWFDQSTKRKAKLVEYAQFCDQEYRKILKYGSTRWLSMEKVVTLLLKQYHTLRSYFLS 345          

HSP 2 Score: 30.4166 bits (67), Expect = 1.214e-13
Identity = 19/61 (31.15%), Postives = 32/61 (52.46%), Query Frame = 1
Query:  586 SVSTDGSN-HGAIKMFPVLIQFFDKN-NGIMTKMIDLYSLPNETAETISDNLNTCLEKYNI 762
            S + DGSN +G  KM P+ ++ +D     + T  +D+      TAE I  +++ CL   +I
Sbjct:  156 SSADDGSNDNGTQKMNPLTVRIYDSQLQRVKTSFLDICMTSGGTAEDIFASIDGCLTSLDI 216          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Nematostella
Match: EDO42389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1N0])

HSP 1 Score: 50.0618 bits (118), Expect = 1.122e-6
Identity = 31/80 (38.75%), Postives = 44/80 (55.00%), Query Frame = 1
Query:  334 KKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSK 573
            KK+ + D  + A E   A   L  HYS NS+  T+KL SNMF DS +AK+   G TK   +    IAP+  + +M+ L +
Sbjct:  176 KKYVTKDETLKA-EVLWAIKVLMSHYSCNSSAGTDKLFSNMFPDSVIAKQFQCGATKCSYLICFGIAPFFHDELMKRLQE 254          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000036787.1 (SMESG000036787.1)

HSP 1 Score: 302.753 bits (774), Expect = 6.612e-126
Identity = 147/149 (98.66%), Postives = 147/149 (98.66%), Query Frame = 1
Query:  325 FFYKKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK 771
            FF KKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLS MFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK
Sbjct:  160 FFTKKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSKMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK 308          

HSP 2 Score: 167.933 bits (424), Expect = 6.612e-126
Identity = 80/83 (96.39%), Postives = 81/83 (97.59%), Query Frame = 2
Query:   95 ILAPNMSKRKCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTKNF 343
            + APNMSKRKCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTK F
Sbjct:   83 VSAPNMSKRKCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTKKF 165          

HSP 3 Score: 245.358 bits (625), Expect = 6.356e-75
Identity = 119/131 (90.84%), Postives = 122/131 (93.13%), Query Frame = 2
Query:  740 LV*KNTILSKNNCNTNFGGLKRSGKNNVCCLLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
            +V K    S +NCNTNFGGLKRSGKNNVC LLKLKFGKDLIGVGC AHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTI+TESLK FCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS
Sbjct:  305 IVEKCVAFSADNCNTNFGGLKRSGKNNVCSLLKLKFGKDLIGVGCSAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIKTESLKKFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 435          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000026972.1 (SMESG000026972.1)

HSP 1 Score: 305.064 bits (780), Expect = 5.042e-125
Identity = 168/242 (69.42%), Postives = 176/242 (72.73%), Query Frame = 1
Query:  325 FFYKKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK-------QL*H*FWRFEKIREKQCLLPFKIEIWKRFNRCWLSCSYCSQFRTAWI*FDDSRFRIYNLKTL*FFFNLYNKDRIFEKFLRICRHSV 1029
            FF KKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIK+FPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK            F   ++  +       K++  K      + C       +A   FD    RI                  FEKFLRICRHSV
Sbjct:  166 FFTKKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKLFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEKCVAFSADNCNTNFGGLKRSGKNNVCSLLKLKFGKDL--IGVGCPAHIVHNSAQHGFDSMTDRI------------------FEKFLRICRHSV 387          

HSP 2 Score: 162.925 bits (411), Expect = 5.042e-125
Identity = 79/80 (98.75%), Postives = 79/80 (98.75%), Query Frame = 2
Query:  104 PNMSKRKCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTKNF 343
            PNMSKRKCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTK F
Sbjct:   92 PNMSKRKCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTKKF 171          

HSP 3 Score: 114.39 bits (285), Expect = 3.134e-28
Identity = 53/62 (85.48%), Postives = 55/62 (88.71%), Query Frame = 2
Query:  740 LV*KNTILSKNNCNTNFGGLKRSGKNNVCCLLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMT 925
            +V K    S +NCNTNFGGLKRSGKNNVC LLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMT
Sbjct:  311 IVEKCVAFSADNCNTNFGGLKRSGKNNVCSLLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMT 372          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000052607.1 (SMESG000052607.1)

HSP 1 Score: 305.064 bits (780), Expect = 3.110e-124
Identity = 148/149 (99.33%), Postives = 148/149 (99.33%), Query Frame = 1
Query:  325 FFYKKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK 771
            FF KKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK
Sbjct:   73 FFTKKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK 221          

HSP 2 Score: 159.844 bits (403), Expect = 3.110e-124
Identity = 77/78 (98.72%), Postives = 77/78 (98.72%), Query Frame = 2
Query:  110 MSKRKCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTKNF 343
            MSKRKCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTK F
Sbjct:    1 MSKRKCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTKKF 78          

HSP 3 Score: 249.98 bits (637), Expect = 4.726e-77
Identity = 121/131 (92.37%), Postives = 123/131 (93.89%), Query Frame = 2
Query:  740 LV*KNTILSKNNCNTNFGGLKRSGKNNVCCLLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
            +V K    S +NCNTNFGGLKRSGKNNVC LLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLK FCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS
Sbjct:  218 IVEKCVAFSADNCNTNFGGLKRSGKNNVCSLLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKKFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 348          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000079481.1 (SMESG000079481.1)

HSP 1 Score: 305.064 bits (780), Expect = 3.925e-124
Identity = 148/149 (99.33%), Postives = 148/149 (99.33%), Query Frame = 1
Query:  325 FFYKKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK 771
            FF KKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK
Sbjct:   73 FFTKKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK 221          

HSP 2 Score: 159.844 bits (403), Expect = 3.925e-124
Identity = 77/78 (98.72%), Postives = 77/78 (98.72%), Query Frame = 2
Query:  110 MSKRKCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTKNF 343
            MSKRKCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTK F
Sbjct:    1 MSKRKCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTKKF 78          

HSP 3 Score: 256.144 bits (653), Expect = 2.602e-79
Identity = 123/131 (93.89%), Postives = 125/131 (95.42%), Query Frame = 2
Query:  740 LV*KNTILSKNNCNTNFGGLKRSGKNNVCCLLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
            +V K    S +NCNTNFGGLKRSGKNNVCCLLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS
Sbjct:  218 IVEKCVAFSADNCNTNFGGLKRSGKNNVCCLLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 348          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000023292.1 (SMESG000023292.1)

HSP 1 Score: 305.449 bits (781), Expect = 1.972e-122
Identity = 148/149 (99.33%), Postives = 148/149 (99.33%), Query Frame = 1
Query:  325 FFYKKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK 771
            FF KKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK
Sbjct:   73 FFTKKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVEK 221          

HSP 2 Score: 153.68 bits (387), Expect = 1.972e-122
Identity = 75/78 (96.15%), Postives = 75/78 (96.15%), Query Frame = 2
Query:  110 MSKRKCLFTEELQAKFVCFKSTPNSKSEAICTVCNTTVSVANKGKYDLEQHIASKKHTNTIRIGESSNSICNFFTKNF 343
            MSKRKCLFTEELQAKFVCFKSTPNSKSEAI TVCNTTVSVANKGKYDLEQH ASKKHTNTIRIGESSNSICNFFTK F
Sbjct:    1 MSKRKCLFTEELQAKFVCFKSTPNSKSEAIYTVCNTTVSVANKGKYDLEQHTASKKHTNTIRIGESSNSICNFFTKKF 78          

HSP 3 Score: 250.751 bits (639), Expect = 2.643e-77
Identity = 121/131 (92.37%), Postives = 123/131 (93.89%), Query Frame = 2
Query:  740 LV*KNTILSKNNCNTNFGGLKRSGKNNVCCLLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPAVKRVLEVYPALKAYFLS 1132
            +V K    S +NCNTNFGGLKRSGKNNVC LLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYP VKRVLEVYPALKAYFLS
Sbjct:  218 IVEKCVAFSADNCNTNFGGLKRSGKNNVCSLLKLKFGKDLIGVGCPAHIVHNSAQHGFDSMTVDLESIILKLYNFFSIYTIRTESLKNFCEFVDIQYKALLKHSKTRWLSLYPVVKRVLEVYPALKAYFLS 348          
The following BLAST results are available for this feature:
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000043280.18.378e-5341.94uncharacterized LOC100492546 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
J9L0G91.148e-8557.04Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
A0A498M1P17.661e-8356.35Golgin subfamily A member 6C OS=Labeo rohita OX=84... [more]
A0A1Y1MAZ34.912e-8156.56Uncharacterized protein (Fragment) OS=Photinus pyr... [more]
A0A1W7R4393.234e-8059.50Putative viral polyprotein (Fragment) OS=Aedes alb... [more]
A0A498M8V78.750e-8057.72Galectin-3-binding A-like protein OS=Labeo rohita ... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000051257.12.007e-5139.29pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000048878.14.598e-4939.29pep primary_assembly:Astyanax_mexicanus-2.0:8:1899... [more]
ENSAMXT00000041838.14.012e-4738.57pep primary_assembly:Astyanax_mexicanus-2.0:14:295... [more]
ENSAMXT00000029907.11.381e-4539.29pep primary_assembly:Astyanax_mexicanus-2.0:15:338... [more]
ENSAMXT00000030070.15.505e-2435.34pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO432825.689e-3644.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466882.762e-1844.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329367.137e-1844.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362981.214e-1332.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO423891.122e-638.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036787.16.612e-12698.66SMESG000036787.1[more]
SMESG000026972.15.042e-12569.42SMESG000026972.1[more]
SMESG000052607.13.110e-12499.33SMESG000052607.1[more]
SMESG000079481.13.925e-12499.33SMESG000079481.1[more]
SMESG000023292.11.972e-12299.33SMESG000023292.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016961 ID=SMED30016961|Name=Dimer_Tnp_hAT domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1133bp
TTAATATTATATTTTTTTGGGTTAAATAAACAAGTAAGTATGTAATTTAT
TATTGTTAATTAGAGTCTTATATTTTATATTCTTGGATTTTACTATTTTA
GCTCCAAATATGAGTAAACGAAAATGTTTATTTACTGAAGAACTGCAAGC
TAAATTTGTATGTTTTAAATCAACACCAAATTCAAAATCCGAGGCAATAT
GCACTGTTTGTAATACTACAGTTTCGGTTGCAAACAAAGGCAAATACGAT
TTGGAACAACATATTGCGTCAAAAAAGCATACAAATACTATTCGTATAGG
AGAAAGTTCCAATTCCATATGCAATTTTTTTACAAAAAATTTTCATCTCT
GGATCACAAAGTATCAGCTGTCGAAGGAGCTTTAGCATTCCACACTTTAA
AGCACCATTATAGTTATAACTCCACCGTTTGTACAAACAAATTACTGTCA
AACATGTTTGATGATTCGGAAGTAGCTAAGCGGATTTCATCTGGAAAGAC
AAAAACGAGATGTATCGCAAATAATGTCATCGCTCCATATTGCATTGAAA
ACATAATGCAATCATTGTCCAAAATACCATTTATATCAGTTTCAACAGAT
GGAAGTAATCATGGGGCAATTAAAATGTTCCCAGTTCTTATTCAATTTTT
TGACAAAAATAATGGAATAATGACAAAAATGATTGATTTATATTCTTTGC
CAAACGAAACAGCAGAGACAATAAGTGATAATTTGAACACTTGTTTAGAA
AAATACAATATTGTCGAAAAACAACTGTAACACTAATTTTGGAGGTTTGA
AAAGATCAGGGAAAAACAATGTTTGCTGCCTTTTAAAATTGAAATTTGGA
AAAGATTTAATAGGTGTTGGTTGTCCTGCTCATATTGTTCACAATTCCGC
ACAGCATGGATTTGATTCGATGACAGTAGATTTAGAATCTATAATCTTAA
AACTCTATAATTTTTTTTCAATTTATACAATAAGGACAGAATCTTTGAAA
AATTTTTGCGAATTTGTAGACATTCAGTATAAAGCGTTATTAAAACATTC
AAAAACGCGCTGGTTATCACTTTATCCCGCTGTGAAAAGAGTCTTGGAAG
TTTATCCTGCTTTAAAAGCTTATTTTTTATCAA
back to top

protein sequence of SMED30016961-orf-1

>SMED30016961-orf-1 ID=SMED30016961-orf-1|Name=SMED30016961-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=154bp
MQFFYKKFSSLDHKVSAVEGALAFHTLKHHYSYNSTVCTNKLLSNMFDDS
EVAKRISSGKTKTRCIANNVIAPYCIENIMQSLSKIPFISVSTDGSNHGA
IKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLEKYNIVE
KQL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002089reproductive organ