Frizzled 5/8 protein

Overview
NameFrizzled 5/8 protein
Smed IDSMED30016952
Length (bp)2231
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Frizzled 5/8 protein (SMED30016952) t-SNE clustered cells

Violin plots show distribution of expression levels for Frizzled 5/8 protein (SMED30016952) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Frizzled 5/8 protein (SMED30016952) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Frizzled 5/8 protein (SMED30016952) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016952

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30016952SMESG000005043.1 dd_Smed_v4_11823_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30016952SMESG000005043.1 dd_Smed_v4_11823_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30016952SMESG000005043.1 dd_Smed_v4_11823_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30016952SMESG000005043.1 dd_Smed_v4_11823_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30016952SMESG000005043.1 SmedASXL_008755SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30016952SMESG000005043.1 dd_Smed_v4_11823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30016952SMESG000005043.1 dd_Smed_v4_11823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30016952SMESG000005043.1 dd_Smed_v4_11823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30016952SMESG000005043.1 dd_Smed_v4_11823_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30016952SMESG000005043.1 dd_Smed_v6_11823_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30016952SMESG000005043.1 SMED30016952smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30016952SMESG000005043.1 SMED30016952smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30016952SMESG000005043.1 Contig54994newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30016952SMESG000005043.1 Contig54994uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30016952SMESG000005043.1 OX_Smed_1.0.14683ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Frizzled 5/8 protein vs. Ensembl Human
Match: FZD5 (frizzled class receptor 5 [Source:HGNC Symbol;Acc:HGNC:4043])

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 269/520 (51.73%), Postives = 363/520 (69.81%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLT-----ENQACLKKDTKNVT---------KP--------PSKGCEC--------KCRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIAC--DGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTK 1840
            C  I +PMC+ IGYNLT+MPN+F+H+TQ+EAGL VHQF+PLVEI CS +LR FLCS+Y PICLP++ KP+  CRSVCE A+ GC+P+M  YGF WP+ M CD+L          C+  +    T         KP        P+ G EC        KCR P++    ++ P +N V TG V NC   C+  +F + +++F TFW+GLW+VLC +S++ TV TFL+D  RF+YPERPI+FLS CY+ VS+G+++R+ VGH  +AC  + + + Y TTGPA C+IVFLL+YFFGMA+S+WWVIL++TWFL+AG+KWG+EAI+ Y++ FH  AW +  VKSI AL L ++DGDPV GICY+GN N  +L+ F++ PL +YLL+G+ FLL+GF++L  IR  I+ +G +KTDKLEKLM+RIGIF LLY+VPA++V+ C+LYE   RE WE +  C C  +   Q   +KPEY V MLKYFMCLVVGITSG WIW+ KT++SW    RR +   C +  +  K
Sbjct:   33 CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGGECPAGGPFVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSADERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGHDTGQPR-AKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESW----RRFTSRCCCRPRRGHK 546          
BLAST of Frizzled 5/8 protein vs. Ensembl Human
Match: FZD10 (frizzled class receptor 10 [Source:HGNC Symbol;Acc:HGNC:4039])

HSP 1 Score: 443.351 bits (1139), Expect = 6.151e-147
Identity = 241/529 (45.56%), Postives = 323/529 (61.06%), Query Frame = 2
Query:  326 LAIDRASADRSNQENFRPN--KCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTE----NQACLKKDTKNVTKPPSKGCEC-----KCRSPYIY---------------DNKPQFNSVITGGVANCFQSCHSANFV---SIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDK-----LRYG--TTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWE---KSNNCYCNRNIKSQENF---SKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHN 1786
            L +  + A  S+ +  RP   KC PI IPMCK+IGYN+T MPN   HE Q EA + +H+F PLVE  C  +LR FLCSLYAP+C      PI ACR +CE AR  C+P+M  + FKWP S+DC KL      N  C++    N +  P++G        + + P+                 DN  +F+ V     A+C   C     V     DK F   WL +WAVLC  SS  TVLTFL+D +RF+YPERPI+FLS CY + S+GY+IR+  G E IACD D      ++ G  +TG   C++VFL++Y+FGMA+S+WWV+LT+TWFL+AG KWG EAI   S  FH  AW +  VK+IL L +  + GD + G+CY+G+ +   L  F+++PL  YL+IG+ F+LSGF+AL  IR+ ++  GE+ TDKLEKLM+RIG+F +LY+VPA  VI C+ YE  N ++W+     + C  N   K+ +     S P   +FM+K FM LVVGITSG WIWTSKTL SW  
Sbjct:   12 LQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPN-NGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKS--ASCAPLCTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIRLFAGAESIACDRDSGQLYVIQEGLESTG---CTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVALFHIRRVMKTGGEN-TDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHKCKMNNQTKTLDCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQ 533          
BLAST of Frizzled 5/8 protein vs. Ensembl Human
Match: FZD7 (frizzled class receptor 7 [Source:HGNC Symbol;Acc:HGNC:4045])

HSP 1 Score: 425.246 bits (1092), Expect = 5.181e-140
Identity = 219/526 (41.63%), Postives = 314/526 (59.70%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQA---CLKKDTKNVTKPPSKGCECKCRSPYIYD---------------------------NKPQFNSVITGGVANCFQSCHSAN------FVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRV-----AVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKS---NNCYCNRNIKSQENFS--KPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQS 1825
            C PI+IP+C +I YN T +PN   H  QE+AGL VHQFYPLV++ CS  LR FLCS+YAP+C     + I  CRS+CE AR GC  +MN +GF+WP+ + C+    + A   C+ ++T + +  P  G      +PY+ D                             P +      G  +C   C          F   ++ F   W+G+W+VLCC S+  TVLT+L+D  RF YPERPI+FLSGCY MV++ ++        AV  E  + DG +     T    C+I+F+++YFFGMA+S+WWVIL++TWFL+AG+KWG EAI   S+ FH  AW +  VK+I  L +  +DGD + G+CY+G ++   L+ F++ PL VYL IG+ FLL+GF++L  IR  ++  G +KT+KLEKLM+RIG+F +LY+VPA +V+ C+ YE   RE WE++     C          +F    P+++VFM+KY M ++VGIT+GFWIW+ KTL SW   + RLS S  G++
Sbjct:   49 CQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCT-VLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGET 572          
BLAST of Frizzled 5/8 protein vs. Ensembl Human
Match: FZD2 (frizzled class receptor 2 [Source:HGNC Symbol;Acc:HGNC:4040])

HSP 1 Score: 419.083 bits (1076), Expect = 8.158e-138
Identity = 224/530 (42.26%), Postives = 314/530 (59.25%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTEN---QACLKKDTKN-------VTKPPS----------------------KGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSAN------FVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYII-----RVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLN-LKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEK---SNNCYCNRNIKSQENFS---KPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQS 1825
            C PI+IP+C +I YN T MPN   H  QE+AGL VHQFYPLV++ CS  LR FLCS+YAP+C     + I  CRS+CE AR GC  +MN +GF+WP+ + C+    +   Q C+ ++           T PP                          E     P +    P + S    G  +C   C  A       F   +  F   W+  W+VLCC S+  TV T+L+D  RF+YPERPI+FLSGCY MVS+ YI         V +E  + DG +     T    C+I+F+++YFF MA+S+WWVIL++TWFL+AG+KWG EAI   S+ FH  AW +  VK+I  L +  IDGD + G+C++G  NSL+ L+ F++ PL VYL IG+ FLL+GF++L  IR  ++  G +KT+KLE+LM+RIG+F +LY+VPA +VI C+ YE   RE WE+   S +C  +  I    +++    P+++V+M+KY M L+VGITSGFWIW+ KTL SW   + RL+ S  G++
Sbjct:   39 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCT-VLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVL-KVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVG-LNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCK-SLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNSRHGET 563          
BLAST of Frizzled 5/8 protein vs. Ensembl Human
Match: FZD1 (frizzled class receptor 1 [Source:HGNC Symbol;Acc:HGNC:4038])

HSP 1 Score: 416.001 bits (1068), Expect = 1.948e-135
Identity = 217/541 (40.11%), Postives = 311/541 (57.49%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQA---CLKKDTKNVTKPPSKGCECKCRSPYIYDNKPQFNSVITG--------------------------------GVANCFQSCHSANFVSI------DKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELI-----ACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKS---------------QENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQS 1825
            C PI+IP+C +I YN T MPN   H  QE+AGL VHQFYPLV++ CS  L+ FLCS+YAP+C     + +  CRS+CE AR GC  +MN +GF+WP ++ C+K   + A   C+ ++T +      KG       P  + + PQ                                       G  +C   C       +      +  F   W+G+W+VLCC S+  TVLT+L+D  RF YPERPI+FLSGCY  V++ YI    +   ++     A DG +     T    C+I+F+++YFF MA+S+WWVIL++TWFL+AG+KWG EAI   S+ FH  AW +  +K+I  L L  +DGD + G+C++G  N   L+ F++ PL VYL IG+ FLL+GF++L  IR  ++  G +KT+KLEKLM+RIG+F +LY+VPA +VI C+ YE   R+ WE+S   +  ++ KS                     P+++VFM+KY M L+VGITSGFWIW+ KTL+SW   + RL+ S  G++
Sbjct:  116 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCT-VLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSD------KGTPTPSLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQWERS---WVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGET 645          
BLAST of Frizzled 5/8 protein vs. Ensembl Celegans
Match: cfz-2 (Frizzled-2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECQ2])

HSP 1 Score: 406.757 bits (1044), Expect = 2.674e-133
Identity = 209/526 (39.73%), Postives = 298/526 (56.65%), Query Frame = 2
Query:  374 RPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDC-------DKLTENQAC-------------------------------------LKKDTKNVTKPPSKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPAR-CSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGES--KTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQS 1810
            +  KC  I IP+CK IGYN+T  PN + HE QEEAGL VHQFYPLVE+ C  +L+ FLC++Y PIC  N+ KPI  C  +C  AR  C+P+M  YGF+WP+++ C       D+++    C                                     + K    V   PS+ C+C C  P+ +    +      G V NC  SCHS        S V+ W+  W++ CC+ ++ T LTFL++  RF+YPERPI  L+ C +MV++G++IR  VGHE IACD  +++         C +VFLL YFFGMAASVWWVIL++TW LSA  KW  EAIS +S  FH + W L  ++++L +   AIDGDP+ GICY+GNT+    ++F++ PL VY ++G  FL+ GF  L SIR  ++ +  S     K+ +LM +IGIF LLY++P+ ++I    YE  +R  WE+S  C C+     ++        + ++K     ++G TSGFW+ ++KTL SW NA   L  S
Sbjct:   21 KRQKCEQITIPLCKGIGYNMTSFPNSYGHEKQEEAGLEVHQFYPLVEVGCFQHLKFFLCTMYTPICQENYDKPILPCMELCVEARSKCSPIMAKYGFRWPETLSCEALPKMSDQMSTGNICAAPPDTPKKQHKGHHHKNQNQNQNQNHNYSPDGPEVGISKIDNEVIAGPSE-CQCTCNQPFQFVASEKSK---VGNVTNCAYSCHSPALAE-SHSLVSNWMAFWSITCCVLASFTFLTFLIETDRFQYPERPIFMLAFCQLMVAVGFMIRYFVGHEEIACDSMRIKGADDNSGSLCFVVFLLTYFFGMAASVWWVILSLTWVLSAASKWSPEAISSFSFHFHVVGWCLPAIQTVLVIVFNAIDGDPITGICYVGNTDLQFQRIFVLFPLLVYFIVGVLFLVIGFCNLWSIRNEVQKQHPSLESAHKITQLMSKIGIFSLLYTIPSLLIICVLFYEQNHRSLWEQSQLCSCS----PKQTIGDSSLIISLIKTCCMCILGWTSGFWVCSTKTLSSWKNAICCLGSS 537          
BLAST of Frizzled 5/8 protein vs. Ensembl Celegans
Match: mom-5 (pep chromosome:WBcel235:I:9965580:9970037:1 gene:WBGene00003397.1 transcript:T23D8.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-5)

HSP 1 Score: 320.857 bits (821), Expect = 2.846e-100
Identity = 192/528 (36.36%), Postives = 279/528 (52.84%), Query Frame = 2
Query:  380 NKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACLK------------KDTKNVTKPPSKGCECKCRSPYIYDNKPQFNS-------VITGGVANCFQSCHSANFVSID-----KSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPAR---------CSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIR---AKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFW-EKSNNCYCNRNIKSQENF---------------SKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQ 1807
             KC  I IPMCKN+ YN T  PN   H TQ EAG  + QF PL+++ CS+++RLFLC++YAP+C     KPIQ CR +C SA++GC  +M  +GF+WP  +DC+K      C+             + + +VT   S        SP    +     S       +++G +  C  +C + N V +      +  +  W   W+V C + S  T++TFL+D SRF YP RPI++L+ CY+ +S  Y+I V VG +  AC      YG+T             CS + ++ YFF M++  WW++L + WFL+A LKWG+E+I+  S  FH + W +  V S+  L   ++DGD   GIC +GN N   L  F   P+ V L +G+  L+ G  ++I IR  I+   A  E    KLEKLM+RIG F ++YS+P A+      Y+  N   W E   +  C R ++ +E F               + PE  VF+LKY   LVVGIT   W+ +SKTL S+H A+  LS 
Sbjct:   35 RKCEHITIPMCKNLDYNQTVFPNLLGHTTQSEAGPAIAQFNPLIKVKCSEDIRLFLCTVYAPVC-TVLEKPIQPCRELCLSAKNGCESLMKKFGFQWPDQLDCNKFPVTDLCVGKNSSESSNSKNYRSSNDVTFGVSTIANEVVLSPKKCPHHMHTTSGSHFSLPLLSGRLPECSLTCEADNQVPMMFDGRVRRILRIWTAAWSVACFVCSLFTLVTFLVDLSRFAYPVRPILYLAFCYLAISTVYMIGV-VGEDGFACG----TYGSTPTTLVTQGGENVGCSALAVVHYFFFMSSCAWWLVLCLAWFLAANLKWGAESIAALSPYFHAMCWGVPAVLSVTVLVTNSVDGDVFTGICSVGNLNPSALVYFFFTPIVVSLALGAVLLVCGIWSMIRIRSYIKLQHADVERNISKLEKLMLRIGAFAIMYSLPTAMNAAIMWYQAVNMPAWLEGWLHHRCVR-LQDRELFGFTYPVDDCPMDPKVAAPEIIVFLLKYVSQLVVGITCAIWVVSSKTLSSYHKAYLALSS 555          
BLAST of Frizzled 5/8 protein vs. Ensembl Celegans
Match: mom-5 (pep chromosome:WBcel235:I:9965580:9969413:1 gene:WBGene00003397.1 transcript:T23D8.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-5)

HSP 1 Score: 319.316 bits (817), Expect = 9.172e-100
Identity = 191/525 (36.38%), Postives = 278/525 (52.95%), Query Frame = 2
Query:  380 NKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACL----------KKDTKNVTKPPSKGCECKCRSPYIYDNKPQFNS-------VITGGVANCFQSCHSANFVSID-----KSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPAR---------CSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIR---AKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENF---------------SKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQ 1807
             KC  I IPMCKN+ YN T  PN   H TQ EAG  + QF PL+++ CS+++RLFLC++YAP+C     KPIQ CR +C SA++GC  +M  +GF+WP  +DC+K      C+          KK + +VT   S        SP    +     S       +++G +  C  +C + N V +      +  +  W   W+V C + S  T++TFL+D SRF YP RPI++L+ CY+ +S  Y+I V VG +  AC      YG+T             CS + ++ YFF M++  WW++L + WFL+A LKWG+E+I+  S  FH + W +  V S+  L   ++DGD   GIC +GN N   L  F   P+ V L +G+  L+ G  ++I IR  I+   A  E    KLEKLM+RIG F ++YS+P A+      Y+  N   W +    +    ++ +E F               + PE  VF+LKY   LVVGIT   W+ +SKTL S+H A+  LS 
Sbjct:   35 RKCEHITIPMCKNLDYNQTVFPNLLGHTTQSEAGPAIAQFNPLIKVKCSEDIRLFLCTVYAPVC-TVLEKPIQPCRELCLSAKNGCESLMKKFGFQWPDQLDCNKFPVTDLCVGKNSSESSNSKKSSNDVTFGVSTIANEVVLSPKKCPHHMHTTSGSHFSLPLLSGRLPECSLTCEADNQVPMMFDGRVRRILRIWTAAWSVACFVCSLFTLVTFLVDLSRFAYPVRPILYLAFCYLAISTVYMIGV-VGEDGFACG----TYGSTPTTLVTQGGENVGCSALAVVHYFFFMSSCAWWLVLCLAWFLAANLKWGAESIAALSPYFHAMCWGVPAVLSVTVLVTNSVDGDVFTGICSVGNLNPSALVYFFFTPIVVSLALGAVLLVCGIWSMIRIRSYIKLQHADVERNISKLEKLMLRIGAFAIMYSLPTAMNAAIMWYQAVNMPAWLEGWLHHRCVRLQDRELFGFTYPVDDCPMDPKVAAPEIIVFLLKYVSQLVVGITCAIWVVSSKTLSSYHKAYLALSS 553          
BLAST of Frizzled 5/8 protein vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 262.307 bits (669), Expect = 2.391e-78
Identity = 146/487 (29.98%), Postives = 244/487 (50.10%), Query Frame = 2
Query:  380 NKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTEN-QACLKKDTKNVT------KPPSKGCECKCRSPY-----IYDNKPQFNSVITGGVANCFQSCHSANFVSID-KSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDG-----DKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHN 1786
             KC+PI I +CK++ YN TY PN   H  Q         F PL++  C  ++  F+CS++AP+C    P+ + +C+SVCE  +  C  ++  +G  WP+ ++C +  +  + C+K     +T      + P+KG       P      + D  P          ++C  +C S    S D K  V  W   +A      +  + LTF +DR RF++PER + +LS C  + S+ Y+  + +   + +C         L  GT   + C   FLL YFF  AA++WW++ + T +LS G KW  E I   S   HF+AW LS + +I+ L    +D   +  +C +GN NS+ L  F+IVP T+ ++IG+CF++ GF ++   R + R +G + T KLEKLM+++G F  L+ +P  + + C  Y+      W +     C +   +    + P+  ++M      L  G +   W+ ++KT+ +W N
Sbjct:   26 GKCIPIDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFPDPPELCMKPTEDEITGGFSAPRLPTKGSSSSSSKPTGCPSDLVDVDPH------DPKSHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCHALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTRG-TDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTRM-TIDCKQQSGACHRPTPPQAEIYMTAVISSLATGFSCLMWVLSAKTVHAWKN 504          
BLAST of Frizzled 5/8 protein vs. Ensembl Celegans
Match: lin-17 (Transmembrane receptor LIN-17 [Source:UniProtKB/TrEMBL;Acc:G5EDV1])

HSP 1 Score: 262.307 bits (669), Expect = 2.391e-78
Identity = 146/487 (29.98%), Postives = 244/487 (50.10%), Query Frame = 2
Query:  380 NKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTEN-QACLKKDTKNVT------KPPSKGCECKCRSPY-----IYDNKPQFNSVITGGVANCFQSCHSANFVSID-KSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDG-----DKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHN 1786
             KC+PI I +CK++ YN TY PN   H  Q         F PL++  C  ++  F+CS++AP+C    P+ + +C+SVCE  +  C  ++  +G  WP+ ++C +  +  + C+K     +T      + P+KG       P      + D  P          ++C  +C S    S D K  V  W   +A      +  + LTF +DR RF++PER + +LS C  + S+ Y+  + +   + +C         L  GT   + C   FLL YFF  AA++WW++ + T +LS G KW  E I   S   HF+AW LS + +I+ L    +D   +  +C +GN NS+ L  F+IVP T+ ++IG+CF++ GF ++   R + R +G + T KLEKLM+++G F  L+ +P  + + C  Y+      W +     C +   +    + P+  ++M      L  G +   W+ ++KT+ +W N
Sbjct:   26 GKCIPIDIELCKDLPYNYTYFPNTILHNDQHTLQTHTEHFKPLMKTKCHPHIHFFICSVFAPMCPIGMPQAVTSCKSVCEQVKADCFSILEEFGIGWPEPLNCAQFPDPPELCMKPTEDEITGGFSAPRLPTKGSSSSSSKPTGCPSDLVDVDPH------DPKSHCAFACQSNVMFSTDNKRMVRSWSIWFAAANAGVALFSFLTFAIDRKRFRFPERCVFYLSLCIFISSLPYLTPLFIDAPIRSCHALGNGRSYLSIGTFDNSYCLASFLLNYFFSTAAALWWLMFSFTLYLSGGRKWVPEGIEACSSYVHFVAWGLSSLATIIVLIFNKVDASELTALCSVGNLNSIALLWFVIVPRTICIVIGTCFIVGGFASMCRERISFRTRG-TDTSKLEKLMVKMGFFCALFILPNVIELVCQCYKFMILTQWTRM-TIDCKQQSGACHRPTPPQAEIYMTAVISSLATGFSCLMWVLSAKTVHAWKN 504          
BLAST of Frizzled 5/8 protein vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0112890)

HSP 1 Score: 496.508 bits (1277), Expect = 2.160e-166
Identity = 267/582 (45.88%), Postives = 340/582 (58.42%), Query Frame = 2
Query:  377 PN-KCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKW---------PKSMDCDKLTENQA--------------------------------------------------CLKKDTKNVTKP-----PSKGCECKCRSPYIYDNKPQF------------------NSVIT--GGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKG----ESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRL--SQSICGQSDKHTKQFP 1849
            PN +C  I IPMC+ IGYN+T  PNE +HETQ+EAGL VHQF+PLVEI CS +L+ FLCS+Y PICL ++ KP+  CRSVCE AR GCAP+M  Y F+W         P   D D L   Q                                                   C  +++KN   P       K C C CRSP I+  K Q                   N  +    GV NC   C    F + +K F   W+ LW+ LC  S+  T+ TF++D  RFKYPERPIVFLS CY MV++GY+ R  + +E IACDG  LR  +TGP  C++VFLL YFFGMA+S+WWVIL+ TWFL+AGLKWG+EAI+K+S+ FH  AW +  V+S+  L L A+DGDP+ GICY+GN N  +LK F++ PL VYL+IG+ FL++GF++L  IR  I+ +G      K DKLEKLM+RIGIF +LY+VPA +VIGC+LYE    E W K+  C C + +K      KP YSV MLKYFM L VGITSG WIW+ KTL+SW   +RRL  +    G +    KQ P
Sbjct:   60 PNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQ-VKGPGK--KPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRP 638          
BLAST of Frizzled 5/8 protein vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0075029)

HSP 1 Score: 496.508 bits (1277), Expect = 2.160e-166
Identity = 267/582 (45.88%), Postives = 340/582 (58.42%), Query Frame = 2
Query:  377 PN-KCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKW---------PKSMDCDKLTENQA--------------------------------------------------CLKKDTKNVTKP-----PSKGCECKCRSPYIYDNKPQF------------------NSVIT--GGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKG----ESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRL--SQSICGQSDKHTKQFP 1849
            PN +C  I IPMC+ IGYN+T  PNE +HETQ+EAGL VHQF+PLVEI CS +L+ FLCS+Y PICL ++ KP+  CRSVCE AR GCAP+M  Y F+W         P   D D L   Q                                                   C  +++KN   P       K C C CRSP I+  K Q                   N  +    GV NC   C    F + +K F   W+ LW+ LC  S+  T+ TF++D  RFKYPERPIVFLS CY MV++GY+ R  + +E IACDG  LR  +TGP  C++VFLL YFFGMA+S+WWVIL+ TWFL+AGLKWG+EAI+K+S+ FH  AW +  V+S+  L L A+DGDP+ GICY+GN N  +LK F++ PL VYL+IG+ FL++GF++L  IR  I+ +G      K DKLEKLM+RIGIF +LY+VPA +VIGC+LYE    E W K+  C C + +K      KP YSV MLKYFM L VGITSG WIW+ KTL+SW   +RRL  +    G +    KQ P
Sbjct:   60 PNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQ-VKGPGK--KPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRP 638          
BLAST of Frizzled 5/8 protein vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0332735)

HSP 1 Score: 496.508 bits (1277), Expect = 2.160e-166
Identity = 267/582 (45.88%), Postives = 340/582 (58.42%), Query Frame = 2
Query:  377 PN-KCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKW---------PKSMDCDKLTENQA--------------------------------------------------CLKKDTKNVTKP-----PSKGCECKCRSPYIYDNKPQF------------------NSVIT--GGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKG----ESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRL--SQSICGQSDKHTKQFP 1849
            PN +C  I IPMC+ IGYN+T  PNE +HETQ+EAGL VHQF+PLVEI CS +L+ FLCS+Y PICL ++ KP+  CRSVCE AR GCAP+M  Y F+W         P   D D L   Q                                                   C  +++KN   P       K C C CRSP I+  K Q                   N  +    GV NC   C    F + +K F   W+ LW+ LC  S+  T+ TF++D  RFKYPERPIVFLS CY MV++GY+ R  + +E IACDG  LR  +TGP  C++VFLL YFFGMA+S+WWVIL+ TWFL+AGLKWG+EAI+K+S+ FH  AW +  V+S+  L L A+DGDP+ GICY+GN N  +LK F++ PL VYL+IG+ FL++GF++L  IR  I+ +G      K DKLEKLM+RIGIF +LY+VPA +VIGC+LYE    E W K+  C C + +K      KP YSV MLKYFM L VGITSG WIW+ KTL+SW   +RRL  +    G +    KQ P
Sbjct:   60 PNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQ-VKGPGK--KPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRP 638          
BLAST of Frizzled 5/8 protein vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0330194)

HSP 1 Score: 496.508 bits (1277), Expect = 2.160e-166
Identity = 267/582 (45.88%), Postives = 340/582 (58.42%), Query Frame = 2
Query:  377 PN-KCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKW---------PKSMDCDKLTENQA--------------------------------------------------CLKKDTKNVTKP-----PSKGCECKCRSPYIYDNKPQF------------------NSVIT--GGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKG----ESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRL--SQSICGQSDKHTKQFP 1849
            PN +C  I IPMC+ IGYN+T  PNE +HETQ+EAGL VHQF+PLVEI CS +L+ FLCS+Y PICL ++ KP+  CRSVCE AR GCAP+M  Y F+W         P   D D L   Q                                                   C  +++KN   P       K C C CRSP I+  K Q                   N  +    GV NC   C    F + +K F   W+ LW+ LC  S+  T+ TF++D  RFKYPERPIVFLS CY MV++GY+ R  + +E IACDG  LR  +TGP  C++VFLL YFFGMA+S+WWVIL+ TWFL+AGLKWG+EAI+K+S+ FH  AW +  V+S+  L L A+DGDP+ GICY+GN N  +LK F++ PL VYL+IG+ FL++GF++L  IR  I+ +G      K DKLEKLM+RIGIF +LY+VPA +VIGC+LYE    E W K+  C C + +K      KP YSV MLKYFM L VGITSG WIW+ KTL+SW   +RRL  +    G +    KQ P
Sbjct:   60 PNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQ-VKGPGK--KPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRP 638          
BLAST of Frizzled 5/8 protein vs. Ensembl Fly
Match: fz2 (gene:FBgn0016797 transcript:FBtr0075028)

HSP 1 Score: 496.508 bits (1277), Expect = 2.160e-166
Identity = 267/582 (45.88%), Postives = 340/582 (58.42%), Query Frame = 2
Query:  377 PN-KCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKW---------PKSMDCDKLTENQA--------------------------------------------------CLKKDTKNVTKP-----PSKGCECKCRSPYIYDNKPQF------------------NSVIT--GGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKG----ESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRL--SQSICGQSDKHTKQFP 1849
            PN +C  I IPMC+ IGYN+T  PNE +HETQ+EAGL VHQF+PLVEI CS +L+ FLCS+Y PICL ++ KP+  CRSVCE AR GCAP+M  Y F+W         P   D D L   Q                                                   C  +++KN   P       K C C CRSP I+  K Q                   N  +    GV NC   C    F + +K F   W+ LW+ LC  S+  T+ TF++D  RFKYPERPIVFLS CY MV++GY+ R  + +E IACDG  LR  +TGP  C++VFLL YFFGMA+S+WWVIL+ TWFL+AGLKWG+EAI+K+S+ FH  AW +  V+S+  L L A+DGDP+ GICY+GN N  +LK F++ PL VYL+IG+ FL++GF++L  IR  I+ +G      K DKLEKLM+RIGIF +LY+VPA +VIGC+LYE    E W K+  C C + +K      KP YSV MLKYFM L VGITSG WIW+ KTL+SW   +RRL  +    G +    KQ P
Sbjct:   60 PNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQ-VKGPGK--KPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRP 638          
BLAST of Frizzled 5/8 protein vs. Ensembl Zebrafish
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 275/536 (51.31%), Postives = 364/536 (67.91%), Query Frame = 2
Query:  308 HLANNQLAIDRASADRSNQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQA----CL---KKDTKNVT----KP---PSKG--------------------CE--CKCRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIAC----DGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHN 1786
            +L    L +  A   RS+    +   C  IA+P+CK IGYN TYMPN+F+H+TQ+EAGL VHQF+PLVEI CS +L+ FLCS+Y PICL ++ KP+  CRSVCE A+ GCAP+M  YGF WP  M CD L    A    C+   + D+  V+    KP   PSK                     CE  C+CR+P +    D  P +N V TG + NC   CH+  F   +++F  FW+GLW+VLC +S+ ATV TFL+D  RFKYPERPI+FLS CYM VSIGYI+R+  GHE +AC    D + + Y TTGPA C++VFLLIYFFGMA+S+WWVIL++TWFL+AG+KWG+EAI+ YS+ FH  AW +  +KSI  L L ++DGDPV GICY+GN N  NL+ F++ PL +YL IG+ FLL+GF++L  IR  I+ +G +KTDKLEKLM+RIGIF +LY+VPA +++ C+ YE  NR+ WE ++NC C      ++   +P+Y+VFMLKYFMCL+VGITSG W W+ KTL+SW +
Sbjct:    4 YLLGIYLFLALALLPRSSGTTAKEITCQEIAVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFPWPDRMRCDLLPVQGAPDTLCMDYNRTDSTTVSPVLSKPTNYPSKAINPHKKKSGRPGVGPNKNKPCEPGCQCRAPMVPVNSDRHPLYNRVKTGQIPNCAMPCHNPYFTQDERTFTAFWIGLWSVLCFISTFATVATFLIDMERFKYPERPIIFLSACYMFVSIGYIVRLIAGHEKVACNREYDVEHIHYETTGPALCTVVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLIPSMKSIAVLALSSVDGDPVAGICYVGNQNLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTVLYTVPATIIVACYFYEQHNRQSWEITHNCSC----LLEQEIKRPDYAVFMLKYFMCLLVGITSGVWTWSGKTLESWRS 534          
BLAST of Frizzled 5/8 protein vs. Ensembl Zebrafish
Match: fzd8b (frizzled class receptor 8b [Source:ZFIN;Acc:ZDB-GENE-000328-4])

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 263/505 (52.08%), Postives = 352/505 (69.70%), Query Frame = 2
Query:  374 RPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKL----TENQACLKKDT----------------------KNVTKPPSKGCE--CKCRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDG----DKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWH 1783
            R + C  I++P+C+ IGYN TYMPN+F+H+ Q+EAGL VHQF+PLVEI CS +LR FLCS+Y PICL ++ KP+  CRSVCE A+ GCAP+M  YGF WP  M CD L      N  C+  +                       KN + P S  CE  C CR+P +    D+ P +N V TG + NC   CH+      +++F TFW+G+W+VLC LS+ ATV+TFL+D  RFKYPERPI+FLS CYM VS+GYIIR+  GHE +AC+     D + Y TTGPA C++VFLLIYFFGMA+++WWVIL+ TWFL+AGLKWG+EAI++YS+ FH  AW +  VKSI  L L ++DGD + GICY+GN N  NL+ F++ PL +YL IG+ FL +GF+++  IR  I+ +G +KTDKLE+LM+RIG+F +LY+V A +++ C++YE  NRE WE ++ C C+ + K+     KP+Y+VFMLKYFMCL++GITSG W W+SKTLDSW 
Sbjct:   27 REHVCQEISVPLCRGIGYNYTYMPNQFNHDNQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFPWPDRMRCDLLPVQGDPNTLCMDYNRTDATSSPAAPKTTSRPGKPFKRKNKSSPGSSSCEPECYCRAPMVPVHSDHHPLYNRVKTGQIPNCAMPCHNPYLSQEERTFATFWIGIWSVLCFLSTFATVITFLIDIERFKYPERPIIFLSACYMFVSLGYIIRLIAGHERVACNQNHEVDHIHYETTGPALCTLVFLLIYFFGMASAIWWVILSFTWFLAAGLKWGNEAIARYSQYFHMAAWLIPSVKSITVLALSSVDGDSIAGICYVGNQNLDNLRGFVLAPLVIYLFIGTIFLFAGFVSMFRIRSVIK-QGGTKTDKLERLMVRIGVFTVLYTVVAIMIVACYVYEHHNREAWEIAHACNCSSDKKA----PKPDYAVFMLKYFMCLLIGITSGAWTWSSKTLDSWR 526          
BLAST of Frizzled 5/8 protein vs. Ensembl Zebrafish
Match: fzd8b (frizzled class receptor 8b [Source:ZFIN;Acc:ZDB-GENE-000328-4])

HSP 1 Score: 553.903 bits (1426), Expect = 0.000e+0
Identity = 263/505 (52.08%), Postives = 351/505 (69.50%), Query Frame = 2
Query:  374 RPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKL----TENQACLKKDT----------------------KNVTKPPSKGCE--CKCRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDG----DKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWH 1783
            R + C  I++P+C+ IGYN TYMPN+F+H+ Q+EAGL VHQF+PLVEI CS +LR FLCS+Y PICL ++ KP+  CRSVCE A+ GCAP+M  YGF WP  M CD L      N  C+  +                       KN + P S  CE  C CR+P +    D+ P +N V TG + NC   CH+      +++F TFW+G+W+VLC LS+ ATV TFL+D  RFKYPERPI+FLS CYM VS+GYIIR+  GHE +AC+     D + Y TTGPA C++VFLLIYFFGMA+++WWVIL+ TWFL+AGLKWG+EAI++YS+ FH  AW +  VKSI  L L ++DGD + GICY+GN N  NL+ F++ PL +YL IG+ FL +GF+++  IR  I+ +G +KTDKLE+LM+RIG+F +LY+V A +++ C++YE  NRE WE ++ C C+ + K+     KP+Y+VFMLKYFMCL++GITSG W W+SKTLDSW 
Sbjct:   27 REHVCQEISVPLCRGIGYNYTYMPNQFNHDNQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFPWPDRMRCDLLPVQGDPNTLCMDYNRTDATSSPAAPKTTSRPGKPFKRKNKSSPGSSSCEPECYCRAPMVPVHSDHHPLYNRVKTGQIPNCAMPCHNPYLSQEERTFATFWIGIWSVLCFLSTFATVATFLIDIERFKYPERPIIFLSACYMFVSLGYIIRLIAGHERVACNQNHEVDHIHYETTGPALCTLVFLLIYFFGMASAIWWVILSFTWFLAAGLKWGNEAIARYSQYFHMAAWLIPSVKSITVLALSSVDGDSIAGICYVGNQNLDNLRGFVLAPLVIYLFIGTIFLFAGFVSMFRIRSVIK-QGGTKTDKLERLMVRIGVFTVLYTVVAIMIVACYVYEHHNREAWEIAHACNCSSDKKA----PKPDYAVFMLKYFMCLLIGITSGAWTWSSKTLDSWR 526          
BLAST of Frizzled 5/8 protein vs. Ensembl Zebrafish
Match: fzd5 (frizzled class receptor 5 [Source:ZFIN;Acc:ZDB-GENE-990415-218])

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 260/506 (51.38%), Postives = 342/506 (67.59%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLT----ENQACLKKDTKNVT-------KPPSKGC-----------------ECKCRSPYIYDNK---PQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDG----DKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRR 1798
            C PI +PMCK IGYN TYMPN+F+H+ Q+E GL VHQF+PLV I CS +L  FLCS+Y PICL ++ KP+  CRSVCE A+ GC+P+M  YGF+WP+ M C++L      ++ C+ +++   T       KP  KG                  EC CR P +   K   P  N V TG + NC   CH   F   +++F TFW+GLW+VLC +S+  TV TFL+D  RFKYPERPI+FL+ CY+ VS+GYI+R+  GHE +AC+G      + Y TTGPA C++VFLLIYFFGMA+S+WWV+L+ TWFL+AG+KWG+EAI+ YS+ FH  AW +  VKSI  L L ++DGDPV GICY+GN +   L+ F++ PL VYL  GS FLL+GF++L  IR  I+ +G +KTDKLEKLM+RIG+F +LY+VPA +V+ C +YE   R  WE++  C C    + Q     P+Y+VFMLKYFMCLVVGITSG WIW+ KTL+SW     R
Sbjct:   45 CEPITVPMCKGIGYNHTYMPNQFNHDNQDEVGLEVHQFWPLVRIHCSPDLLFFLCSMYTPICLQDYKKPLPPCRSVCERAKRGCSPLMIQYGFEWPERMSCEQLPMLGDTDRLCMDRNSSETTTLSPPFPKPTPKGTPRHRATAKSAPPQKCDRECHCRGPLVPIKKEAHPLHNRVNTGSLPNCALPCHQPYFSQDERTFTTFWIGLWSVLCFVSTFTTVATFLIDMERFKYPERPIIFLAACYLFVSLGYIVRLLAGHERVACEGTGDQQHILYDTTGPALCTLVFLLIYFFGMASSIWWVVLSFTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLEGLRGFVLAPLVVYLFTGSLFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGLFTVLYTVPATIVVACLVYEQHYRPSWERALACSCPS--ERQRLGMGPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWRRFIAR 547          
BLAST of Frizzled 5/8 protein vs. Ensembl Zebrafish
Match: fzd9a (frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GENE-060531-77])

HSP 1 Score: 441.425 bits (1134), Expect = 2.075e-146
Identity = 228/518 (44.02%), Postives = 325/518 (62.74%), Query Frame = 2
Query:  359 NQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQ---ACLKKDTKNVTKPPSKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSAN-FVSIDKS---------------------FVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDK-----LRYG--TTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWE---KSNNCYCNRNIKSQE---NFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRR 1798
            + E+ RP KC PI IPMC+ IGYN+T MPN  ++E+QEEA + +++F PLV+  C  +L+ FLCSLY P+C       I ACR +CE AR  C+P+M  + F WP S+DC KL  N    A   +  +N T+P +K  E     P     + +  + ++G +++  QSC +   F  +DKS                     F   W+ +W+ LC +S+  TVLTFLLD  RF+YPERPI+FLS CY + S+ +IIR   G E IACD +      +R G  +TG   C+IVFL++Y+FGMA+S+WWVILT+TWFL+AG KWG EAI  +S  FH  AW +  VK+I+ LT+  + GD + G+CY+G+ +S  L  F+++PL+ YL++G+ F+L+GF+AL  IRK ++  G + T+KLEKLM++IG+F +LY+VPA +VI C+ YE  N E+W+     N C      +S +   + S P  +VFMLK FM LVVGITSG W+W+SKTL +W   + R
Sbjct:   27 DLEHGRPGKCEPITIPMCQGIGYNMTRMPNLLNYESQEEASIKLNEFAPLVKYGCDIHLQFFLCSLYVPMCAEQVSASIPACRPMCEQARQRCSPIMEQFSFSWPDSLDCSKLPTNNDPNALCIEAPENDTQPETKKGEGMLPVP----PRSRQPTTVSGRISSISQSCENPEKFQYVDKSESCAPRCTPTVDVYWSRQDKDFAFIWMVVWSTLCFVSTAFTVLTFLLDPQRFQYPERPIIFLSMCYNIYSVAFIIRSVAGAENIACDRENGELYIIREGLESTG---CTIVFLILYYFGMASSIWWVILTLTWFLAAGRKWGHEAIEAHSSYFHMAAWGIPAVKTIVILTMRKVAGDELTGLCYVGSMDSSALTGFVLIPLSCYLIVGTSFILTGFVALFHIRKIMKTGG-TNTEKLEKLMVKIGVFSILYTVPATIVIICYFYERLNMEYWKFRALENKCVSFPGRRSDDCSLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLYNR 536          
BLAST of Frizzled 5/8 protein vs. Ensembl Xenopus
Match: zdhhc9 (zinc finger DHHC-type containing 9 [Source:Xenbase;Acc:XB-GENE-1016830])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 270/500 (54.00%), Postives = 356/500 (71.20%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTE----NQACLKKDTKNV-----------TKPPSKGCE--CKCRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQS 1825
            C  I +PMCK IGYN TYMPN+F+H+TQ+EAG+ VHQF+PLV I CS +L+ FLCS+Y PICLP++ KP+  CRSVCE A+ GC+P+M  YGF WP+ M+CD+L E    +  C+  +                K PS  C+  CKCR P++    ++ P +N + TG V NC   C    F   +K+F TFW+GLW++LC +S+  TV TFL+D  RF+YPERPI+FLS CY+ VSIGYI+R+ VGHE +AC+ D + Y TTGPA C++VFLLIYFFGMA+S+WWVILT TWFL+AG+KWG+EAI+ YS+ FH  AW +  VKSI  L L ++DGDPV GIC++GN N  NL+ F++ PL VYL  G+ FLL+GF++L  IR  I+ +G +KTDKLEKLM+RIGIF +LY+VPA +V+ C++YE   RE WEK++NC C  + K      +P+Y+VFMLKYFMCLVVGITSG WIW+ KTL+SW    +R +   C  S
Sbjct:   33 CQEITVPMCKGIGYNHTYMPNQFNHDTQDEAGMEVHQFWPLVVIQCSLDLKFFLCSMYTPICLPDYRKPLPPCRSVCERAKAGCSPLMRKYGFAWPERMNCDRLPEHGDPDTLCMDYNWTETTTTPPPTHPPKVKTPSSDCDGVCKCREPFLSITRESHPLYNRIKTGQVPNCAMPCFQPYFTQDEKTFATFWIGLWSILCFISTFTTVATFLIDMERFRYPERPIIFLSACYLFVSIGYIVRLIVGHENVACNKDHIHYETTGPALCTVVFLLIYFFGMASSIWWVILTFTWFLAAGMKWGNEAIASYSQYFHMAAWLIPSVKSIAVLALSSVDGDPVAGICFVGNQNLDNLRGFVLAPLVVYLFTGTMFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFSVLYTVPATIVVACYIYEQHYREHWEKAHNCSCPGDKKRY----RPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESW----KRFTGRCCRNS 523          
BLAST of Frizzled 5/8 protein vs. Ensembl Xenopus
Match: fzd8 (frizzled class receptor 8 [Source:NCBI gene;Acc:100038274])

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 265/511 (51.86%), Postives = 348/511 (68.10%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTE--NQACLKKDTKNVTKPPSK--------------------------------GCE--CKCRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKL------RYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWH 1783
            C  I +P+CK+IGYN TYMPN+F+H+TQ+EAG+ VHQF+PLV I CS +L+ FLCS+Y PICL ++ KP+  CRSVCE AR GCAP+M  YGF WP  M CD+L E  N   L  D  N T+  +                                 GCE  C+CR+P +    +  P +N V TG + NC   CH+  F   +++F  FW+GLW+VLC  S+ ATV TFL+D  RFKYPERPI+FLS CY++VS GY++R+  GHE +AC   +L       Y TTGPA C++VFLLIYFFGMA+S+WWVIL++TWFL+AG+KWG+EAI+ YS+ FH  AW +  +KSI  L L ++DGDPV GIC++GN N  NL+ F++ PL +YL IGS FLL+GF++L  IR  I+ +G +KTDKLEKLM+RIGIF +LY+VPA +V+ C  YE  NR+ WE ++NC   +   +Q    +P+Y+VFMLKYFMCLVVGITSG WIW+ KTL+SW 
Sbjct:   27 CQEITVPLCKDIGYNYTYMPNQFNHDTQDEAGMEVHQFWPLVVIHCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYYNRTEQTTAAPSHPEPPKPPARSAPKGRTRVEPPRPRPRAPGCEPGCQCRAPMVPVTNERHPLYNRVRTGQIPNCAMPCHNPYFSPEERTFTEFWIGLWSVLCFASTFATVSTFLIDMERFKYPERPIIFLSACYLLVSAGYLVRLIAGHEKVACSRGELDLEHIIHYETTGPALCTLVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSIKSIAVLALSSVDGDPVAGICFVGNQNLDNLRGFVLAPLVIYLFIGSMFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFSVLYTVPATIVVACFFYEQHNRQGWEVAHNCNSCQPEVAQPR--RPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWR 534          
BLAST of Frizzled 5/8 protein vs. Ensembl Xenopus
Match: ntrk1 (neurotrophic receptor tyrosine kinase 1 [Source:Xenbase;Acc:XB-GENE-923001])

HSP 1 Score: 423.705 bits (1088), Expect = 1.036e-139
Identity = 221/517 (42.75%), Postives = 314/517 (60.74%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTEN---QACLKKDTKNVTKPP---SKGCECKCRSPYIYDN------------KPQFNSVITGGVANCFQSCHSAN-----FVSIDK-SFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELI-----ACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKS--------QENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQS 1825
            C PI+IP+C +I YN T MPN   H  QE+AGL VHQFYPLV++ CS  LR FLCS+YAP+C     + I  CRS+CE AR GC  +MN +GF+WP+ + C+    +   Q C+ ++      P    +         P IY               P + +    G  +C   C  +      F S D+  F   W+ +W+VLCC S+  TV T+L+D  RF+YPERPI+FLSGCY MVS+ YI    +G +++     + DG K     T    C+I+F+++YFF MA+S+WWVIL++TWFL+AG+KWG EAI   S+ FH  AW +  VK+I  L +  IDGD + G+C++G  N   L+ F++ PL VYL IG+ FLL+GF++L  IR  ++  G +KT+KLE+LM+RIG+F +LY+VPA +VI C+ YE   RE WE+S   + ++N KS              P+++V+M+KY M L+VGITSGFWIW+ KTL SW   + RL+ +  G++
Sbjct:   40 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSSELRFFLCSMYAPVC-TVLEQAIPPCRSICERARHGCEALMNKFGFQWPERLRCENFPRHGAEQICVGQNHSEDGGPTLLTTSPPHHGTPGPPIYATLDHPFHCPRVLKVPSYLNYRFLGEKDCAAPCEPSKNDGFMFFSQDEIRFARVWILIWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLGDKVVCNENFSEDGYKTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNNIDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERS---WVSQNCKSLAIPCPLQYTPRMTPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNNKHGET 551          
BLAST of Frizzled 5/8 protein vs. Ensembl Xenopus
Match: bdh2 (3-hydroxybutyrate dehydrogenase 2 [Source:Xenbase;Acc:XB-GENE-985755])

HSP 1 Score: 418.313 bits (1074), Expect = 1.025e-137
Identity = 217/514 (42.22%), Postives = 308/514 (59.92%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACLKKDTKNVTKPPSKGCECKCRSPYIYDN---KPQFNSVITG---------------GVANCFQSCHSAN------FVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGY-----IIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKS---NNCYCNRNIKSQENFS--KPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQS 1825
            C PI+IP+C +I YN T MPN   H  QE+AGL VHQFYPLV++ CS  LR FLCS+YAP+C     + I  CRS+CE AR GC  +MN +GF+WP+ + C+    + A      +N +     G   +  +PY+ D+    P  N   T                G  +C   C          F   +  F   W+G+WA+LC +S+  TVLT+L+D  RF YPERPI+FLSGCY MV++ Y     +    V  E  + D  +     T    C+I+F+++YFFGMA+S+WWVIL++TWFL+AG+KWG EAI   S+ FH  AW +  VK+I  L +  +DGD + G+CY+G  +  +L+ F++ PL VYL IG+ FLL+GF++L  IR  ++  G +KT+KLEKLM+RIG+F ++Y+VPA +V+ C+ YE   R+ WEK+     C          NF+   P+++VFM+KY M ++VGITS FWIW+ KTL SW   + RLS    G++
Sbjct:   36 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCT-VLEQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDNSPSGPTAR-PTPYLPDSITFHPHPNRDFTCPRQLKVPPYLGYRFLGEKDCGAPCEPGKANGLMYFKEEEVRFARLWVGIWAILCGISTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAYTAGFLLEERGVCVERFSEDSYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDILSGVCYVGINSVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLEKLMVRIGVFSVMYTVPATIVLACYFYEQAFRDTWEKTWLVQTCKGFAVPCPNYNFAPMSPDFTVFMIKYLMTMIVGITSSFWIWSGKTLQSWRRFYHRLSNGGKGET 546          
BLAST of Frizzled 5/8 protein vs. Ensembl Xenopus
Match: FZD9 (frizzled class receptor 9 [Source:NCBI gene;Acc:100487936])

HSP 1 Score: 406.757 bits (1044), Expect = 4.665e-133
Identity = 219/517 (42.36%), Postives = 302/517 (58.41%), Query Frame = 2
Query:  359 NQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKL---TENQACLKKDTKNVT--KPPSKG---CECKCRSPYIYD----------NKPQFNSVITGGVANCFQSCHSANFV---SIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDK-----LRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQEN------FSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAF--RRLSQ 1807
            + E  R  KC PI IPMC+ IGYN+T MPN   HE+QEEA   + +F PLVE  C  +LR FLCSLYAP+C       I AC+ +CE+AR  CAP+M ++ + WP+S+DCD+L    +  A   +  +N T   PP+ G        R P              N  +F  V   GV  C   C     V   S DK F   W+  W+ LC +S+  TV TFLL   RF+YPE+PI+FLS CY + S  ++IR A G   IACD +      +R G    + C++VFL++Y+FGMA+S+WWV+LT+TWFL+A  KWG EAI  +   FH  AW +  +K+I+ LT+  + GD + G+CY+G ++   L  F++VPL+ YL+ G+ FLL+GF+AL  IR+ ++  G + T+KLEKLM++IG+F +LY+VPA  +I C  YE  N   W+        R +            S P  +VFMLK FM L VGITSG W+W+SKTL +W      RRL +
Sbjct:   19 DVERGREAKCEPIQIPMCQGIGYNMTRMPNYVGHESQEEAAAKLQEFAPLVEYGCHIHLRFFLCSLYAPMCTEQVSTSIPACKPMCEAARQKCAPIMESFQYVWPESLDCDRLPSKNDPHALCMEAPENATNGDPPTNGHGMLPVAPRPPRPSGSGIGISSRCANPDKFMYVERSGV--CAPRCIPGVDVYWSSGDKDFALVWMAAWSGLCFISTAFTVFTFLLHPQRFQYPEKPIIFLSMCYNVYSTAFLIRAAAGAPSIACDREGGAPYLIREGLES-SGCTLVFLILYYFGMASSLWWVVLTLTWFLAASKKWGHEAIESHGSYFHLAAWGIPAIKTIIILTMRKVGGDELTGLCYVGGSDPSALTGFVLVPLSCYLVTGTSFLLTGFVALFHIRRVMKTGG-TNTEKLEKLMVKIGVFSILYTVPATCIIVCCFYERLNLAHWDSRAREESCRTVPGSARPDCNLPHSIPSVAVFMLKIFMSLAVGITSGVWVWSSKTLQAWQGILCQRRLVE 531          
BLAST of Frizzled 5/8 protein vs. Ensembl Mouse
Match: Fzd5 (frizzled class receptor 5 [Source:MGI Symbol;Acc:MGI:108571])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 269/521 (51.63%), Postives = 358/521 (68.71%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKL--------------TENQACLKKDTKNVTKP--------PSKGCECK--------CRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIAC--DGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQ 1843
            C  I +PMC+ IGYNLT+MPN+F+H+TQ+EAGL VHQF+PLVEI CS +LR FLCS+Y PICLP++ KP+  CRSVCE A+ GC+P+M  YGF WP+ M CD+L                ++A          KP        PS G EC         CR P++    ++ P +N V TG V NC   C+  +F   +++F TFW+GLW+VLC +S++ TV TFL+D  RF+YPERPI+FLS CY+ VS+G+++R+ VGH  +AC  +   + Y TTGPA C++VFLL+YFFGMA+S+WWVIL++TWFL+AG+KWG+EAI+ Y++ FH  AW +  VKSI AL L ++DGDPV GICY+GN N  +L+ F++ PL +YLL+G+ FLL+GF++L  IR  I+ +G +KTDKLEKLM+RIGIF LLY+VPA++V+ C+LYE   RE WE +  C C      Q   +KPEY V MLKYFMCLVVGITSG WIW+ KTL+SW    RR +   C  S +  K 
Sbjct:   33 CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPR-AKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESW----RRFTSRCCCSSRRGHKS 547          
BLAST of Frizzled 5/8 protein vs. Ensembl Mouse
Match: Fzd5 (frizzled class receptor 5 [Source:MGI Symbol;Acc:MGI:108571])

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 269/521 (51.63%), Postives = 358/521 (68.71%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKL--------------TENQACLKKDTKNVTKP--------PSKGCECK--------CRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIAC--DGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQ 1843
            C  I +PMC+ IGYNLT+MPN+F+H+TQ+EAGL VHQF+PLVEI CS +LR FLCS+Y PICLP++ KP+  CRSVCE A+ GC+P+M  YGF WP+ M CD+L                ++A          KP        PS G EC         CR P++    ++ P +N V TG V NC   C+  +F   +++F TFW+GLW+VLC +S++ TV TFL+D  RF+YPERPI+FLS CY+ VS+G+++R+ VGH  +AC  +   + Y TTGPA C++VFLL+YFFGMA+S+WWVIL++TWFL+AG+KWG+EAI+ Y++ FH  AW +  VKSI AL L ++DGDPV GICY+GN N  +L+ F++ PL +YLL+G+ FLL+GF++L  IR  I+ +G +KTDKLEKLM+RIGIF LLY+VPA++V+ C+LYE   RE WE +  C C      Q   +KPEY V MLKYFMCLVVGITSG WIW+ KTL+SW    RR +   C  S +  K 
Sbjct:   33 CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPR-AKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESW----RRFTSRCCCSSRRGHKS 547          
BLAST of Frizzled 5/8 protein vs. Ensembl Mouse
Match: Fzd8 (frizzled class receptor 8 [Source:MGI Symbol;Acc:MGI:108460])

HSP 1 Score: 538.11 bits (1385), Expect = 0.000e+0
Identity = 266/579 (45.94%), Postives = 357/579 (61.66%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTE----NQACLKKDTKNVT-------------------------------------------------KPPSKG------------CE--CKCRSPYIY---DNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDG------------------------------------------DKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAK-GESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWH 1783
            C  I +P+CK IGYN TYMPN+F+H+TQ+EAGL VHQF+PLVEI CS +L+ FLCS+Y PICL ++ KP+  CRSVCE A+ GCAP+M  YGF WP  M CD+L E    +  C+  +  ++T                                                  PPS+G            CE  C+CR+P +    +  P +N V TG +ANC   CH+  F   +++F  FW+GLW+VLC +S+ ATV TFL+D  RFKYPERPI+FLS CY+ VS+GY++R+  GHE +AC G                                            +RY TTGPA C++VFLL+YFFGMA+S+WWVIL++TWFL+AG+KWG+EAI+ YS+ FH  AW +  VKSI  L L ++DGDPV GICY+GN +  NL+ F++ PL +YL IG+ FLL+GF++L  IR  I+ + G +KT KLEKLM+R+G+F +LY+VPAAVV+ C  YE  NR  WE ++NC C R+++  +   +P+Y+VFMLKYFMCLVVGITSG W+W+ KTL+SW 
Sbjct:   35 CQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPPGEQPPSGSGHSRPPGARPPHRGGSSRGSGDAAAAPPSRGGKARPPGGGAAPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAAGAGAAGAGASSPGARGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQA-RRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWR 612          
BLAST of Frizzled 5/8 protein vs. Ensembl Mouse
Match: Fzd10 (frizzled class receptor 10 [Source:MGI Symbol;Acc:MGI:2136761])

HSP 1 Score: 441.425 bits (1134), Expect = 2.387e-146
Identity = 241/523 (46.08%), Postives = 318/523 (60.80%), Query Frame = 2
Query:  356 SNQENFRPN--KCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTE----NQACLKKDTKNVTKPPSKGCECKCRSPYIYDNKP---QFNSVITGGV--ANC-----------FQSCH-------SANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDK-----LRYG--TTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWE---KSNNCYCNRNIKSQE---NFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRR 1798
            S+ +  RP   KC P+ IPMCK+IGYN T MPN   HE Q EA + +H+F PLVE  C  +LR FLCSLYAP+C      PI ACR +CE AR  C+P+M  + F+WP S+DC KL      N  C++    N +  PS+G       P     +P   Q + +  GG   A C            +SC           +   DK F   WL +W+VLC  SS  TVLTFL+D SRF+YPERPI+FLS CY + S+GYIIR+  G E IACD D      ++ G  +TG   C++VFL++Y+FGMA+S+WWV+LT+TWFL+AG KWG EAI   S  FH  AW +  VK+IL L +  + GD + G+CY+G+ +   L  F++VPL  YL+IG+ F+LSGF+AL  IR+ ++  GE+ TDKLEKLM+RIG+F LLY+VPA  VI C+ YE  N ++W+     + C  N   K+ +     S P   VFM+K  M LVVGITSG W+WTSKTL SW +   R
Sbjct:   23 SSMDLERPGDGKCQPVEIPMCKDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHSHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFKFRWPDSLDCSKLPNKNDPNYLCMEAPN-NGSDEPSRGS--GMFPPLFRPQRPHSAQEHPLKDGGPGRAGCDNPGKFHHVEKSESCAPLCTPGVDVYWSRDDKRFAVVWLAIWSVLCFFSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQLYVIQEGLESTG---CTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVIGTSFILSGFVALFHIRRVMKTGGEN-TDKLEKLMVRIGVFSLLYTVPATCVIACYFYERLNMDYWKMLATQHKCKMNNQTKTPDCLMTTSIPAVEVFMVKVSMLLVVGITSGVWVWTSKTLQSWQHVCSR 538          
BLAST of Frizzled 5/8 protein vs. Ensembl Mouse
Match: Fzd7 (frizzled class receptor 7 [Source:MGI Symbol;Acc:MGI:108570])

HSP 1 Score: 426.017 bits (1094), Expect = 1.414e-140
Identity = 219/526 (41.63%), Postives = 315/526 (59.89%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQA---CLKKDTKNVTKPPSKGCECKCRSPYIYDNKPQFNSVITG---------------------------GVANCFQSCHSAN------FVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRV-----AVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKS---NNCYCNRNIKSQENFS--KPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQS 1825
            C PI+IP+C +I YN T +PN   H  QE+AGL VHQFYPLV++ CS  LR FLCS+YAP+C     + I  CRS+CE AR GC  +MN +GF+WP+ + C+    + A   C+ ++T + +            +PY+ D  P F ++                              G  +C   C          F   ++ F   W+G+W+VLCC S+  TVLT+L+D  RF YPERPI+FLSGCY MV++ ++        AV  E  + DG +     T    C+I+F+++YFFGMA+S+WWVIL++TWFL+AG+KWG EAI   S+ FH  AW +  VK+I  L +  +DGD + G+CY+G ++   L+ F++ PL VYL IG+ FLL+GF++L  IR  ++  G +KT+KLEKLM+RIG+F +LY+VPA +V+ C+ YE   RE WE++     C          +FS   P+++VFM+KY M ++VGIT+GFWIW+ KTL SW   + RLS S  G++
Sbjct:   49 CQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCT-VLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGAGGSPTAYPTAPYLPD--PPFTAMSPSDGRGRLSFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFSPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGET 570          
BLAST of Frizzled 5/8 protein vs. UniProt/SwissProt
Match: sp|P58421|FZD5_XENLA (Frizzled-5 OS=Xenopus laevis OX=8355 GN=fzd5 PE=2 SV=1)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 269/500 (53.80%), Postives = 354/500 (70.80%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTE----NQACLKKD-----------TKNVTKPPSKGCE--CKCRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQS 1825
            C  I +PMCK IGYN TYMPN+F+H+TQ+EAG+ VHQF+PLV I CS +L+ FLCS+Y PICLP++ KP+  CRSVCE A+ GC+P+M  YGF WP+ M+CD+L E    +  C+  +                K P+  C+  CKCR P++    ++ P +N + TG V NC   C    F   +K FVTFW+GLW++LC +S+  TV TFL+D  RF+YPERPI+FLS CY+ VSIGY++R+ VGHE +AC+ D + Y TTGPA C+IVFLLIYFFGMA+S+WWVILT TWFL+AG+KWG+EAI+ YS+ FH  AW +  VKSI  L L ++DGDPV GICY+GN N  NL+ F++ PL VYL  G+ FLL+GF++L  IR  I+ +G +KTDKLEKLM+RIGIF +LY+VPA +V+ C++YE   RE WEK++NC C       +   +P+Y+VFMLKY MCLVVGITSG WIW+ KTL+SW    +R +   C  S
Sbjct:   33 CQEITVPMCKGIGYNHTYMPNQFNHDTQDEAGMEVHQFWPLVVIQCSLDLKFFLCSMYTPICLPDYRKPLPPCRSVCERAKAGCSPLMRKYGFAWPERMNCDRLPEHGDPDTLCMYYNWTETTTTLPPTHPPKVKTPTSDCDGVCKCREPFVSITRESHPLYNRIKTGQVPNCAMPCFQPYFTQDEKMFVTFWIGLWSILCFISTFTTVATFLIDMERFRYPERPIIFLSACYLFVSIGYVVRLIVGHENVACNKDHIHYETTGPALCTIVFLLIYFFGMASSIWWVILTFTWFLAAGMKWGNEAIASYSQYFHMAAWLIPSVKSIAVLALSSVDGDPVAGICYVGNQNLDNLRGFVLAPLVVYLFSGTMFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFSVLYTVPATIVVACYIYEQHYREHWEKTHNCSC----PGDKQRYRPDYAVFMLKYLMCLVVGITSGVWIWSGKTLESW----KRFTGRCCRNS 523          
BLAST of Frizzled 5/8 protein vs. UniProt/SwissProt
Match: sp|Q13467|FZD5_HUMAN (Frizzled-5 OS=Homo sapiens OX=9606 GN=FZD5 PE=1 SV=2)

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 269/520 (51.73%), Postives = 363/520 (69.81%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLT-----ENQACLKKDTKNVT---------KP--------PSKGCEC--------KCRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIAC--DGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTK 1840
            C  I +PMC+ IGYNLT+MPN+F+H+TQ+EAGL VHQF+PLVEI CS +LR FLCS+Y PICLP++ KP+  CRSVCE A+ GC+P+M  YGF WP+ M CD+L          C+  +    T         KP        P+ G EC        KCR P++    ++ P +N V TG V NC   C+  +F + +++F TFW+GLW+VLC +S++ TV TFL+D  RF+YPERPI+FLS CY+ VS+G+++R+ VGH  +AC  + + + Y TTGPA C+IVFLL+YFFGMA+S+WWVIL++TWFL+AG+KWG+EAI+ Y++ FH  AW +  VKSI AL L ++DGDPV GICY+GN N  +L+ F++ PL +YLL+G+ FLL+GF++L  IR  I+ +G +KTDKLEKLM+RIGIF LLY+VPA++V+ C+LYE   RE WE +  C C  +   Q   +KPEY V MLKYFMCLVVGITSG WIW+ KT++SW    RR +   C +  +  K
Sbjct:   33 CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPPGAPASGGECPAGGPFVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSADERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHNHIHYETTGPALCTIVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGHDTGQPR-AKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESW----RRFTSRCCCRPRRGHK 546          
BLAST of Frizzled 5/8 protein vs. UniProt/SwissProt
Match: sp|Q8CHL0|FZD5_RAT (Frizzled-5 OS=Rattus norvegicus OX=10116 GN=Fzd5 PE=2 SV=1)

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 268/521 (51.44%), Postives = 359/521 (68.91%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKL--------------TENQACLKKDTKNVTKP--------PSKGCECK--------CRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIAC--DGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQ 1843
            C  I +PMC+ IGYNLT+MPN+F+H+TQ+EAGL VHQF+PLVEI CS +LR FLCS+Y PICLP++ KP+  CRSVCE A+ GC+P+M  YGF WP+ M CD+L                ++A          KP        PS G EC         CR P++    ++ P +N V TG V NC   C+  +F   +++F TFW+GLW+VLC +S++ TV TFL+D  RF+YPERPI+FLS CY+ VS+G+++R+ VGH  +AC  +   + Y TTGPA C++VFLL+YFFGMA+S+WWVIL++TWFL+AG+KWG+EAI+ Y++ FH  AW +  VKSI AL L ++DGDPV G+CY+GN N  +L+ F++ PL +YLL+G+ FLL+GF++L  IR  I+ +G +KTDKLEKLM+RIGIF LLY+VPA++V+ C+LYE   RE WE +  C C  +   Q   +KPEY V MLKYFMCLVVGITSG WIW+ KTL+SW    RR +   C  S +  K 
Sbjct:   33 CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGVCYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGSDAGQPR-AKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESW----RRFTSRCCCSSRRGHKS 547          
BLAST of Frizzled 5/8 protein vs. UniProt/SwissProt
Match: sp|Q9EQD0|FZD5_MOUSE (Frizzled-5 OS=Mus musculus OX=10090 GN=Fzd5 PE=1 SV=3)

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 269/521 (51.63%), Postives = 358/521 (68.71%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKL--------------TENQACLKKDTKNVTKP--------PSKGCECK--------CRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIAC--DGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQ 1843
            C  I +PMC+ IGYNLT+MPN+F+H+TQ+EAGL VHQF+PLVEI CS +LR FLCS+Y PICLP++ KP+  CRSVCE A+ GC+P+M  YGF WP+ M CD+L                ++A          KP        PS G EC         CR P++    ++ P +N V TG V NC   C+  +F   +++F TFW+GLW+VLC +S++ TV TFL+D  RF+YPERPI+FLS CY+ VS+G+++R+ VGH  +AC  +   + Y TTGPA C++VFLL+YFFGMA+S+WWVIL++TWFL+AG+KWG+EAI+ Y++ FH  AW +  VKSI AL L ++DGDPV GICY+GN N  +L+ F++ PL +YLL+G+ FLL+GF++L  IR  I+ +G +KTDKLEKLM+RIGIF LLY+VPA++V+ C+LYE   RE WE +  C C      Q   +KPEY V MLKYFMCLVVGITSG WIW+ KTL+SW    RR +   C  S +  K 
Sbjct:   33 CQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPR-AKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESW----RRFTSRCCCSSRRGHKS 547          
BLAST of Frizzled 5/8 protein vs. UniProt/SwissProt
Match: sp|O93274|FZD8_XENLA (Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 SV=1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 268/511 (52.45%), Postives = 351/511 (68.69%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTE--NQACLKKDTKNVTK---------------------------PP-----SKGCE--CKCRSPYIY---DNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKL------RYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWH 1783
            C  I +P+CK+IGYN TYMPN+F+H+TQ+EAG+ VHQF+PLV I CS +L+ FLCS+Y PICL ++ KP+  CRSVCE AR GCAP+M  YGF WP  M CD+L E  N   L  D  N T+                           PP     + GCE  C+CR+P +    +  P +N V TG + NC   CH+  F   +++F  FW+GLW+VLC  S+ ATV TFL+D  RFKYPERPI+FLS CY++VS GY+IR+  GHE +AC   +L       Y TTGPA C++VFLLIYFFGMA+S+WWVIL++TWFL+AG+KWG+EAI+ YS+ FH  AW +  +KSI  L L ++DGDPV GIC++GN N  NL+ F++ PL +YL IGS FLL+GF++L  IR  I+ +G +KTDKLEKLM+RIGIF +LY+VPA +V+ C  YE  NR+ WE ++NC   +   +Q +  +P+Y+VFMLKYFMCLVVGITSG WIW+ KTL+SW 
Sbjct:   28 CQEITVPLCKDIGYNYTYMPNQFNHDTQDEAGMEVHQFWPLVVIHCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYYNRTEQTTAAPSHPEPPKPPARSVPKGRTRVEPPRSRSRATGCESGCQCRAPMVQVSNERHPLYNRVRTGQIPNCAMPCHNPFFSPEERTFTEFWIGLWSVLCFASTFATVSTFLIDMERFKYPERPIIFLSACYLLVSTGYLIRLIAGHEKVACSRGELDLEHIIHYETTGPALCTLVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSIKSIAVLALSSVDGDPVAGICFVGNQNLDNLRGFVLAPLVIYLFIGSMFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFSVLYTVPATIVVACFFYEQHNRQGWEVAHNCNSCQPEMAQPH--RPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWR 535          
BLAST of Frizzled 5/8 protein vs. TrEMBL
Match: T1DBJ2 (Fzd-5/8-4 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1264.6 bits (3271), Expect = 0.000e+0
Identity = 606/606 (100.00%), Postives = 606/606 (100.00%), Query Frame = 2
Query:  272 QIGDDKLSSASKHLANNQLAIDRASADRSNQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACLKKDTKNVTKPPSKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQFPGNEQETPLCQINSNQITNGKPIEQCLVNQTALINPATHTGNLYTQHPMDSNALTHHIAGNVQHHLFVHKANSDLASVSRV 2089
            QIGDDKLSSASKHLANNQLAIDRASADRSNQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACLKKDTKNVTKPPSKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQFPGNEQETPLCQINSNQITNGKPIEQCLVNQTALINPATHTGNLYTQHPMDSNALTHHIAGNVQHHLFVHKANSDLASVSRV
Sbjct:   21 QIGDDKLSSASKHLANNQLAIDRASADRSNQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACLKKDTKNVTKPPSKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQFPGNEQETPLCQINSNQITNGKPIEQCLVNQTALINPATHTGNLYTQHPMDSNALTHHIAGNVQHHLFVHKANSDLASVSRV 626          
BLAST of Frizzled 5/8 protein vs. TrEMBL
Match: T1E109 (Fzd-5/8-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 1025.39 bits (2650), Expect = 0.000e+0
Identity = 487/609 (79.97%), Postives = 537/609 (88.18%), Query Frame = 2
Query:  272 QIGDDKLSSASKHLANNQLAIDRASADRSNQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACLKKDTKNVTKP-PSKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKH--TKQFPGNEQETPLCQINSNQITNGKPIEQCLVNQTALINPATHTGNLYTQHPMDSNALTHHIAGNVQHHLFVHKANSDLASVSRV 2089
            Q+ +DKLSSASK LANNQ+  DR   D SN ENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACS+NLRLFLCS+YAPICLPNWPK I+ACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTE+QACLKKDTKNVTKP  S GC+CKCR PYI DNKPQFNSVITGGV NCFQSCHSANFVS+DKSFVTFW+GLWAVLCC+SSTATV TFLLDRSRFKYPERPIVFLSGCYMMVS GYIIRVA+GHELIAC+ ++LRYGTTGPARCS+VFLLIYFFGMAASVWWVILT+TWFLSAGLKWGSEAI+KYSEIFHF+AWFLSG KSILALT VAIDGDP+ GICYIGNTN L+LKLFLI PL VYLL GSCFLLSGF+ALISIRKTIRAKGE+KTDKLEKLMMRIGIFGLLYSVPAAVVIGCH+YE+KNRE WE+S NC C R +    +F +PEYS+FMLKYFMCLVVGITSGFWIWT+KTLDSW+NAFR++ +++ G+  K+   K F G EQ+TPLCQ+N  Q+      +  +V Q +L+  ATH  N Y+QH  DSN L H   G++QHH F+H ANSDLASVSRV
Sbjct:   28 QLSNDKLSSASKQLANNQITFDRP-VDSSNSENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSENLRLFLCSMYAPICLPNWPKRIRACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTEDQACLKKDTKNVTKPQKSNGCDCKCRHPYILDNKPQFNSVITGGVHNCFQSCHSANFVSVDKSFVTFWIGLWAVLCCISSTATVFTFLLDRSRFKYPERPIVFLSGCYMMVSTGYIIRVAMGHELIACENNRLRYGTTGPARCSVVFLLIYFFGMAASVWWVILTVTWFLSAGLKWGSEAIAKYSEIFHFMAWFLSGAKSILALTFVAIDGDPIAGICYIGNTNPLHLKLFLIAPLLVYLLTGSCFLLSGFVALISIRKTIRAKGETKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHIYELKNRELWERSINCLCPRTLTEDVSFFRPEYSIFMLKYFMCLVVGITSGFWIWTTKTLDSWNNAFRQVGRALLGKPRKNNSAKHFLGTEQDTPLCQMNQKQMPVIVSPDSGMVTQNSLMTQATHISN-YSQHQADSNGLNHIGGGSIQHHHFIHNANSDLASVSRV 634          
BLAST of Frizzled 5/8 protein vs. TrEMBL
Match: T1DF88 (Fzd-5/8-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 647.892 bits (1670), Expect = 0.000e+0
Identity = 301/494 (60.93%), Postives = 378/494 (76.52%), Query Frame = 2
Query:  374 RPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACLKKDTKNVTKPP----SKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQ 1843
            RP KCVPI + MCK+IGYNLTY+PN+ +H +QEEAGL V QF+PLVEI CS++LRLF+CS+YAPICLPNWP  + ACRSVC SARDGC  VM  YGFKWP+ M+CD L E+ ACL+K  +   K       K C+C CR+P I D +  +N +ITGGV NC  SC +  F   DK+F TFW+GLWA LC +S+T T+ TF +DRSRF+YPERPI+FLS CY++++IGYIIRV +GHE IAC G+ +RYG TG   CSIVFLL+YFFGMA+S+WWVILT TWFL+AGLKW SEAI+ YS+++HF AWF+ G +SI  LT+ ++DGDP+ GIC++GNTN  NL +F+I+PL VYLLIGS FLL+GF++L+ IRKTI+ KGESKTDKLE LM+RIGIFG++YSVPA  VI C +YE+  R+ WEK+  C C      Q+ F  PEYSVFMLKYFM L+VG TSGFW+WTSKTLDSW    + + +S C +   H + 
Sbjct:   30 RPPKCVPIEMSMCKDIGYNLTYLPNDLNHGSQEEAGLEVSQFFPLVEINCSEDLRLFICSMYAPICLPNWPNRVPACRSVCISARDGCITVMRQYGFKWPERMNCDTLPEDNACLRKGNETNNKMSYSLIPKKCKCHCRAPLIKDTRDYYNKIITGGVNNCLMSCRAPYFTDFDKNFPTFWIGLWACLCIVSTTITMATFFIDRSRFQYPERPIIFLSFCYLLMAIGYIIRVGLGHEAIACKGESIRYGLTGTVPCSIVFLLVYFFGMASSIWWVILTATWFLAAGLKWSSEAITMYSDVYHFFAWFIPGFQSIFVLTMTSVDGDPISGICFVGNTNKFNLLVFVIIPLLVYLLIGSGFLLAGFLSLMKIRKTIKEKGESKTDKLENLMLRIGIFGIVYSVPAITVILCCVYELLYRDKWEKTYTCPCE-----QKKF-YPEYSVFMLKYFMTLIVGTTSGFWVWTSKTLDSWA---KIICRSCCEKEHSHDQM 514          
BLAST of Frizzled 5/8 protein vs. TrEMBL
Match: T1E0Z7 (Fzd-5/8-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 303/519 (58.38%), Postives = 388/519 (74.76%), Query Frame = 2
Query:  359 NQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACLKKDTKN--------VTKPP----SKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQFPGNEQETPLCQ 1879
            ++ + RP+ C+PI I MCK IGYNLTY+PN+ +H + EEAGL + QF  LVEI CS++LRLFLCS+YAPICLPNWP  I ACRS+C SAR+GC  VMN YGFKWP+ M+C+KL E+ ACL+KD K         V++ P    SK C C CRSP I D++  FN V+TG ++NC  +C S  F   DKSF TFWLG+WA +C +S++ T+LTF +D+SRF+YPERPI+FLS CY+++S+GY+IRVA+GHE +AC  D +RYG++G   CSIVFL IYFFGMA+S+WWV+LT TWFL+AGLKWGSEAI  Y++I+HF AWF+ G++SI+ LT+ ++DGDPV GICY+GN N  NL  F+I+PL VYLL+G+ FLL+GF+AL+ IRKTI+ KGESKTDKLEKLM+RI IFG++YSVP   V+ C +YE   R+ WE+S  C C R  K Q     PEYSVFMLKYFM LVVG T+GFWIWT KTLDSW   F +L   +C +   H K     + + PLC+
Sbjct:   26 SKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTTNFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYLLVGTGFLLAGFLALMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPC-RTKKYQ-----PEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL---LCCRKSLHYKVTCPTQLDKPLCK 535          
BLAST of Frizzled 5/8 protein vs. TrEMBL
Match: A0A2T7PZY2 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_01610 PE=3 SV=1)

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 278/518 (53.67%), Postives = 364/518 (70.27%), Query Frame = 2
Query:  374 RPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKL----TENQACLKKDTKNVTKPP--------------------------------------SKGCECKCRSPYIY---DNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAF 1792
            +P +C  I IPMCK IGYN TYMPN+F+HETQEEAGL VHQF+PLVEI CS +L+ FLCS+Y+PIC+ N+ KP+ ACRSVCE A+ GCAP+M  YGF WP+ MDC+KL     ++Q C+  +T +   PP                                       + C C+CR+P +    D+   +N  +TGG+ NC  +C+S  F   +++F TFW+GLW++LCC+S++ TV TF +D  RFKYPERPI+FLS CY MVSIGYIIR+ VGH+ +ACDGD +RY TTGPA C++VFLLIYFFGMA+S+WWVIL+ TWFL+AGLKWG EAI+ YS+ FH +AW +  VKSI  L + ++DGDP+ GIC++GN +  NL+ F++ PL +YL+IG+ FLL+GF++L  IR  I+ +G  KTDKLE+LM+RIG+F +LY+VPA +VI C+ YE   RE WE++  C C      QE  + P+YSVFMLKYFMCLVVGITSGFWIWT KT+DSW   F
Sbjct:   66 QPRRCQEITIPMCKGIGYNYTYMPNQFNHETQEEAGLEVHQFWPLVEIHCSPDLKFFLCSMYSPICMSNYRKPLPACRSVCERAKAGCAPLMRQYGFGWPEQMDCEKLPKYGDKDQLCMDANTTDRQTPPPHTKYTYPTARPSGVDFQRPLDHGALPLPPDQAPARSTERDCRCQCRAPLVEVHKDSSSYYNKTVTGGIINCAVNCYSPYFSEDERTFATFWIGLWSILCCISTSMTVSTFFVDMQRFKYPERPIIFLSACYFMVSIGYIIRLIVGHQEVACDGDMVRYETTGPAVCTVVFLLIYFFGMASSIWWVILSFTWFLAAGLKWGQEAIASYSQYFHLVAWLIPSVKSIAVLAMSSVDGDPIAGICFVGNQSLENLRGFVLAPLFIYLIIGTSFLLAGFVSLFRIRSVIKQQGRGKTDKLERLMIRIGVFSVLYTVPATIVIACYFYEQHLRERWERTRTCPC------QEGGAAPDYSVFMLKYFMCLVVGITSGFWIWTGKTVDSWRKLF 577          
BLAST of Frizzled 5/8 protein vs. Ensembl Cavefish
Match: ENSAMXT00000026985.2 (pep primary_assembly:Astyanax_mexicanus-2.0:19:27065879:27070162:-1 gene:ENSAMXG00000026259.2 transcript:ENSAMXT00000026985.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 556.599 bits (1433), Expect = 0.000e+0
Identity = 262/506 (51.78%), Postives = 349/506 (68.97%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLT----ENQACLKKDTKNVT-------KPPSKGC-----------------ECKCRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGD----KLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRR 1798
            C PI +PMCK IGYNLTYMPN+F+H+TQEE GL VHQF+PLV I CS +L  FLCS+Y PICLP++ KP+  CRSVCE A+ GC+P+M  YGF+WP+ M C++L      ++ C+ +++   T       KP  +G                  EC+CR P +    ++ P +N V TG + NC   CH   F   +++F TFW+GLW+VLC +S+  TV TFL+D  RFKYPERPI+FL+ CY+ VS+GYI+R+  GHE +AC G      + Y TTGPA C++VFLLIYFFGMA+S+WWV+L+ TWFL+AG+KWG+EAI+ YS+ FH  AW +  VKSI  L L ++DGDPV GICY+GN +  +L+ F++ PL VYL  GS FLL+GF++L  IR  I+ +G +KTDKLEKLM+RIG+F +LY+VPA +V+ C +YE   R  WE++  C C    + Q+    P+Y+VFMLKYFMCLVVGITSG WIW+ KTL+SW     R
Sbjct:   37 CEPITVPMCKGIGYNLTYMPNQFNHDTQEEVGLEVHQFWPLVRIRCSPDLLFFLCSMYTPICLPDYKKPLPPCRSVCERAKRGCSPLMIQYGFEWPERMSCEQLPMLGDPDRLCMDQNSSETTTLSPSFPKPTPRGSSRHRATSKSAVPQKCDRECRCREPLVPIKKESHPLYNRVQTGSLPNCALPCHQPYFSQDERAFTTFWIGLWSVLCFVSTLTTVATFLIDMERFKYPERPIIFLAACYLFVSLGYIVRLLAGHEKVACGGSGDQRHILYDTTGPALCTLVFLLIYFFGMASSIWWVVLSFTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLESLRGFVLAPLVVYLFSGSLFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGLFTVLYTVPATIVVACLVYEQHYRPEWEQALGCSCAS--ERQQQGLGPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWRRFVAR 539          
BLAST of Frizzled 5/8 protein vs. Ensembl Cavefish
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 520.005 bits (1338), Expect = 1.367e-177
Identity = 251/502 (50.00%), Postives = 340/502 (67.73%), Query Frame = 2
Query:  326 LAIDRASADRSNQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQA-------CRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACLKKDTKNVTKPPSKGCE--CKCRSPYIYDNK---PQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIAC----DGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWH 1783
            L +   +  RS+    +   C  IA+P+CK +GYN TYMPN+F+H+TQ+EAGL VHQF+PLVEI CS +LR FLCS+Y PICL ++ KP+         C     +     +PV++    +  K       T++    +   +   + P   C+  C+CR+P +  N    P +N V TG + NC   CH+  F   +++F  FW+GLW+VLC +S+ ATV TFL+D  RFKYPERPI+FLS CYM VSIGYI+R+  GHE +AC    D + + Y TTGPA C++VFLLIYFFGMA+S+WWVIL++TWFL+AG+KWG+EAI+ YS+ FH  AW +  +KSI  L L ++DGDPV GICY+GN N  NL+ F++ PL +YL IG+ FLL+GF++L  IR  I+ +G +KTDKLEKLM+RIGIF +LY+VPA +++ C+ YE  NR+ WE S+NC C      +    +P+Y+VFMLKYFMCL VGITSG WIW+ KTLDSW 
Sbjct:   12 LFLALGTLQRSSGTTAKELTCQEIAVPLCKGVGYNHTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLRFFLCSMYTPICLEDYKKPLPVQGDPDTLCMDYNRTDSTTASPVLSKPTGRPGKPHVPPHRTKHG---RPGVQPPKRKPGSPCDPGCQCRAPMVRVNSERHPLYNRVKTGQMPNCAMPCHNPYFTQDERTFTAFWIGLWSVLCFVSTFATVATFLIDMERFKYPERPIIFLSACYMFVSIGYIVRLIAGHEKVACSREYDVEHVHYETTGPALCTVVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIASYSQYFHLAAWLIPSMKSIAVLALSSVDGDPVAGICYVGNQNLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTVLYTVPATIIVACYFYEQHNRQSWETSHNCSC----LMEHELRRPDYAVFMLKYFMCLSVGITSGVWIWSGKTLDSWR 505          
BLAST of Frizzled 5/8 protein vs. Ensembl Cavefish
Match: fzd7b (frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GENE-990415-229])

HSP 1 Score: 433.721 bits (1114), Expect = 8.223e-144
Identity = 220/509 (43.22%), Postives = 318/509 (62.48%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQA---CLKKDTKNVTKP------------PSKGCECKCRSPY---IYDNKPQFNSVITGGVANCFQSCHSAN------FVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDG---DKLRYGTTGPAR--CSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIK---SQENFS--KPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQS 1810
            C PI+IP+C +I YN T MPN   H  QE+AGL VHQFYPLV++ CS +L+ FLCS+YAP+C     + I  CRS+CE AR GC  +MN +GF+WP+ + C+    + A   C+ ++T +   P            P  G E +   P+   +    P + +    G  +C   C  +       F   +  F   W+G+WA+LCC+S+  TVLT+L+D  RF+YPERPI+FLSGCY MV++ Y+    +  +++  D    D  R    G  +  C+I+F+++YFFGMA+S+WWVIL++TWFLSAG+KWG EAI   S+ FH  AW +  VK+I  L L  +DGD + G+C++G  N   L+ F++ PL VYL IG+ FLL+GF++L  IR  ++  G +KT+KLEKLM+RIG+F +LY+VPA +VI C+ YE   RE WEK+ +    +         NF+   P+++VFM+KY M ++VGITSGFWIW+ KTL SW + ++RL  +
Sbjct:   50 CQPISIPLCTDIQYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSADLKFFLCSMYAPVCT-VLEQAIPPCRSLCERARHGCEALMNKFGFQWPERLRCEAFPVHGAGEICVGQNTSDPGSPTSEPTLYAPGLTPPPGPE-RSGQPFTCPLQLAVPSYLNYKFLGAKDCGAPCEHSQPHGLMYFREEEMKFGRLWVGIWAILCCVSTLFTVLTYLVDMRRFRYPERPIIFLSGCYFMVAVAYVTGFLLEDKVVCIDKFREDAYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILALGQVDGDLLTGVCFVGIYNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFREQWEKTWHMQTCKRFAVPCPSSNFAPMSPDFTVFMIKYLMTMIVGITSGFWIWSGKTLQSWRSFYKRLGNA 555          
BLAST of Frizzled 5/8 protein vs. Ensembl Cavefish
Match: fzd9a (frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GENE-060531-77])

HSP 1 Score: 432.18 bits (1110), Expect = 9.977e-143
Identity = 233/534 (43.63%), Postives = 325/534 (60.86%), Query Frame = 2
Query:  323 QLAIDRASADRS--NQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQ---ACLKKDTKNVTKPPSKGCE------CKCRSPYIYDNKPQFNSVITGGVANC-----FQSCHSAN-------------FVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDK-----LRYG--TTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWE-KSNNCYC-----NRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRR 1798
            QL  D +S D    + E  RP KC PI IPMC+ IGYN+T MPN   +E+QEEA + +++F PLVE  C  +LR FLCSLY P+C       I ACR++C  AR  C+P+M  + F WP S+DC KL  N    A   +  +N T PP+K  E       + R P     +P      +GG  +C     FQ    +              +   DK F   W+ +W+ LC +S+  TVLTFLLD  RF+YPERPI+FLS CY + S+ +IIR   G E IACD +      ++ G  +TG   C+IVFL++Y+FGMA+S+WWVILT+TWFL+AG KWG EAI  +S  FH +AW +  +K+I+ LT+  + GD + G+CY+G+ ++  L  F+I+PL+ YL+IG+ F+L+GF+AL  IRK ++  G + T+KLEKLM++IG+F +LY+VPA  VI C+ YE  N ++W+ +++   C      R      + S P  +VFMLK FM LVVGITSG W+W+SKTL +W     R
Sbjct:   28 QLVSDGSSLDIGAYDGERGRPAKCEPITIPMCQGIGYNMTRMPNFMKYESQEEASIKLNEFAPLVEYGCDVHLRFFLCSLYVPMCTDQVSTTIPACRAMCVQARQKCSPIMEQFSFGWPDSLDCSKLPTNNDPNALCIEAPENDTVPPTKKGEGMLPVPARPRPPGTGAGRP------SGGSGSCENHEKFQYVEKSESCAPRCSPTVDVFWSRQDKDFAFIWMVVWSTLCFVSTAFTVLTFLLDPQRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRENGQLYIIQEGLESTG---CTIVFLILYYFGMASSIWWVILTLTWFLAAGRKWGHEAIEAHSSYFHMVAWGIPAMKTIVILTMRKVAGDELTGLCYVGSMDTNALTGFIIIPLSCYLIIGTSFILTGFVALFHIRKIMKTGG-TNTEKLEKLMVKIGVFSILYTVPATCVIICYFYERLNMDYWKFRASESKCVSFPGRRTEDCTLDSSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLCAR 551          
BLAST of Frizzled 5/8 protein vs. Ensembl Cavefish
Match: fzd9b (frizzled-9 [Source:NCBI gene;Acc:103027133])

HSP 1 Score: 430.639 bits (1106), Expect = 2.769e-142
Identity = 231/528 (43.75%), Postives = 320/528 (60.61%), Query Frame = 2
Query:  326 LAIDRASADRSNQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKL----TENQACLKKDTKNVTKPPSKGCECKCRSP-----------------YIYDNKPQFNSVITGGVANCFQSCHSANFV---SIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDK-----LRYG--TTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWE-KSNNCYC-----NRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRR 1798
            +A+        + E  RP KC PI IPMC+ IGYNLT MPN   H++Q+EA + +++F PLVE  C  +LR FLCSLYAP+C       I ACR +CE AR  C+P+M  + + WP+S+DC KL      N  C++   +N TKP  K  E     P                    +N  +F  V      +C   C SA  V     DK F   W+ +W+ LC +S+  TVLTFLLD  RF+YPERPI+FLS CY + S+ +IIR   G E IACD +      ++ G  +TG   C+IVFL++Y+FGMA+S+WWVILT+TWFL+AG KWG EAI  +S  FH  AW +  +K+I+ LT+  + GD + G+CY+G+ +   L  F++VPL+ YL++G+ F+L+GF+AL  IRK ++ +G + T+KLEKLM++IGI+ +LY+VPA  VI C+ YE  N ++W+ +     C      RN     + S P  +VFMLK FM LVVGITSG W+W+SKTL +W     R
Sbjct:   22 IAVSSLEIGSYDFERGRPAKCEPIVIPMCQGIGYNLTRMPNFMDHDSQKEAAIKLNEFAPLVEYGCDVHLRFFLCSLYAPMCTDQVSTSIPACRPMCEQARQRCSPIMEKFNYAWPESLDCSKLPTRNDPNALCMEAP-ENDTKPEPKKGEGMLPVPPRPRQPGSGGGRPGGSVGACENPEKFQYVEKS--ESCAPRCSSAVDVFWSRQDKDFAFIWMAVWSTLCFVSTAFTVLTFLLDPHRFQYPERPIIFLSMCYNVYSVAFIIRSVAGAENIACDRENGELYIIQEGLESTG---CTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIESHSSYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDVGALTGFVLVPLSFYLVVGTSFVLTGFVALFHIRKVMKTEG-TNTEKLEKLMVKIGIYSILYTVPATCVIVCYFYERLNMDYWKFRGLESKCVTFPGRRNEDCSLDASMPAVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQGLCSR 542          
BLAST of Frizzled 5/8 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011009.1 (pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gene:ENSPMAG00000009982.1 transcript:ENSPMAT00000011009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 256/536 (47.76%), Postives = 353/536 (65.86%), Query Frame = 2
Query:  374 RPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKL----TENQACLKKDTKNVT-KPPS--------------------------------KGCE--CKCRSPYIY---DNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDK--LRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQEN----FSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHT 1837
            R   C  I +PMC+ IGYN TYMPN+F+H++Q+EAGL VHQF+PLVEI CS +LR FLCS+Y PICL ++ +P+  CRSVCE AR GCAP+M  YGF WP  M CD+L     +N+ C+  +  + T +PP                                 + CE  C CR+P +    D  P +N V TG V NC   CH   F   +++F +FW+GLW++LC +S+  TV+TFL+D  RFKYPERPI+FLS CY  VS+GYI+R+ VGH+ + C+ +   + Y TTGPA C++VFLL YFFGMA+S+WWVIL++TWF++AG+KW SEAI+ YS+ +H  AW L  V+S+  L   ++D DP+ GIC +G  +  NL+ F++VPLTVYL +G+ FLL+GF +L+ IR  I+ +G +KTDKLEKLM+RIGIF +LY+VPA  V+ C+ YE ++R+ W ++  C   +  +   +      +P+Y +FMLKYFMCLVVGITSG WIW+ KT+D+W    +RL    CG   K +
Sbjct:    5 REMLCQNITVPMCRGIGYNHTYMPNDFNHDSQDEAGLEVHQFWPLVEIKCSPDLRFFLCSMYTPICLEDYKQPLPPCRSVCERARAGCAPLMRQYGFAWPDRMRCDRLPVLGDQNRLCMDYNKSDTTPQPPEVKPTAPVRSFNPSKNRATTRVGGGGGGGGGSGEACESGCACRAPMVAIGSDRHPLYNRVRTGSVLNCAMPCHDPYFTQDERTFASFWIGLWSILCFVSTFTTVVTFLIDMERFKYPERPIIFLSACYAFVSMGYIVRLVVGHDGVICNQEHRHVHYETTGPALCTVVFLLTYFFGMASSIWWVILSLTWFMAAGMKWSSEAIAGYSQYYHLAAWLLPSVQSVAVLATSSVDADPLAGICSVGAQSLENLRGFVLVPLTVYLCVGAVFLLAGFTSLVRIRNAIKQQGGTKTDKLEKLMVRIGIFSMLYTVPAIAVVACYFYEERSRDGWARALICPSCQGDEEPGSQQQQQQRPDYGIFMLKYFMCLVVGITSGVWIWSGKTVDTW----KRLCCRCCGLGGKSS 536          
BLAST of Frizzled 5/8 protein vs. Ensembl Sea Lamprey
Match: fzd2 (frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GENE-990415-224])

HSP 1 Score: 417.157 bits (1071), Expect = 2.367e-138
Identity = 219/535 (40.93%), Postives = 315/535 (58.88%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLT---ENQACLKKD---------------------------------TKNVTKPPSKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSAN------FVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDG---DKLRYGTTGPAR--CSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEK---SNNCY-----CNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQS 1825
            C PI+IP+C +I YN T MPN   H  QE+AGL VHQFYPLV++ CS +L+ FLCS+YAP+C     K I  CRS+C+ AR GC  +MN +GF+WP+ + C+       ++ C+ ++                                 T +  +PP +     C  P +    P  N+ +     NC   C          F   +  F   W+G+W+VLCC S+  TV T+L+D  RF+YPERPI+FLSGCY MV++ Y+    +  +++  +    D  R  T G  +  C+I+F+LIYFF MA+S+WWV+L +TWFL+AG+KWG EAI   S+ FH  AW +  VK+I  L +  +DGD + G+C++G ++   L+ F++ PL VYL +G+ FLL+GF++L  IR  ++  G +KT+KLEKLM+RIGIF +LY+VPA +VI C+ YE   RE WEK   S +C      C  N        KP+++VFM+KY M L+VGITSGFWIW+ KTL SW   + +L+    G++
Sbjct:   13 CQPISIPLCTDIPYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVCT-VLEKAIPPCRSLCDRARQGCEALMNKFGFQWPERLRCENFPVQGSDEICVGQNHTDKAGPTALPPTPPGGGGGVIGGIGGGAGDFVTIHTRRPPGRTHPFMC--PRVLKVPPYLNAQLFRE-RNCAAPCEPKKPNGLMYFSEEELRFSRLWVGIWSVLCCASTLFTVTTYLVDMQRFRYPERPIIFLSGCYFMVAVAYVAGFLLDDKVVCNEQFSEDIYRTVTQGTKKEGCTILFMLIYFFSMASSIWWVVLALTWFLAAGMKWGHEAIEANSQYFHLAAWAIPAVKTITILAMGLVDGDMLSGVCFVGISSVAALRGFVLAPLFVYLFLGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLEKLMVRIGIFSVLYTVPATIVIACYFYEQAFREQWEKTWVSQSCKGFAIPCPLNHYPN---MKPDFTVFMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTKLANGNKGET 539          
BLAST of Frizzled 5/8 protein vs. Ensembl Sea Lamprey
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 380.948 bits (977), Expect = 1.956e-126
Identity = 185/367 (50.41%), Postives = 253/367 (68.94%), Query Frame = 2
Query:  761 CE--CKCRSPYIYDNKPQ---FNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGD--KLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAK-GESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNC-YCNRNIKS-QENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDK 1831
            CE  C CR+P +  + P+   ++ V TG V NC   CHS       ++F +FW+GLW+ LC  ++ ATV TFL+D  RFKYPERPI+FLS C M+ S+GYI+R+  GHE +AC  D   + Y ++GPA C+ VFLL YFFGMA  VWWVIL++TWF++AGLKWGSEAI+ YS+ +H  AW L  +K+I AL + A+DGDPV GIC +GN +  NL+ F++ PL  YLL+G+ FLL+G +AL  IR  I A  G +KT+KLE+LM+RIG+F +LY+VPAAV + CHLYE ++R+ WE++  C  C        E  ++P+++VFMLKYF+CLV GITSG WIW+ KT  SW   ++R      G+  +
Sbjct:    1 CEPICGCRAPLVRISNPRHVLYDRVRTGQVRNCATPCHSPFLGREQRTFASFWIGLWSSLCFAATFATVSTFLIDMERFKYPERPIIFLSLCCMLASLGYIVRMVAGHEAVACSADWHHVLYASSGPALCTAVFLLTYFFGMAGCVWWVILSLTWFMAAGLKWGSEAIAGYSQYYHLAAWLLPSIKAIAALAMNAVDGDPVAGICSVGNQSLDNLRGFVLAPLVAYLLVGTAFLLAGLVALFRIRNAISANPGGAKTEKLERLMVRIGVFAVLYTVPAAVAVVCHLYEQQHRDSWERTLVCGACGPGPGHLPEPGARPDFAVFMLKYFVCLVGGITSGAWIWSGKTAGSWKRFYKRCRAWRAGKRHR 367          
BLAST of Frizzled 5/8 protein vs. Ensembl Sea Lamprey
Match: fzd7a (frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GENE-990415-223])

HSP 1 Score: 316.235 bits (809), Expect = 8.844e-99
Identity = 154/322 (47.83%), Postives = 218/322 (67.70%), Query Frame = 2
Query:  890 FVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGT----TGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQ------ENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQS 1825
            F   W+G+W++LCC S+  TVLT+L+D  RF+YPERPI+FLSGCY +VSI YI+      +++     +  Y T    T    C+I+F+++YFF MA+S+WWVIL++TWFLSAG+KWG EAI   S+ FH  AW +  +K+I  L +  +DGD + G+C++G  +   L+ F++ PL VYL IG+ FLL+GF++L  IR  ++  G +KT+KLEKLM+RIGIF +LY+VPA +VI C+ YE   R  WEKS   +  ++   Q       N  KP+++VFM+KY M L+VGITSGFWIW+ KTL SW N + RLS    G++
Sbjct:  274 FARMWVGVWSILCCASTLFTVLTYLVDMERFRYPERPIIFLSGCYAVVSIAYIVGFFFEEKIVCNKFFEDSYSTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILAMGQVDGDVLTGVCFVGLNSIDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLEKLMVRIGIFSVLYTVPATIVIACYFYEQAFRAQWEKSWVAHTCKSFAVQCPQGHYPNM-KPDFTVFMIKYLMTLIVGITSGFWIWSGKTLQSWRNFYSRLSNKSHGET 593          

HSP 2 Score: 128.257 bits (321), Expect = 3.609e-31
Identity = 55/104 (52.88%), Postives = 73/104 (70.19%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKL 697
            C PI+IP+C +I YN T MPN   H  QE+AGL VHQFYPLV++ CS +L+ FLCS+YAP+C     + I  CRS+CE AR GC  +MN +GF+WP+ + C+  
Sbjct:   57 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPDLKFFLCSMYAPVCT-VLEEAIPPCRSLCERARQGCETLMNKFGFQWPERLRCENF 159          
BLAST of Frizzled 5/8 protein vs. Ensembl Sea Lamprey
Match: fzd3b (frizzled class receptor 3b [Source:ZFIN;Acc:ZDB-GENE-070122-1])

HSP 1 Score: 217.238 bits (552), Expect = 3.831e-63
Identity = 131/351 (37.32%), Postives = 199/351 (56.70%), Query Frame = 2
Query:  830 GVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPAR--------CSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKS---NNCYCNR---NIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAF---RRLSQSICGQSDK 1831
            GV +C   C +  F S +     + +G+ +V+C +++T T LTFLLDR RF+YPERPI+F + CY+ VS+ +++   +     AC+   L  G  G           C+ VF+L+YF  MA ++WWV+LTITWFL+AGLKWG EAI K +  FH LAW      ++  L L  ++GD + G+CY G  +   L+ F++ PL      G   LL+G ++L  +R  +R  G ++T KL K M+RIG+F +LY VP   ++ C +YE  +R  WE +   + C   R     ++ +   +P   +F++KYF  LVVGI   FW+ + KT   W  AF   RR  Q++  +S +
Sbjct:   26 GVPDCSPPCPNMYFSSGELELTRYLVGVMSVVCLVATTFTFLTFLLDRKRFRYPERPIIFYATCYVAVSLSFLVGFLLDDSAAACNAPGLAPGAAGTVTQGSRNNKACTAVFMLLYFSAMAGALWWVVLTITWFLAAGLKWGREAIEKRAAAFHALAWGPPAALTVALLALNKVEGDNLSGVCYAGLYDVTTLRYFVLAPLGACAAAGLSLLLAGIVSLNRVRLEMRHDGRNQT-KLVKFMVRIGVFSVLYLVPQLALVACLVYEQASRAAWEATWLRDRCTEYRIPCPYQANQPKQRPALVLFLVKYFTTLVVGIPPAFWVGSRKTCLGW-AAFLSGRRHKQAVVNESRR 374          
BLAST of Frizzled 5/8 protein vs. Ensembl Nematostella
Match: EDO42932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S003])

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 267/497 (53.72%), Postives = 348/497 (70.02%), Query Frame = 2
Query:  383 KCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKL----TENQACLKKDTKNVTKP-PSKGCE--------------CKCRSPYIY---DNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKL-RYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLS 1804
            KC  I IPMC+ IGYNLTYMPN F+H+TQ EA L VHQF+PLVEI CS +LR FLCS+YAP+C  ++ K +  CRSVCE AR GCAP+M  YGF WP+ M C+       EN  C+ +++   + P PS+  +              C CR P++     N     ++  GGV  C  +C+   F     SF +FW+GLWA+LC +S+  T LTFL+D  RFKYPERPI+FLSGCY+MVS+GYIIR+  GH+ IACD + L RY T+GPA C+IVFLL+YFFGMA+SVWWVIL  TWFLSAG+KW SEAI+ YS+ FH +AW +  +++I  L +  IDGDPV GICY+GN N  +L +F+IVPL VYL+ G+ FL++GF +L+ IRK +R  G +KTDKLEKLM+RIG+F +LY+VPA +V+ C+ YE+ NRE WE++ NC      +      KP++SVF++KYFM LVVGITSGFWIW+ KT++SW N   RLS
Sbjct:   28 KCEEITIPMCRGIGYNLTYMPNMFNHDTQAEAALEVHQFWPLVEIQCSPDLRFFLCSMYAPLCEKHYDKDLPPCRSVCERARTGCAPLMRKYGFSWPERMKCENFPELGDENTLCMGRNSSGESTPKPSQSPQPAPSPDTAAISANCCSCRPPFVSIAGKNIKPTRAISVGGVPQCAMACNRTYFTHDQDSFASFWIGLWAILCFISTLVTTLTFLVDMHRFKYPERPIIFLSGCYLMVSVGYIIRLIAGHKQIACDSNGLMRYDTSGPASCTIVFLLVYFFGMASSVWWVILAFTWFLSAGMKWSSEAITNYSQYFHAVAWLVPAIQAIAVLAMSTIDGDPVSGICYVGNHNLQSLVVFVIVPLVVYLVFGTSFLMAGFYSLVRIRKLLRQHGSTKTDKLEKLMIRIGVFSVLYTVPATIVVACYYYELVNRETWERTINCSGCGVTR-----VKPDHSVFIIKYFMALVVGITSGFWIWSGKTIESWRNFCARLS 519          
BLAST of Frizzled 5/8 protein vs. Ensembl Nematostella
Match: EDO38567 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCF4])

HSP 1 Score: 439.113 bits (1128), Expect = 1.053e-145
Identity = 238/585 (40.68%), Postives = 336/585 (57.44%), Query Frame = 2
Query:  299 ASKHLANNQLAIDRASADRSNQENFRPN-KCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACLKKDTKNVTKPPSKGC----ECKCRSPY----IYDN----KPQFNSVITGG-----------VANCFQSCHS-ANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDK---LRYGT--TGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKS---NNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQFPGNEQETPLCQINSNQITNGKPIEQCLVNQTALINP 1954
             +K LA   L     SA    Q +  PN KC PI IP+C  IGYN T  PN    E+QEEA   +H+F PL+ + C+  LR FLCS++ P+C      PI ACRS+CESARDGC+P+M  +GF WP ++DCD+L       KK        P+K C      K  +P     I+ N     P+F  +   G              C   C S   F S +K F   W+ +W+VLC +S+  TVLTF++D SRFKYPERPI+FLS CY + S+GYI+RV  G   + CD  +   +R G      A CS+VFLL+Y+FGMA++VWWV+LT  WFL+AG KWG EAI + +  FH +AW +  +++I+AL +  +D D + G+CY+GN +  NL  +++ PL +YLL+G+ FLL+GF++L  IR  ++ K E+ TDKLEKL++RIG+F +LY++P + VI C  YE  N + W+     N   C  +    EN+  P   VF++KYFM L++GITS  WIW++KT  SW   +   S+   G++ K      G+         NS Q+    P  Q + + T+   P
Sbjct:    2 GAKRLALILLLFITVSAMVYGQRSEVPNSKCTPITIPLCMGIGYNATRFPNFLAQESQEEAAKRIHEFKPLIAVNCAPLLRFFLCSVFVPMCTKEVNVPIYACRSMCESARDGCSPMMQRFGFNWPDTLDCDRLP------KKGDPQAKSDPTKLCMAAPNIKQTAPLNESDIWSNFESLGPEFKKINNTGPLRYKYTYVEKYDQCVPQCKSDLMFSSNNKRFANVWISVWSVLCFISTAVTVLTFVIDTSRFKYPERPIIFLSLCYNLYSLGYIVRVTAGRNEVICDETESFVIRAGMNIADHACCSVVFLLLYYFGMASAVWWVVLTFAWFLAAGRKWGQEAIERKATYFHAVAWTVPAIQTIMALIMRKVDADELTGLCYVGNMDYENLANYVLTPLCLYLLVGTFFLLAGFVSLFRIRTVLKNK-ETNTDKLEKLIVRIGVFSVLYTIPVSAVIACSFYEYNNMDVWKVRAPFNTYICRGDQACLENYG-PSIEVFIVKYFMLLIIGITSNMWIWSTKTFKSWRKFY---SKRKGGEAKKKVDYSAGSAPPK-----NSLQVHMPPPSVQPVYHHTSAFAP 570          
BLAST of Frizzled 5/8 protein vs. Ensembl Nematostella
Match: EDO35751 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM6])

HSP 1 Score: 429.483 bits (1103), Expect = 7.090e-143
Identity = 216/510 (42.35%), Postives = 306/510 (60.00%), Query Frame = 2
Query:  380 NKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTE--NQACLKKDT-----------KNVTKPPSKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYG-------TTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQE----------------NFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRL 1801
             +C P+ IP+C  + YN+T  PN   H TQEEA L VHQF+PLV++ CS +L  FLCS+YAP+C      P+  CRS+C + R GC  +M  +GF WP S+ C++  +  ++ C+ ++T            N T P       + R P     K   +     G   C  +C +  F   ++     W G+WA+LC +S+  T+LTFL+D  RF+YPERPI+FLSGCY MVSI +I     G + IAC+ + ++ G        T    C+++F+++YFF MA+S+WWVILT+TWFL+AGLKWG EAI   S+ FH  AW +  VK+I  L +  +DGD + G+CY+G ++   L+ +++ PL VY +IG+ FLL+GFI+L  +R  ++    SK +K+EKLM+RIG+F +LY+VPA VVIGC  YE  NRE W+ S      R  K  E                   KP++ VFM+KY M L+VGITSGFWIW+SKTL+SW   +RR 
Sbjct:   27 KRCEPVTIPLCTGLQYNMTIFPNTLKHRTQEEAALEVHQFFPLVKVDCSKDLAFFLCSVYAPVCT-VLETPLPPCRSLCLTVRSGCEGLMKRFGFTWPDSLSCERFPKLGDEICVGENTTTPTSDQDGGINNNTYPDVDMSTMRYRCPE--SQKIPNDQYTFHGEKRCAATCRNVFFTKREREIARMWTGIWAILCAVSTLFTILTFLIDMRRFRYPERPIIFLSGCYFMVSIAFITGYVAGDK-IACN-EPIKKGFPKTLVQGTKHEGCTVIFMMLYFFSMASSIWWVILTVTWFLAAGLKWGQEAIEANSQFFHLAAWAIPAVKTIAILLMTKVDGDELSGVCYVGLSDVSALRGYVLAPLFVYFIIGATFLLAGFISLFRVRSVLK-DDYSKREKIEKLMIRIGVFSILYTVPALVVIGCLYYEQSNRELWDNSWIEGWKRQKKCTEVETKLKGEVSCPPYPVPLQKPDFMVFMVKYLMFLIVGITSGFWIWSSKTLNSWRRFYRRF 530          
BLAST of Frizzled 5/8 protein vs. Ensembl Nematostella
Match: EDO30865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZJ6])

HSP 1 Score: 378.252 bits (970), Expect = 1.734e-123
Identity = 205/523 (39.20%), Postives = 307/523 (58.70%), Query Frame = 2
Query:  383 KCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACS-DNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKL----TENQACL------------KKDTKNVT----KPPSKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSAN-FVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGD---KLRYGTTGPAR---CSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQFPGNEQET 1867
            KC  I+I +C+++GYN+T MPN   HETQ+EA   + QF PL++  C+ + L  FLCS YAP+C       I +CR +CE  R  C PV+  +G  WP  ++C +      E   C+            + D K +     KPPS G E +CR    + N   +  V      +C   C+    F + DK  +  W+ +W++ C +S+T T+ TFL++  RFKYPER I++L+ CY   S+ YIIR+  G + I+CD D    +++      R   C+IVFL+ YFF MAA++WWV+L +TWFL+AG+KWG EAI  Y+++FH +AW L  +K+I  L    +DGD + G+C++GN + + L  F++ P   YL+IG+ FL++GF+AL  IR T++  G++KTDKLE+L++RIGIF +L +VPA  VI C+ YE  N+E+W      Y  R+    E    P +S+FMLK FM L  G+ +G WIW+ KT+++W   + ++S        K  +   GN  ET
Sbjct:    3 KCEKISIDLCRSVGYNVTRMPNLIGHETQKEAESQLKQFLPLIQYGCAREQLVFFLCSAYAPMCTDKVDVVITSCRPLCEYVRKSCLPVLTEFGIPWPNPLNCTRFLVRNNERNMCMPGPNFTESPEKPRPDFKPINDTTEKPPSTGSE-QCRR---FKNSKNYFYV--QSTESCAVRCNEDGIFKTSDKETMDIWITIWSIFCFISTTITLTTFLIETGRFKYPERSIIWLALCYNFYSLSYIIRLGAGRQAISCDTDPTTHVKFHIQDGLRNTGCAIVFLIQYFFCMAATIWWVVLALTWFLAAGMKWGCEAIGSYAKLFHIIAWILPCIKTIFILITRKVDGDELTGLCFVGNQDLIALAAFVLGPQFTYLIIGTLFLIAGFVALFRIRTTVQRGGQAKTDKLERLIVRIGIFSVLSTVPATAVIACYFYEYANKEYWY-----YGQRDGAVAE----PNFSIFMLKVFMSLFTGVITGMWIWSHKTMNTWRAFYYKVSGK--RPPRKLERNGNGNTNET 508          
BLAST of Frizzled 5/8 protein vs. Ensembl Nematostella
Match: EDO40119 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S829])

HSP 1 Score: 157.532 bits (397), Expect = 4.488e-41
Identity = 129/505 (25.54%), Postives = 227/505 (44.95%), Query Frame = 2
Query:  383 KCVPIAIPMCKNIGYNLTYMPNEF--HHETQEEAGLVVHQFYPLVEI-ACSDNLRLFLCSLYAPIC------LPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQ--ACLKKDTKNVTKPPSKGCECKCRSPYIYDN-KPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLD-RSRFKYPERPIVFLSGCYMMVSIGYIIRVA--VGHELIACDGDKLRYGTTGPAR---CSIVFLLIYFFGMAASVWWVILTITWFLS-AGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTD-KLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNN----CYCNRNIKSQENF----SKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSI 1813
            KC P+    C     +  Y   E      +Q++    + ++  L  +  C + L+ FLC +Y P C      LP        CR  C + R  C+ V+ +Y  +WP+ + CDKL E      LKK   N         E  C++P +    KP +      G+  C   C +  F   + + +  ++  +  L  + +  TV+TFL+  +S+ +YP   + F++ C+ + S+G++I+ +     +++    D +R G    +    C + F+L+Y+F +A   W+V+L  +W +    L    +  +  +  FH ++W L  V +   L +  +D + + GIC++G  N      FL+ PL + L+IG  FL  G   L  +RK+      ++   K+++ +MR+G F  +      +   CH+YE  N+E WE+S      C  N  +K   N      +   SV  L        GI    W WTS T  +W   + R++ S+
Sbjct:   25 KCEPLKEQTCLGEKLDYHYTTTELVTDSSSQDQVKKNLEKWEGLKFLPKCWEVLQPFLCQIYKPKCKNGSVELP--------CREQCFATRKPCS-VVESYR-RWPEFLRCDKLPEGNCNGTLKKLHLN---------ESACKAPLVETAYKPSWYE----GIEGCGIQCMNPIFSEEEHTRIHRFVAAFGTLTTVCTLFTVVTFLVGWKSQNRYPSVILFFMNACFCVASVGFLIQFSSDARRKVVCRRDDTMRLGEPTESDSFLCVLTFVLVYYFSLAGMTWFVMLAYSWCICFKTLGSTRDNFAGKTGYFHIISWSLPAVLTGCVLLVKQVDANSISGICFVGYKNPSMRAGFLLAPLGLDLVIGGMFLAKGLFTLFKLRKSNPNFLSNRASIKIKETIMRVGFFAFVAFAFVFITFACHVYEYYNQERWERSYRAFLMCIANHEVKGVSNTCSIKDRANLSVLELSLSSLFGAGIAMSGWTWTSNTFKTWKKLWHRVTTSV 506          
BLAST of Frizzled 5/8 protein vs. Ensembl Medaka
Match: fzd8a (frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GENE-000328-3])

HSP 1 Score: 558.14 bits (1437), Expect = 0.000e+0
Identity = 267/510 (52.35%), Postives = 350/510 (68.63%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKL----TENQACLKKDTKNVT------------------------------KPPSKGCE--CKCRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGD----KLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHN 1786
            C  IA+P+CK IGYN TYMPN+F+H+TQ+EAGL VHQF+PLVEI CS +L+ FLCS+Y PICL ++ KP+  CRSVCE AR GCAP+M  YGF WP  M CD L      +  C+  +  + T                              KPP+  CE  C+C  P +    +  P +N V TG V NC   CH+  F   +++F  FW+GLW+VLC +S+ ATV TFL+D  RFKYPERPI+FLS CYM VS+GYI+R+  GHE +AC+ D     + Y TTGPA C+IVFLLIYFFGMA+S+WWVIL++TWFL+AG+KWG+EAI+ Y++ FH  AW +  +KSI  L L ++DGD V GICY+GN N  NL+ F++ PL +YL IG+ FLL+GF++L  IR  I+ +G +KTDKLEKLM+RIGIF +LY+VPA V++ C+ YE  NR+ WE ++NC  +  ++ +   S P+Y+VFMLKYFMCL+VGITSG WIW+ KTLDSW  
Sbjct:   21 CQGIAVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERARAGCAPLMRQYGFPWPDRMRCDLLPVQGNPDTLCMDYNRNDSTTASPVLSKPTNHPGRSPKSKPGRAGAPGKYKPPAAPCEPGCRCLEPMVAVTTERHPLYNRVKTGQVTNCAMPCHNPYFTHDERAFTAFWIGLWSVLCFVSTFATVATFLIDMERFKYPERPIIFLSACYMFVSVGYIVRLIAGHEKVACNRDFDVEHIHYETTGPALCTIVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIASYAQHFHLAAWLIPSMKSIAVLALSSVDGDSVAGICYVGNQNLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIK-QGGTKTDKLEKLMIRIGIFTVLYTVPATVIVACYFYEQHNRQDWEMTHNC-SSCLMERERARSGPDYAVFMLKYFMCLLVGITSGVWIWSGKTLDSWRT 528          
BLAST of Frizzled 5/8 protein vs. Ensembl Medaka
Match: ENSORLT00000013002.2 (pep primary_assembly:ASM223467v1:21:5638676:5644296:-1 gene:ENSORLG00000010376.2 transcript:ENSORLT00000013002.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 262/500 (52.40%), Postives = 351/500 (70.20%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCD---KLTENQACLKKDT---------------KNVTKPPSKG-C--ECKCRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGD-----KLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRR 1798
            C PI +PMCK IGYNLTYMPN+F+H+TQEE GL VHQF+PLV I CS +L  FLCS+Y PICLP++ KP+  CRSVCE A+ GC+P+M+ YGF+WP+ M C+   +L +   C+ +++               K  T+PPS   C  EC+CR P I    ++   F  V TG + NC   CH   F + +++F +FW+GLW+VLC +S+  TV TFL+D  RFKYPERPI+FL+ CY+ VS+GYIIR+  GHE +AC         + Y  TGPA C++VFLL+YFFGMA+S+WWV+L+ TWFL+AG+KWGSEAI+ YS+ FH  AW +  VKSIL L L ++DGDPV GICY+GN +  NL+ F++ PL VYL  G+ FLL+GF++L  IR  I+ +G +KTDKLE+LM+RIG+F +LY+VPA +V+ C +YE   R  WE++  C C   ++ Q +   P+Y+VFMLKYFMCLVVGITSG WIW+ KTL+SW +   R
Sbjct:   24 CEPITVPMCKGIGYNLTYMPNKFNHDTQEEVGLEVHQFWPLVRIRCSPDLLFFLCSMYTPICLPDYRKPLPPCRSVCERAKRGCSPLMSQYGFEWPERMSCEGLPQLGDETLCMDQNSSEATTSAPPFPKSTPKVRTRPPSPSQCDRECRCRDPLIPIKRESHALFGRVQTGPLPNCALPCHLPYFSADERAFTSFWVGLWSVLCFISTLTTVATFLIDMERFKYPERPIIFLAACYLFVSLGYIIRLVAGHERVACGAGGTSQLHILYDATGPALCTLVFLLVYFFGMASSIWWVVLSFTWFLAAGMKWGSEAIAGYSQYFHLAAWLIPSVKSILVLALSSVDGDPVAGICYVGNQSLENLRGFVLAPLVVYLFTGTLFLLAGFVSLFRIRSIIK-QGGTKTDKLERLMIRIGLFTVLYTVPATIVVACLVYEQHYRPSWERALACSC--PLERQRSIRGPDYAVFMLKYFMCLVVGITSGVWIWSGKTLESWRSFVAR 520          
BLAST of Frizzled 5/8 protein vs. Ensembl Medaka
Match: ENSORLT00000002667.2 (pep primary_assembly:ASM223467v1:17:316235:318512:1 gene:ENSORLG00000002147.2 transcript:ENSORLT00000002667.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 259/516 (50.19%), Postives = 347/516 (67.25%), Query Frame = 2
Query:  383 KCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTE----NQACLKKDTKNVT-------------------------------KPPSKGCE--CKCRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACD----GDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRR 1798
            +C  I++P+CK IGYN T+MPN+FHH+TQ+EAGL VHQF+PLVEI CS +LR FLCS+Y PICL ++ KP+  CR VCE A+ GCAP+M  YGF WP  M CD L E    +  C+   ++  T                               KP    CE  C CR+P +    +  P  N V TG + NC   C++  F   +++F +FW+GLW++LC +S+  TV TFL+D  RFKYPERPI+FLS CYM VS+GYI+R+  GHE +AC+       + Y TTGPA C+IVFLLIYFFGMA+S+WWVIL++TWFL+AG+KWG+EAI  YS+ FH  AW +  +KSI  L L ++DGD V G+CY+GN N  +L+ F++ PL +YL+IG+ FLL+GF++L  IR  I+ +G +KTDKLE+L++RIG+F +LY+VPA V++ C+ YE  NR+ WE ++NC C      Q    +P Y+VFMLKYFMCL+VGITSG WIW+ KTLD+W    RR
Sbjct:   23 QCQEISVPLCKGIGYNYTHMPNKFHHDTQDEAGLEVHQFWPLVEIKCSPDLRFFLCSMYTPICLEDYKKPLPPCRGVCERAKAGCAPLMRQYGFPWPDRMRCDLLPEQGNHDSLCMDYSSQTTTVSPALAKPTNRPLKPYNKRKGPYGRTFPGKHKPAGSPCEAACSCRAPMVPVSSEGHPLHNRVRTGQIVNCAVPCYNPYFTQEERTFTSFWIGLWSILCFISTFTTVATFLIDMERFKYPERPIIFLSACYMFVSVGYIVRLVAGHEEVACNMWNGAGYIHYETTGPALCTIVFLLIYFFGMASSIWWVILSLTWFLAAGMKWGNEAIGSYSQHFHLAAWLIPSMKSIAVLALSSVDGDSVAGVCYVGNQNLDSLRGFVLAPLVIYLVIGTMFLLAGFVSLFRIRSVIK-QGGTKTDKLERLIIRIGVFTVLYTVPATVIVACYFYEQHNRQAWEITHNCTCATEPSKQ----RPNYAVFMLKYFMCLLVGITSGAWIWSGKTLDTWRTFCRR 533          
BLAST of Frizzled 5/8 protein vs. Ensembl Medaka
Match: fzd7b (frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GENE-990415-229])

HSP 1 Score: 427.943 bits (1099), Expect = 1.264e-141
Identity = 217/522 (41.57%), Postives = 319/522 (61.11%), Query Frame = 2
Query:  386 CVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTEN---QACLKKDT--------------KNVTKPPSKGCECKCRSPY---------IYDNKPQFNSVITGGVANCFQSCHSAN------FVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACD---GDKLRYGTTGPAR--CSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQ---ENFS--KPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQS 1825
            C PI+IP+C +I YN T MPN   H  QE+AGL VHQFYPLV++ CS  L+ FLCS+YAP+C     + I  CRS+CE AR GC  +MN +GF+WP+ + C+    N   + C+ ++T              + VT PP++      + P+         +    P +      GV +C   C          F   +  F   W+G+W++LCC+S+  TVLT+L+D  RF+YPERPI+FLSGCY MV++ Y     +  +++  D   G+  R    G  +  C+I+F+++YFFGMA+S+WWVIL++TWFLSAG+KWG EAI   S+ FH  AW +  +K+I  L +  +DGD + G+C++G  N   L+ F++ PL VYL IG+ FLL+GF++L  IR  ++  G +KT+KLEKLM+RIG+F +LY+VPA +VI C+ YE   RE WE++ +    +         NF+   P+++VFM+KY M ++VGITSGFW+W+ KTL SW   ++RL     G++
Sbjct:   30 CQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSTELKFFLCSMYAPVCT-VLEQAIPPCRSLCERARQGCEALMNKFGFQWPERLHCEAFPVNGGSEICVGQNTSEPGSPSSSSPHVPELVTVPPNRFPNPP-QPPHNSYHQFSCPLQLEVPSYLGYRFMGVKDCGAPCEPTKPSGIMYFREDEVKFGRLWVGIWSILCCVSTLFTVLTYLVDMRRFRYPERPIIFLSGCYFMVAVAYAAGFFLEDKVVCVDKFKGEGFRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILAMGQVDGDVLTGVCFVGIFNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDG-TKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERTWHMQTCKRFAVPCPVHNFAPMTPDFTVFMIKYLMTMIVGITSGFWVWSGKTLQSWRRFYKRLGNGNHGET 548          
BLAST of Frizzled 5/8 protein vs. Ensembl Medaka
Match: fzd9b (frizzled class receptor 9 [Source:NCBI gene;Acc:101174936])

HSP 1 Score: 428.713 bits (1101), Expect = 1.918e-141
Identity = 234/560 (41.79%), Postives = 331/560 (59.11%), Query Frame = 2
Query:  326 LAIDRASADRS--NQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKL----TENQACL-----------------------------KKDTKNVTKPPSKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSANFV---SIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDK-----LRYG--TTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFW-----EKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQ--SDKHTKQFP 1849
            L +  +S + S  + E  RP KC PI IPMC  IGYNLT MPN   H+ Q EA + + +F PLV+  C  +LR FLCSLYAP+C       I ACR +CE ARD CAP+M  + + WP S+DC KL      N  C+                             + DT + ++ P  G  C+    + +  K Q          +C   C  A  V     DK F   W+ +W++LC +S+  TVLTFLL+  RF+YPERPI+FLS CYM+ S+ +IIR   G E IACD +      ++ G  +TG   C+IVFL++Y+FGMA+S+WWVILT+TWFL+AG KWG EAI  +S  FH  AW +  +K+I+ LT+  + GD + G+CY+G+ +S  L  F+++PL+ YL+IG+ F+L+GF+AL  IRK ++ +G + T+KLEKLM++IGI+ +LY+VPA  VI C+ YE  N ++W     ++  + + + N K     S P  +VFMLK FM LVVGITSG W+W+SKTL +W        Q +C +  SD+ + + P
Sbjct:   19 LPVSASSLEMSFYDLERDRPAKCEPIVIPMCVGIGYNLTRMPNFMDHDDQAEAAIKLQEFAPLVDYGCDVHLRFFLCSLYAPMCTDKVSTSIPACRPMCEQARDKCAPIMKKFSYTWPDSLDCSKLPTRNDPNALCMEAPENETRTEGKKDKKKGEGMLPVPPRPRQPDTPS-SRLPGSGNSCENPDKFQFVEKSQ----------SCAPRCSPAVDVYWSRQDKDFAFIWMTVWSILCFVSTAFTVLTFLLEPHRFQYPERPIIFLSMCYMVYSLAFIIRSVAGAENIACDREHGELYIIQEGLESTG---CTIVFLILYYFGMASSIWWVILTLTWFLAAGKKWGHEAIEAHSNYFHMAAWGIPALKTIVILTMRKVAGDELTGLCYVGSMDSGALTGFVLIPLSCYLIIGTSFILTGFVALFHIRKVMKTEG-TNTEKLEKLMVKIGIYSILYTVPATCVIVCYFYERLNMDYWKLRGLQEECDSFSSHNSKCSLETSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTW--------QGLCSRKLSDRTSSRKP 555          
BLAST of Frizzled 5/8 protein vs. Planmine SMEST
Match: SMESG000005043.1 (SMESG000005043.1)

HSP 1 Score: 1264.6 bits (3271), Expect = 0.000e+0
Identity = 606/606 (100.00%), Postives = 606/606 (100.00%), Query Frame = 2
Query:  272 QIGDDKLSSASKHLANNQLAIDRASADRSNQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACLKKDTKNVTKPPSKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQFPGNEQETPLCQINSNQITNGKPIEQCLVNQTALINPATHTGNLYTQHPMDSNALTHHIAGNVQHHLFVHKANSDLASVSRV 2089
            QIGDDKLSSASKHLANNQLAIDRASADRSNQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACLKKDTKNVTKPPSKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQFPGNEQETPLCQINSNQITNGKPIEQCLVNQTALINPATHTGNLYTQHPMDSNALTHHIAGNVQHHLFVHKANSDLASVSRV
Sbjct:   21 QIGDDKLSSASKHLANNQLAIDRASADRSNQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACLKKDTKNVTKPPSKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQFPGNEQETPLCQINSNQITNGKPIEQCLVNQTALINPATHTGNLYTQHPMDSNALTHHIAGNVQHHLFVHKANSDLASVSRV 626          
BLAST of Frizzled 5/8 protein vs. Planmine SMEST
Match: SMESG000031852.1 (SMESG000031852.1)

HSP 1 Score: 647.506 bits (1669), Expect = 0.000e+0
Identity = 303/519 (58.38%), Postives = 388/519 (74.76%), Query Frame = 2
Query:  359 NQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACLKKDTKN--------VTKPP----SKGCECKCRSPYIYDNKPQFNSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQFPGNEQETPLCQ 1879
            ++ + RP+ C+PI I MCK IGYNLTY+PN+ +H + EEAGL + QF  LVEI CS++LRLFLCS+YAPICLPNWP  I ACRS+C SAR+GC  VMN YGFKWP+ M+C+KL E+ ACL+KD K         V++ P    SK C C CRSP I D++  FN V+TG ++NC  +C S  F   DKSF TFWLG+WA +C +S++ T+LTF +D+SRF+YPERPI+FLS CY+++S+GY+IRVA+GHE +AC  D +RYG++G   CSIVFL IYFFGMA+S+WWV+LT TWFL+AGLKWGSEAI  Y++I+HF AWF+ G++SI+ LT+ ++DGDPV GICY+GN N  NL  F+I+PL VYLL+G+ FLL+GF+AL+ IRKTI+ KGESKTDKLEKLM+RI IFG++YSVP   V+ C +YE   R+ WE+S  C C R  K Q     PEYSVFMLKYFM LVVG T+GFWIWT KTLDSW   F +L   +C +   H K     + + PLC+
Sbjct:   26 SKPDLRPSTCIPIEISMCKGIGYNLTYIPNDLNHASLEEAGLEIQQFNALVEINCSEDLRLFLCSMYAPICLPNWPNRIPACRSLCISAREGCTRVMNQYGFKWPEGMNCEKLPEDNACLRKDNKTRSNKTANFVSERPYLLKSKKCHCHCRSPLIIDSRDHFNKVVTGNISNCLMNCRSPYFGEFDKSFSTFWLGIWACVCIISTSVTILTFCIDKSRFQYPERPIIFLSICYLLMSVGYLIRVALGHEAVACKSDAIRYGSSGAVPCSIVFLFIYFFGMASSIWWVVLTATWFLAAGLKWGSEAILMYADIYHFFAWFIPGIQSIIILTMSSVDGDPVSGICYVGNLNKYNLLFFVIIPLIVYLLVGTGFLLAGFLALMKIRKTIKEKGESKTDKLEKLMIRISIFGIVYSVPTMTVVFCSIYEFIFRDLWEQSYTCPC-RTKKYQ-----PEYSVFMLKYFMNLVVGTTAGFWIWTPKTLDSWSKVFCKL---LCCRKSLHHKVTCPTQLDKPLCK 535          
BLAST of Frizzled 5/8 protein vs. Planmine SMEST
Match: SMESG000035834.1 (SMESG000035834.1)

HSP 1 Score: 556.984 bits (1434), Expect = 0.000e+0
Identity = 276/553 (49.91%), Postives = 362/553 (65.46%), Query Frame = 2
Query:  353 RSNQENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLT-----ENQACLKKDTKN--------VTKPPSKG------------------------------CECKCRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVS-IDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDK---------LRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSIC--GQSDKHT 1837
            +S+  N    KC  I IPMCK+I YN+T MPN F+HE Q+EAG   HQFYPLV+I CS++L+ FLCS+Y PICL  + K +  CRSVCE  + GC P++  Y FKWP+ M+CD+       E   C++K+           VT  P +                               C+C CR P I     NK  FN V T G+ NC Q C S  F S  D+ F+ FWLGLW ++C LS+ + V TF +D  R++YPERPI+F+S CY MVS+G++IR+ +GHE +ACD  K         LRYG +GPA C+IVFLLIY+FGMAAS+WWV+LTITWFL+AGLKWGSEAISKYS+I+HFLAWFL G+KSI+ALT+ A+DGDPV GICY+GNT+  NL LF++ PL VYL IG+  L+SGF +L  IR  I+ +   KT+KLEKLM+RIG+F +LY+ PAAV++ C +YE++NR  W ++ +C C  + + Q N  +P YSVFM KYFM + VG+TSGFWIW+ KT+ SW     RL  + C   + +KHT
Sbjct:   32 KSDNTNRDKGKCEIIKIPMCKDIHYNMTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVVTLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDSIKAKDGSSLSLLRYGGSGPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHT 584          
BLAST of Frizzled 5/8 protein vs. Planmine SMEST
Match: SMESG000035834.1 (SMESG000035834.1)

HSP 1 Score: 532.332 bits (1370), Expect = 1.752e-180
Identity = 263/527 (49.91%), Postives = 346/527 (65.65%), Query Frame = 2
Query:  431 LTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLT-----ENQACLKKDTKN--------VTKPPSKG------------------------------CECKCRSPYI---YDNKPQFNSVITGGVANCFQSCHSANFVS-IDKSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDK---------LRYGTTGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSIC--GQSDKHT 1837
            +T MPN F+HE Q+EAG   HQFYPLV+I CS++L+ FLCS+Y PICL  + K +  CRSVCE  + GC P++  Y FKWP+ M+CD+       E   C++K+           VT  P +                               C+C CR P I     NK  FN V T G+ NC Q C S  F S  D+ F+ FWLGLW ++C LS+ + V TF +D  R++YPERPI+F+S CY MVS+G++IR+ +GHE +ACD  K         LRYG +GPA C+IVFLLIY+FGMAAS+WWV+LTITWFL+AGLKWGSEAISKYS+I+HFLAWFL G+KSI+ALT+ A+DGDPV GICY+GNT+  NL LF++ PL VYL IG+  L+SGF +L  IR  I+ +   KT+KLEKLM+RIG+F +LY+ PAAV++ C +YE++NR  W ++ +C C  + + Q N  +P YSVFM KYFM + VG+TSGFWIW+ KT+ SW     RL  + C   + +KHT
Sbjct:    1 MTMMPNMFNHENQDEAGFEAHQFYPLVQIKCSEDLQFFLCSIYTPICLKQYVKSLPPCRSVCERVKKGCDPLLQKYTFKWPEKMNCDQFPVYNNPEKILCMEKNLSTASTTLASVVTLAPKEQNDANSRQVAEQNLLNEVSYQLTRQYNSRVFCQCSCRKPLIDIAEINKAHFNRVSTLGMFNCAQGCKSPFFSSESDQKFIGFWLGLWTIICLLSTFSIVATFSIDPGRYRYPERPIIFMSICYFMVSLGFLIRIVMGHEDLACDSIKAKDGSSLSLLRYGGSGPAHCTIVFLLIYYFGMAASLWWVLLTITWFLAAGLKWGSEAISKYSQIYHFLAWFLPGIKSIVALTMSAVDGDPVSGICYVGNTSDFNLILFVLSPLLVYLTIGTLVLISGFASLFRIRSIIKLQTGGKTEKLEKLMIRIGVFSVLYTAPAAVIVACIIYELQNRAEWYQNLSCDCFDSNRHQLNLPRPSYSVFMFKYFMFMGVGMTSGFWIWSKKTILSWKMVCYRLGINSCHVEERNKHT 527          
BLAST of Frizzled 5/8 protein vs. Planmine SMEST
Match: SMESG000040115.1 (SMESG000040115.1)

HSP 1 Score: 354.369 bits (908), Expect = 8.397e-113
Identity = 206/500 (41.20%), Postives = 290/500 (58.00%), Query Frame = 2
Query:  431 LTYMPNEFHHETQEEAGLVVHQFYPLVEIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYGFKWPKSMDCDKLTENQACLKKDTKNVTKPP--SKGCECKCRSPYIYDNKPQF--NSVITGGVANCFQSCHSANFVSID-KSFVTFWLGLWAVLCCLSSTATVLTFLLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGTTGPA-----------RCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEIFHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLTVYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYSVPAAVVIGCHLYEVKNREFW-------------EKSNNC---YCNRNIKSQEN---FS-KPEYSVFMLKYFMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQ 1822
            +T  PN   H TQ+EA L ++++ PL+ I C  +L+LFLCSLY P+C     K +  CRS+C   +  C P++  + FKWP+SM CD   EN  C++ +       P  S  C    + P  YD K +   NSVI     +C   C+   F   + + F   W+ LW+ +C  S+  TVLTFL+D  RF+YPERPI+FLS CY++V + Y+    +  + +AC G      +TG              C I+F+L+YFF MA+++WWV+LTITW+L+A   W  E+I + S+ FHF AW +   K+I  L L  +DGDP+ G+C+ G ++   L+ FLI PL +YLLIG+ FL++GF+++  IR  I+  G SKTDKLEKL+ RIGIF +LY VPA VVI C+ +E  N   W             E  + C   + ++ I    N   FS KPE+ +FM+KY M L+VGITSG WIW+ KTL SW   F RL    CG+
Sbjct:    1 MTIFPNHMLHSTQDEAALEINEYVPLMRIKCHGSLQLFLCSLYFPVCTIM-KKALPPCRSLCLQIKKECEPILKKFYFKWPQSMSCDLYPENNLCIRDNQTEKESAPNVSLSCPKSLQIPVSYDFKIRLSQNSVI----QDCGIPCNRYYFNEPNLRKFARVWVALWSFMCVGSTLFTVLTFLIDMKRFQYPERPIIFLSACYLVVGLTYVAGFFLNDK-VACAGPFTNKDSTGKTPKIVVQGTKFESCIILFMLLYFFSMASAIWWVVLTITWYLAAKCHWAHESIGRNSQYFHFAAWAIPAGKTIGILALSKVDGDPLTGVCFTGLSDPSTLRGFLIAPLCIYLLIGTGFLIAGFVSMFEIRTIIKTGG-SKTDKLEKLITRIGIFSVLYVVPAVVVIACYFHESMNLYKWMQRWYLIDICRSAEYKDECKKIHDHKPINPGGNALIFSQKPEFELFMIKYLMSLIVGITSGIWIWSGKTLLSWKYFFSRL----CGR 489          
The following BLAST results are available for this feature:
BLAST of Frizzled 5/8 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FZD50.000e+051.73frizzled class receptor 5 [Source:HGNC Symbol;Acc:... [more]
FZD106.151e-14745.56frizzled class receptor 10 [Source:HGNC Symbol;Acc... [more]
FZD75.181e-14041.63frizzled class receptor 7 [Source:HGNC Symbol;Acc:... [more]
FZD28.158e-13842.26frizzled class receptor 2 [Source:HGNC Symbol;Acc:... [more]
FZD11.948e-13540.11frizzled class receptor 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Frizzled 5/8 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cfz-22.674e-13339.73Frizzled-2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECQ... [more]
mom-52.846e-10036.36pep chromosome:WBcel235:I:9965580:9970037:1 gene:W... [more]
mom-59.172e-10036.38pep chromosome:WBcel235:I:9965580:9969413:1 gene:W... [more]
lin-172.391e-7829.98Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
lin-172.391e-7829.98Transmembrane receptor LIN-17 [Source:UniProtKB/T... [more]
back to top
BLAST of Frizzled 5/8 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fz22.160e-16645.88gene:FBgn0016797 transcript:FBtr0112890[more]
fz22.160e-16645.88gene:FBgn0016797 transcript:FBtr0075029[more]
fz22.160e-16645.88gene:FBgn0016797 transcript:FBtr0332735[more]
fz22.160e-16645.88gene:FBgn0016797 transcript:FBtr0330194[more]
fz22.160e-16645.88gene:FBgn0016797 transcript:FBtr0075028[more]
back to top
BLAST of Frizzled 5/8 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd8a0.000e+051.31frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd8b0.000e+052.08frizzled class receptor 8b [Source:ZFIN;Acc:ZDB-GE... [more]
fzd8b0.000e+052.08frizzled class receptor 8b [Source:ZFIN;Acc:ZDB-GE... [more]
fzd50.000e+051.38frizzled class receptor 5 [Source:ZFIN;Acc:ZDB-GEN... [more]
fzd9a2.075e-14644.02frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Frizzled 5/8 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zdhhc90.000e+054.00zinc finger DHHC-type containing 9 [Source:Xenbase... [more]
fzd80.000e+051.86frizzled class receptor 8 [Source:NCBI gene;Acc:10... [more]
ntrk11.036e-13942.75neurotrophic receptor tyrosine kinase 1 [Source:Xe... [more]
bdh21.025e-13742.223-hydroxybutyrate dehydrogenase 2 [Source:Xenbase;... [more]
FZD94.665e-13342.36frizzled class receptor 9 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Frizzled 5/8 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fzd50.000e+051.63frizzled class receptor 5 [Source:MGI Symbol;Acc:M... [more]
Fzd50.000e+051.63frizzled class receptor 5 [Source:MGI Symbol;Acc:M... [more]
Fzd80.000e+045.94frizzled class receptor 8 [Source:MGI Symbol;Acc:M... [more]
Fzd102.387e-14646.08frizzled class receptor 10 [Source:MGI Symbol;Acc:... [more]
Fzd71.414e-14041.63frizzled class receptor 7 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Frizzled 5/8 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P58421|FZD5_XENLA0.000e+053.80Frizzled-5 OS=Xenopus laevis OX=8355 GN=fzd5 PE=2 ... [more]
sp|Q13467|FZD5_HUMAN0.000e+051.73Frizzled-5 OS=Homo sapiens OX=9606 GN=FZD5 PE=1 SV... [more]
sp|Q8CHL0|FZD5_RAT0.000e+051.44Frizzled-5 OS=Rattus norvegicus OX=10116 GN=Fzd5 P... [more]
sp|Q9EQD0|FZD5_MOUSE0.000e+051.63Frizzled-5 OS=Mus musculus OX=10090 GN=Fzd5 PE=1 S... [more]
sp|O93274|FZD8_XENLA0.000e+052.45Frizzled-8 OS=Xenopus laevis OX=8355 GN=fzd8 PE=1 ... [more]
back to top
BLAST of Frizzled 5/8 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1DBJ20.000e+0100.00Fzd-5/8-4 OS=Schmidtea mediterranea OX=79327 PE=2 ... [more]
T1E1090.000e+079.97Fzd-5/8-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV... [more]
T1DF880.000e+060.93Fzd-5/8-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV... [more]
T1E0Z70.000e+058.38Fzd-5/8-1 OS=Schmidtea mediterranea OX=79327 PE=2 ... [more]
A0A2T7PZY20.000e+053.67Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of Frizzled 5/8 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000026985.20.000e+051.78pep primary_assembly:Astyanax_mexicanus-2.0:19:270... [more]
fzd8a1.367e-17750.00frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd7b8.223e-14443.22frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9a9.977e-14343.63frizzled class receptor 9a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9b2.769e-14243.75frizzled-9 [Source:NCBI gene;Acc:103027133][more]
back to top
BLAST of Frizzled 5/8 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011009.10.000e+047.76pep scaffold:Pmarinus_7.0:GL485859:2701:4509:1 gen... [more]
fzd22.367e-13840.93frizzled class receptor 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
fzd8a1.956e-12650.41frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd7a8.844e-9947.83frizzled class receptor 7a [Source:ZFIN;Acc:ZDB-GE... [more]
fzd3b3.831e-6337.32frizzled class receptor 3b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Frizzled 5/8 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Frizzled 5/8 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO429320.000e+053.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385671.053e-14540.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357517.090e-14342.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308651.734e-12339.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401194.488e-4125.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Frizzled 5/8 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fzd8a0.000e+052.35frizzled class receptor 8a [Source:ZFIN;Acc:ZDB-GE... [more]
ENSORLT00000013002.20.000e+052.40pep primary_assembly:ASM223467v1:21:5638676:564429... [more]
ENSORLT00000002667.20.000e+050.19pep primary_assembly:ASM223467v1:17:316235:318512:... [more]
fzd7b1.264e-14141.57frizzled class receptor 7b [Source:ZFIN;Acc:ZDB-GE... [more]
fzd9b1.918e-14141.79frizzled class receptor 9 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Frizzled 5/8 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005043.10.000e+0100.00SMESG000005043.1[more]
SMESG000031852.10.000e+058.38SMESG000031852.1[more]
SMESG000035834.10.000e+049.91SMESG000035834.1[more]
SMESG000035834.11.752e-18049.91SMESG000035834.1[more]
SMESG000040115.18.397e-11341.20SMESG000040115.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016952 ID=SMED30016952|Name=Frizzled 5/8 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2231bp
TAATAGAACGATTAAGATGCCCGTTACAGAATTATCGTTTCTGTTCGAAA
TTCGACAATCATTAGAAATATTATCATTATTGGATCAAGAATAATAATTT
TTTTCTTGTCAACAACAACCGAAAAGAAAGTTAAGTCTAGTTAAAAATTC
CTGAAATGATCCTCAATGATGTTCATTTAATTTTTTTTGGTTGGAAAAAT
TAAAGAAAACAATGATTTTAATTTGCTTATTGTTTTCTTCTTCCCATCTA
CTGCTCACTTCCTCCGGATCCCAGATCGGCGATGACAAATTAAGCTCAGC
TTCAAAACATCTGGCCAACAATCAACTAGCGATAGATCGGGCATCTGCCG
ACAGATCAAACCAGGAGAATTTTCGACCAAACAAATGCGTCCCAATTGCT
ATACCAATGTGTAAAAATATCGGATATAACTTGACTTATATGCCCAATGA
ATTTCATCATGAAACACAGGAAGAAGCCGGATTAGTAGTACATCAATTTT
ATCCTTTGGTTGAAATTGCTTGTTCTGATAACCTAAGACTATTCCTATGC
AGTTTGTACGCTCCGATTTGCCTACCGAATTGGCCGAAACCTATCCAAGC
GTGCAGATCAGTTTGCGAGAGTGCTCGAGACGGATGCGCTCCCGTCATGA
ATACGTATGGATTTAAATGGCCGAAAAGTATGGATTGTGATAAATTGACG
GAAAATCAAGCTTGCCTTAAAAAGGATACGAAAAATGTCACAAAACCACC
TTCCAAAGGTTGTGAATGCAAATGCAGATCACCGTACATTTACGATAACA
AGCCTCAGTTCAATTCAGTAATTACCGGTGGAGTAGCGAATTGTTTTCAG
AGCTGTCATTCAGCGAATTTTGTCAGTATAGACAAAAGTTTTGTAACATT
TTGGTTGGGTTTATGGGCTGTGCTTTGTTGCCTTAGTAGTACAGCTACTG
TCCTGACGTTTTTGCTTGATCGTTCTCGTTTCAAATATCCGGAACGTCCG
ATCGTATTTCTGTCTGGTTGTTATATGATGGTTTCCATTGGTTACATAAT
TCGCGTTGCAGTCGGACATGAATTAATAGCCTGTGATGGAGACAAATTGA
GATATGGGACGACTGGGCCAGCGCGATGTTCAATTGTGTTTTTACTAATA
TACTTTTTTGGCATGGCTGCGTCCGTTTGGTGGGTAATTTTGACGATTAC
TTGGTTTTTATCAGCTGGATTAAAATGGGGTAGTGAAGCTATTTCAAAAT
ACTCTGAGATTTTTCATTTTCTGGCGTGGTTCTTGTCTGGTGTGAAGAGC
ATTCTGGCATTGACATTGGTGGCAATTGACGGGGATCCTGTTGGAGGAAT
TTGCTACATAGGCAACACTAACAGTCTCAATCTCAAATTATTTTTAATTG
TCCCATTAACTGTTTATTTGTTAATTGGATCGTGTTTTCTGTTATCAGGG
TTTATCGCTTTAATAAGCATTAGAAAAACTATTCGAGCCAAAGGAGAATC
GAAAACTGACAAATTGGAGAAACTAATGATGCGCATTGGAATATTTGGAT
TGCTATACAGTGTTCCAGCTGCTGTCGTAATCGGATGCCATCTTTACGAA
GTAAAAAATCGAGAATTTTGGGAAAAGTCCAACAATTGTTATTGCAATCG
TAACATAAAGTCTCAAGAGAACTTTTCCAAGCCAGAATATTCTGTGTTTA
TGCTCAAATATTTTATGTGTTTGGTTGTTGGAATTACTTCAGGATTTTGG
ATTTGGACGTCGAAAACACTCGATTCTTGGCACAATGCATTTCGGCGACT
TTCACAGAGCATTTGCGGTCAATCTGACAAACACACAAAACAGTTTCCCG
GAAACGAACAAGAAACTCCTCTTTGTCAGATCAATTCGAATCAAATAACG
AATGGAAAACCCATTGAACAGTGTTTAGTTAATCAGACCGCGTTGATCAA
TCCAGCCACTCACACGGGCAATTTATATACTCAACATCCAATGGATAGCA
ACGCATTGACGCATCATATTGCTGGCAACGTTCAGCATCATTTATTCGTA
CACAAAGCTAACTCAGATTTGGCCTCGGTGTCCAGGGTATAATAATAAAA
TAAAAGACAAAAATGATTAATTCAAGAAATAAATCTATGAATATTTTTGA
TCTCCTGATGATAAACCCAAAGTTTTTGACATAGTTTCTTGCAATAAAGT
TGTAAATATTATCTATTTTCAATGTGTGGAC
back to top

protein sequence of SMED30016952-orf-1

>SMED30016952-orf-1 ID=SMED30016952-orf-1|Name=SMED30016952-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=627bp
MILICLLFSSSHLLLTSSGSQIGDDKLSSASKHLANNQLAIDRASADRSN
QENFRPNKCVPIAIPMCKNIGYNLTYMPNEFHHETQEEAGLVVHQFYPLV
EIACSDNLRLFLCSLYAPICLPNWPKPIQACRSVCESARDGCAPVMNTYG
FKWPKSMDCDKLTENQACLKKDTKNVTKPPSKGCECKCRSPYIYDNKPQF
NSVITGGVANCFQSCHSANFVSIDKSFVTFWLGLWAVLCCLSSTATVLTF
LLDRSRFKYPERPIVFLSGCYMMVSIGYIIRVAVGHELIACDGDKLRYGT
TGPARCSIVFLLIYFFGMAASVWWVILTITWFLSAGLKWGSEAISKYSEI
FHFLAWFLSGVKSILALTLVAIDGDPVGGICYIGNTNSLNLKLFLIVPLT
VYLLIGSCFLLSGFIALISIRKTIRAKGESKTDKLEKLMMRIGIFGLLYS
VPAAVVIGCHLYEVKNREFWEKSNNCYCNRNIKSQENFSKPEYSVFMLKY
FMCLVVGITSGFWIWTSKTLDSWHNAFRRLSQSICGQSDKHTKQFPGNEQ
ETPLCQINSNQITNGKPIEQCLVNQTALINPATHTGNLYTQHPMDSNALT
HHIAGNVQHHLFVHKANSDLASVSRV*
back to top
Aliases
The feature 'Frizzled 5/8 protein' has the following synonyms
Synonym
fzdP-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR036790Frizzled_dom_sf
IPR015526Frizzled/SFRP
IPR000539Frizzled/Smoothened_TM
IPR020067Frizzled_dom
IPR017981GPCR_2-like
Vocabulary: biological process
TermDefinition
GO:0007166cell surface receptor signaling pathway
GO:0007275multicellular organism development
GO:0016055Wnt signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004888transmembrane signaling receptor activity
GO:0042813Wnt-activated receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000539Frizzled/Smoothened, transmembrane domainPRINTSPR00489FRIZZLEDcoord: 308..332
score: 64.8
coord: 438..459
score: 56.18
coord: 495..515
score: 60.95
coord: 259..281
score: 57.22
coord: 396..418
score: 47.13
coord: 351..374
score: 40.5
coord: 231..253
score: 47.83
IPR000539Frizzled/Smoothened, transmembrane domainSMARTSM01330Frizzled_2coord: 218..533
e-value: 4.1E-173
score: 591.1
IPR000539Frizzled/Smoothened, transmembrane domainPFAMPF01534Frizzledcoord: 222..529
e-value: 2.7E-127
score: 424.3
IPR020067Frizzled domainSMARTSM00063FRI_4coord: 58..173
e-value: 1.2E-59
score: 214.2
IPR020067Frizzled domainPFAMPF01392Fzcoord: 59..166
e-value: 2.3E-34
score: 118.3
IPR020067Frizzled domainPROSITEPS50038FZcoord: 54..171
score: 26.739
IPR036790Frizzled cysteine-rich domain superfamilyGENE3DG3DSA:1.10.2000.10coord: 54..178
e-value: 9.7E-43
score: 147.4
IPR036790Frizzled cysteine-rich domain superfamilySUPERFAMILYSSF63501Frizzled cysteine-rich domaincoord: 57..165
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 185..533
e-value: 3.8E-131
score: 439.1
NoneNo IPR availablePANTHERPTHR11309:SF136FRIZZLED-5coord: 172..542
NoneNo IPR availablePANTHERPTHR11309:SF136FRIZZLED-5coord: 45..165
NoneNo IPR availableCDDcd150357tmF_FZD5_FZD8-likecoord: 224..528
e-value: 0.0
score: 528.001
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.673
NoneNo IPR availableTMHMMTMhelixcoord: 399..421
NoneNo IPR availableTMHMMTMhelixcoord: 307..329
NoneNo IPR availableTMHMMTMhelixcoord: 442..464
NoneNo IPR availableTMHMMTMhelixcoord: 263..285
NoneNo IPR availableTMHMMTMhelixcoord: 350..372
NoneNo IPR availableTMHMMTMhelixcoord: 493..515
NoneNo IPR availableTMHMMTMhelixcoord: 229..251
IPR015526Frizzled/secreted frizzled-related proteinPANTHERPTHR11309FRIZZLEDcoord: 45..165
IPR015526Frizzled/secreted frizzled-related proteinPANTHERPTHR11309FRIZZLEDcoord: 172..542
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 226..522
score: 33.86