Dystrophin

Overview
NameDystrophin
Smed IDSMED30016950
Length (bp)13071
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dystrophin (SMED30016950) t-SNE clustered cells

Violin plots show distribution of expression levels for Dystrophin (SMED30016950) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dystrophin (SMED30016950) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dystrophin (SMED30016950) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016950

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30016950SMESG000020523.1 dd_Smed_v4_5325_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30016950SMESG000020523.1 dd_Smed_v4_5325_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30016950SMESG000020523.1 dd_Smed_v4_5325_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016950SMESG000020523.1 dd_Smed_v4_5325_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30016950SMESG000020523.1 dd_Smed_v4_5325_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016950SMESG000020523.1 dd_Smed_v4_5325_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30016950SMESG000020523.1 dd_Smed_v4_5325_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30016950SMESG000020523.1 dd_Smed_v4_5325_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016950SMESG000020523.1 dd_Smed_v4_5325_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dystrophin vs. Ensembl Human
Match: DMD (dystrophin [Source:HGNC Symbol;Acc:HGNC:2928])

HSP 1 Score: 278.485 bits (711), Expect = 3.699e-79
Identity = 135/320 (42.19%), Postives = 196/320 (61.25%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKS 11166
            +NV +CVD+ LNWLLNVYD+ R G+IRVLS KT I+ L  A L++KY+YLF  V ++ G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               I A+                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++  P +S   P++  ++   HSR+E YA+RLAE+E  N S
Sbjct:  101 VNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PEIEAAL----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMET--PASS---PQL--SHDDTHSRIEHYASRLAEMENSNGS 372          

HSP 2 Score: 86.2705 bits (212), Expect = 7.961e-16
Identity = 43/94 (45.74%), Postives = 58/94 (61.70%), Query Frame = 1
Query: 9616 KNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQK 9897
            K H TQ T WDHP M +L +S  +LN++RFSAYRTAMKLR LQK LCLD + ++   D       H    N++ +D+ QII  L ++Y    Q+
Sbjct:    6 KGHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDAL---DQHNLKQNDQPMDILQIINCLTTIYDRLEQE 96          

HSP 3 Score: 72.7886 bits (177), Expect = 1.344e-11
Identity = 49/142 (34.51%), Postives = 72/142 (50.70%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +++  LE + R L AEY+RL+ Q    + +  +SP+ S                           PP         ++P SP +         P   +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct:  425 LERILADLEEENRNLQAEYDRLKQQ----HEHKGLSPLPS---------------------------PP--------EMMPTSPQS---------PRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 518          
BLAST of Dystrophin vs. Ensembl Human
Match: DMD (dystrophin [Source:HGNC Symbol;Acc:HGNC:2928])

HSP 1 Score: 277.33 bits (708), Expect = 6.913e-79
Identity = 134/328 (40.85%), Postives = 197/328 (60.06%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIP--------TASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKS 11166
            +NV +CVD+ LNWLLNVYD+ R G+IRVLS KT I+ L  A L++KY+YLF  V ++ G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               I A+                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++ +         +A   +P++  ++   HSR+E YA+RLAE+E  N S
Sbjct:  101 VNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PEIEAAL----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQL--SHDDTHSRIEHYASRLAEMENSNGS 385          

HSP 2 Score: 86.6557 bits (213), Expect = 6.795e-16
Identity = 43/94 (45.74%), Postives = 58/94 (61.70%), Query Frame = 1
Query: 9616 KNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQK 9897
            K H TQ T WDHP M +L +S  +LN++RFSAYRTAMKLR LQK LCLD + ++   D       H    N++ +D+ QII  L ++Y    Q+
Sbjct:    6 KGHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDAL---DQHNLKQNDQPMDILQIINCLTTIYDRLEQE 96          

HSP 3 Score: 72.4034 bits (176), Expect = 1.465e-11
Identity = 49/142 (34.51%), Postives = 72/142 (50.70%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +++  LE + R L AEY+RL+ Q    + +  +SP+ S                           PP         ++P SP +         P   +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct:  438 LERILADLEEENRNLQAEYDRLKQQ----HEHKGLSPLPS---------------------------PP--------EMMPTSPQS---------PRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 531          
BLAST of Dystrophin vs. Ensembl Human
Match: DMD (dystrophin [Source:HGNC Symbol;Acc:HGNC:2928])

HSP 1 Score: 277.33 bits (708), Expect = 1.022e-78
Identity = 134/328 (40.85%), Postives = 197/328 (60.06%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIP--------TASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKS 11166
            +NV +CVD+ LNWLLNVYD+ R G+IRVLS KT I+ L  A L++KY+YLF  V ++ G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               I A+                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++ +         +A   +P++  ++   HSR+E YA+RLAE+E  N S
Sbjct:  101 VNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PEIEAAL----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQL--SHDDTHSRIEHYASRLAEMENSNGS 385          

HSP 2 Score: 86.2705 bits (212), Expect = 9.175e-16
Identity = 43/94 (45.74%), Postives = 58/94 (61.70%), Query Frame = 1
Query: 9616 KNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQK 9897
            K H TQ T WDHP M +L +S  +LN++RFSAYRTAMKLR LQK LCLD + ++   D       H    N++ +D+ QII  L ++Y    Q+
Sbjct:    6 KGHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDAL---DQHNLKQNDQPMDILQIINCLTTIYDRLEQE 96          

HSP 3 Score: 72.4034 bits (176), Expect = 1.407e-11
Identity = 49/142 (34.51%), Postives = 72/142 (50.70%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +++  LE + R L AEY+RL+ Q    + +  +SP+ S                           PP         ++P SP +         P   +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct:  438 LERILADLEEENRNLQAEYDRLKQQ----HEHKGLSPLPS---------------------------PP--------EMMPTSPQS---------PRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 531          
BLAST of Dystrophin vs. Ensembl Human
Match: DMD (dystrophin [Source:HGNC Symbol;Acc:HGNC:2928])

HSP 1 Score: 278.485 bits (711), Expect = 2.438e-76
Identity = 134/330 (40.61%), Postives = 198/330 (60.00%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIP--------TASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNI 11172
            +NV +CVD+ LNWLLNVYD+ R G+IRVLS KT I+ L  A L++KY+YLF  V ++ G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               I A+                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++ +         +A   +P++  ++   HSR+E YA+RLAE+E  N S +
Sbjct:  440 VNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PEIEAAL----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQL--SHDDTHSRIEHYASRLAEMENSNGSYL 726          

HSP 2 Score: 118.242 bits (295), Expect = 1.845e-25
Identity = 82/290 (28.28%), Postives = 134/290 (46.21%), Query Frame = 1
Query: 9028 KWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQK 9897
            +W +LNL   D+     +    L+ +     E +  L + E    +W  V ++ +  +   + + K+L   + PL E ++ +     QL  + + ++       E + +R   ++   E R++QLH+                    H      S+             F+   + SV  PWER + P+  +VPYY NH TQ T WDHP M +L +S  +LN++RFSAYRTAMKLR LQK LCLD + ++   D       H    N++ +D+ QII  L ++Y    Q+
Sbjct:  185 EWEKLNLHSADWQRKIDETLERLRELQEATDELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLARQLTTLGIQLSPYNLSTLEDLNTRWKLLQVAVEDRVRQLHEA-------------------HRDFGPASQH------------FL---STSVQGPWERAISPN--KVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDAL---DQHNLKQNDQPMDILQIINCLTTIYDRLEQE 435          

HSP 3 Score: 72.4034 bits (176), Expect = 1.896e-11
Identity = 49/142 (34.51%), Postives = 72/142 (50.70%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +++  LE + R L AEY+RL+ Q    + +  +SP+ S                           PP         ++P SP +         P   +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct:  777 LERILADLEEENRNLQAEYDRLKQQ----HEHKGLSPLPS---------------------------PP--------EMMPTSPQS---------PRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 870          
BLAST of Dystrophin vs. Ensembl Human
Match: DMD (dystrophin [Source:HGNC Symbol;Acc:HGNC:2928])

HSP 1 Score: 280.411 bits (716), Expect = 1.472e-75
Identity = 135/320 (42.19%), Postives = 196/320 (61.25%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKS 11166
            +NV +CVD+ LNWLLNVYD+ R G+IRVLS KT I+ L  A L++KY+YLF  V ++ G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               I A+                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++  P +S   P++  ++   HSR+E YA+RLAE+E  N S
Sbjct:  709 VNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PEIEAAL----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMET--PASS---PQL--SHDDTHSRIEHYASRLAEMENSNGS 980          

HSP 2 Score: 117.087 bits (292), Expect = 5.262e-25
Identity = 82/290 (28.28%), Postives = 134/290 (46.21%), Query Frame = 1
Query: 9028 KWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQK 9897
            +W +LNL   D+     +    L+ +     E +  L + E    +W  V ++ +  +   + + K+L   + PL E ++ +     QL  + + ++       E + +R   ++   E R++QLH+                    H      S+             F+   + SV  PWER + P+  +VPYY NH TQ T WDHP M +L +S  +LN++RFSAYRTAMKLR LQK LCLD + ++   D       H    N++ +D+ QII  L ++Y    Q+
Sbjct:  454 EWEKLNLHSADWQRKIDETLERLRELQEATDELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVSHVNDLARQLTTLGIQLSPYNLSTLEDLNTRWKLLQVAVEDRVRQLHEA-------------------HRDFGPASQH------------FL---STSVQGPWERAISPN--KVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDAL---DQHNLKQNDQPMDILQIINCLTTIYDRLEQE 704          

HSP 3 Score: 72.7886 bits (177), Expect = 1.561e-11
Identity = 49/142 (34.51%), Postives = 72/142 (50.70%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +++  LE + R L AEY+RL+ Q    + +  +SP+ S                           PP         ++P SP +         P   +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct: 1033 LERILADLEEENRNLQAEYDRLKQQ----HEHKGLSPLPS---------------------------PP--------EMMPTSPQS---------PRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 1126          
BLAST of Dystrophin vs. Ensembl Celegans
Match: dys-1 (Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW65])

HSP 1 Score: 227.639 bits (579), Expect = 1.277e-58
Identity = 106/269 (39.41%), Postives = 164/269 (60.97%), Query Frame = 1
Query: 10210 NVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPV 11016
            +V++ VD+ +N+LLN++D +R+G +RVLS K A+++ +N  L+EKY+YLF LV  + G     ++  +L D + IP+ + ES++FG  NV+PSV SCF+ V                 R+  +                        I    F+ W++ EPQS+VWL V++R++ +ES  H +KC VCK+ PI+G+RYRCL C N DLCQ CFF  +T+KSH+ +HPMQEYC  T+S ++ RD++++ RN+FR+    RQ+    YLP+
Sbjct: 2938 SVSLAVDICINFLLNLFDQSRDGIMRVLSFKIAMIVFSNIPLEEKYRYLFKLVSQD-GHATQKQIALLLYDLIHIPRLVGESAAFGGTNVEPSVRSCFETV-----------------RLAPT------------------------ISEGAFIDWVKKEPQSIVWLAVMHRLVISESTKHASKCNVCKMFPIIGIRYRCLTCFNCDLCQNCFFSQRTAKSHRTNHPMQEYCEKTTSSDDARDFAKMIRNKFRASK--RQK---GYLPI 3159          

HSP 2 Score: 99.3673 bits (246), Expect = 7.771e-20
Identity = 42/88 (47.73%), Postives = 61/88 (69.32%), Query Frame = 1
Query: 9550 NESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTF-RLCGV 9810
            N+SV+ PW+R +  S   +PYY   +++ TQW+HP+  +++K   + N ++F AYRTAMKLRALQK LCLD VD+ L+   F RL G+
Sbjct: 2820 NQSVTLPWQRAISKSNL-LPYYIEQTSEKTQWEHPVWVEIVKELSQFNRVKFLAYRTAMKLRALQKRLCLDLVDLTLLEKAFVRLKGL 2906          
BLAST of Dystrophin vs. Ensembl Celegans
Match: dys-1 (Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW65])

HSP 1 Score: 227.639 bits (579), Expect = 1.286e-58
Identity = 106/269 (39.41%), Postives = 164/269 (60.97%), Query Frame = 1
Query: 10210 NVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPV 11016
            +V++ VD+ +N+LLN++D +R+G +RVLS K A+++ +N  L+EKY+YLF LV  + G     ++  +L D + IP+ + ES++FG  NV+PSV SCF+ V                 R+  +                        I    F+ W++ EPQS+VWL V++R++ +ES  H +KC VCK+ PI+G+RYRCL C N DLCQ CFF  +T+KSH+ +HPMQEYC  T+S ++ RD++++ RN+FR+    RQ+    YLP+
Sbjct: 2927 SVSLAVDICINFLLNLFDQSRDGIMRVLSFKIAMIVFSNIPLEEKYRYLFKLVSQD-GHATQKQIALLLYDLIHIPRLVGESAAFGGTNVEPSVRSCFETV-----------------RLAPT------------------------ISEGAFIDWVKKEPQSIVWLAVMHRLVISESTKHASKCNVCKMFPIIGIRYRCLTCFNCDLCQNCFFSQRTAKSHRTNHPMQEYCEKTTSSDDARDFAKMIRNKFRASK--RQK---GYLPI 3148          

HSP 2 Score: 99.3673 bits (246), Expect = 7.898e-20
Identity = 42/88 (47.73%), Postives = 61/88 (69.32%), Query Frame = 1
Query: 9550 NESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTF-RLCGV 9810
            N+SV+ PW+R +  S   +PYY   +++ TQW+HP+  +++K   + N ++F AYRTAMKLRALQK LCLD VD+ L+   F RL G+
Sbjct: 2809 NQSVTLPWQRAISKSNL-LPYYIEQTSEKTQWEHPVWVEIVKELSQFNRVKFLAYRTAMKLRALQKRLCLDLVDLTLLEKAFVRLKGL 2895          
BLAST of Dystrophin vs. Ensembl Celegans
Match: dys-1 (Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW65])

HSP 1 Score: 226.868 bits (577), Expect = 2.009e-58
Identity = 106/269 (39.41%), Postives = 164/269 (60.97%), Query Frame = 1
Query: 10210 NVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPV 11016
            +V++ VD+ +N+LLN++D +R+G +RVLS K A+++ +N  L+EKY+YLF LV  + G     ++  +L D + IP+ + ES++FG  NV+PSV SCF+ V                 R+  +                        I    F+ W++ EPQS+VWL V++R++ +ES  H +KC VCK+ PI+G+RYRCL C N DLCQ CFF  +T+KSH+ +HPMQEYC  T+S ++ RD++++ RN+FR+    RQ+    YLP+
Sbjct: 3153 SVSLAVDICINFLLNLFDQSRDGIMRVLSFKIAMIVFSNIPLEEKYRYLFKLVSQD-GHATQKQIALLLYDLIHIPRLVGESAAFGGTNVEPSVRSCFETV-----------------RLAPT------------------------ISEGAFIDWVKKEPQSIVWLAVMHRLVISESTKHASKCNVCKMFPIIGIRYRCLTCFNCDLCQNCFFSQRTAKSHRTNHPMQEYCEKTTSSDDARDFAKMIRNKFRASK--RQK---GYLPI 3374          

HSP 2 Score: 98.9821 bits (245), Expect = 9.744e-20
Identity = 42/88 (47.73%), Postives = 61/88 (69.32%), Query Frame = 1
Query: 9550 NESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTF-RLCGV 9810
            N+SV+ PW+R +  S   +PYY   +++ TQW+HP+  +++K   + N ++F AYRTAMKLRALQK LCLD VD+ L+   F RL G+
Sbjct: 3035 NQSVTLPWQRAISKSNL-LPYYIEQTSEKTQWEHPVWVEIVKELSQFNRVKFLAYRTAMKLRALQKRLCLDLVDLTLLEKAFVRLKGL 3121          

HSP 3 Score: 58.151 bits (139), Expect = 2.041e-7
Identity = 57/232 (24.57%), Postives = 98/232 (42.24%), Query Frame = 1
Query:  157 QQLVFAKWFNNKLKKLYQPSIESLINGFRSGRRFYSI---TNMICQNENLEIPEQLTDQQLISTGIENILAKF--STTLPQSLQDKIEELLNGDEKIILSLAWWMITEYFAKQRS---LSVNAIHSDTLFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVMELRERLSGTSQ 828
            Q+ VF +W N+ L        +SL +G  +   + +I   T  +  N + + P              N+L     S T PQ       E++ G +K +LS AWW + ++F K  +   L    +      WC ++ K Y  + V +FT+S+RDG A   ++H Y   L         ++   +     +A + +   RLL   +  S   LD  S+  ++M L   +  TS+
Sbjct:   30 QEWVFVRWANHLLGTERLTDYKSLQDGSNAIFVYQAIIGQTMAVLGNPSDDWP--------------NVLQNIGDSKTNPQ-------EVMEGQQKAVLS-AWWQLVQFFWKNNAPVQLREEKLSEAIKQWCIEVMKSYEEIDVYDFTSSFRDGHAFNYLIHSYDRKLINLTKTAEMSAIDRIENAFAVAEKTWNVPRLLNPKDLHSDQ-LDSHSVLCYLMSLYLAMISTSK 238          
BLAST of Dystrophin vs. Ensembl Celegans
Match: dys-1 (Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW65])

HSP 1 Score: 226.868 bits (577), Expect = 2.116e-58
Identity = 106/269 (39.41%), Postives = 164/269 (60.97%), Query Frame = 1
Query: 10210 NVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPV 11016
            +V++ VD+ +N+LLN++D +R+G +RVLS K A+++ +N  L+EKY+YLF LV  + G     ++  +L D + IP+ + ES++FG  NV+PSV SCF+ V                 R+  +                        I    F+ W++ EPQS+VWL V++R++ +ES  H +KC VCK+ PI+G+RYRCL C N DLCQ CFF  +T+KSH+ +HPMQEYC  T+S ++ RD++++ RN+FR+    RQ+    YLP+
Sbjct: 3164 SVSLAVDICINFLLNLFDQSRDGIMRVLSFKIAMIVFSNIPLEEKYRYLFKLVSQD-GHATQKQIALLLYDLIHIPRLVGESAAFGGTNVEPSVRSCFETV-----------------RLAPT------------------------ISEGAFIDWVKKEPQSIVWLAVMHRLVISESTKHASKCNVCKMFPIIGIRYRCLTCFNCDLCQNCFFSQRTAKSHRTNHPMQEYCEKTTSSDDARDFAKMIRNKFRASK--RQK---GYLPI 3385          

HSP 2 Score: 98.9821 bits (245), Expect = 1.008e-19
Identity = 42/88 (47.73%), Postives = 61/88 (69.32%), Query Frame = 1
Query: 9550 NESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTF-RLCGV 9810
            N+SV+ PW+R +  S   +PYY   +++ TQW+HP+  +++K   + N ++F AYRTAMKLRALQK LCLD VD+ L+   F RL G+
Sbjct: 3046 NQSVTLPWQRAISKSNL-LPYYIEQTSEKTQWEHPVWVEIVKELSQFNRVKFLAYRTAMKLRALQKRLCLDLVDLTLLEKAFVRLKGL 3132          

HSP 3 Score: 58.151 bits (139), Expect = 2.094e-7
Identity = 57/232 (24.57%), Postives = 98/232 (42.24%), Query Frame = 1
Query:  157 QQLVFAKWFNNKLKKLYQPSIESLINGFRSGRRFYSI---TNMICQNENLEIPEQLTDQQLISTGIENILAKF--STTLPQSLQDKIEELLNGDEKIILSLAWWMITEYFAKQRS---LSVNAIHSDTLFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVMELRERLSGTSQ 828
            Q+ VF +W N+ L        +SL +G  +   + +I   T  +  N + + P              N+L     S T PQ       E++ G +K +LS AWW + ++F K  +   L    +      WC ++ K Y  + V +FT+S+RDG A   ++H Y   L         ++   +     +A + +   RLL   +  S   LD  S+  ++M L   +  TS+
Sbjct:   30 QEWVFVRWANHLLGTERLTDYKSLQDGSNAIFVYQAIIGQTMAVLGNPSDDWP--------------NVLQNIGDSKTNPQ-------EVMEGQQKAVLS-AWWQLVQFFWKNNAPVQLREEKLSEAIKQWCIEVMKSYEEIDVYDFTSSFRDGHAFNYLIHSYDRKLINLTKTAEMSAIDRIENAFAVAEKTWNVPRLLNPKDLHSDQ-LDSHSVLCYLMSLYLAMISTSK 238          
BLAST of Dystrophin vs. Ensembl Celegans
Match: dys-1 (Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW65])

HSP 1 Score: 226.483 bits (576), Expect = 2.193e-58
Identity = 106/269 (39.41%), Postives = 164/269 (60.97%), Query Frame = 1
Query: 10210 NVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPV 11016
            +V++ VD+ +N+LLN++D +R+G +RVLS K A+++ +N  L+EKY+YLF LV  + G     ++  +L D + IP+ + ES++FG  NV+PSV SCF+ V                 R+  +                        I    F+ W++ EPQS+VWL V++R++ +ES  H +KC VCK+ PI+G+RYRCL C N DLCQ CFF  +T+KSH+ +HPMQEYC  T+S ++ RD++++ RN+FR+    RQ+    YLP+
Sbjct: 2005 SVSLAVDICINFLLNLFDQSRDGIMRVLSFKIAMIVFSNIPLEEKYRYLFKLVSQD-GHATQKQIALLLYDLIHIPRLVGESAAFGGTNVEPSVRSCFETV-----------------RLAPT------------------------ISEGAFIDWVKKEPQSIVWLAVMHRLVISESTKHASKCNVCKMFPIIGIRYRCLTCFNCDLCQNCFFSQRTAKSHRTNHPMQEYCEKTTSSDDARDFAKMIRNKFRASK--RQK---GYLPI 2226          

HSP 2 Score: 98.5969 bits (244), Expect = 1.156e-19
Identity = 68/241 (28.22%), Postives = 126/241 (52.28%), Query Frame = 1
Query: 9139 SELEFHIDNWSNV---ANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRIS----YIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSEN---------RKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTF-RLCGV 9810
            +EL   +++W  +   A  +L  + + +++ +  + S +  +E + A+E  K  L+++K+       +E+++I+ RI     ++  + +   + L   E L L + +     QI   ++   ++ R I +      N           F+   N+SV+ PW+R +  S   +PYY   +++ TQW+HP+  +++K   + N ++F AYRTAMKLRALQK LCLD VD+ L+   F RL G+
Sbjct: 1749 AELGIEVESWDKLVQHAMQRLQELERNLAECQLHLTSSENEIETMKAVE--KIHLEDLKIA-----REETDQISKRIDEVRLFVDDVNDAAARLL--AEDLKLDEHAKG---QIEHVNKRYSTLKRAIRIRQAAVRNAASDFGPTSEHFL---NQSVTLPWQRAISKSNL-LPYYIEQTSEKTQWEHPVWVEIVKELSQFNRVKFLAYRTAMKLRALQKRLCLDLVDLTLLEKAFVRLKGL 1973          
BLAST of Dystrophin vs. Ensembl Fly
Match: Dys (gene:FBgn0260003 transcript:FBtr0110916)

HSP 1 Score: 287.345 bits (734), Expect = 6.204e-79
Identity = 138/335 (41.19%), Postives = 207/335 (61.79%), Query Frame = 1
Query: 10156 MANIPSTRTLLSTGEY---EINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVE 11151
            + +IP   T+L +      +I++ + +DLA+NW+LNVYDS R G+IRVLS K  +V+L    L+EKY+YLF LV +   + D  RL  +L DC+ +P+ L E ++FG  N++PSV SC +       +++ D      Q I                           I L +FL WL+ EPQSLVWLPVL+R+ +AE+A HQAKC +CK  PIVG RYRCL+C NFD+CQ CFF+ + +K+HK++HPM EYC  T+S E+ RD++R  +N+F+S+ + ++  ++ YLPVQ+    D ++S  P+      ++    + +HSR+E YA+RLA+VE
Sbjct:  493 LIDIPDMTTVLHSLYVTIDKIDLTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQAG--ISQEAIDGN----QDIS--------------------------IELQHFLGWLQHEPQSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDVRDFTRALKNKFKSRKYFKKHPRVGYLPVQSVLEGDALESPAPSPQHTTHQL---QNDMHSRLEMYASRLAQVE 792          

HSP 2 Score: 103.605 bits (257), Expect = 3.273e-21
Identity = 50/110 (45.45%), Postives = 70/110 (63.64%), Query Frame = 1
Query: 9550 NESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
             +SV  PWER    + + VPYY +H  + T WDHP M +L+K   +LN IRFSAYRTAMKLR++QK L LD + M+   ++F   G+   A N++L+D+  +   L SLY
Sbjct:  402 GQSVKPPWERAT--TAANVPYYIDHERETTHWDHPEMIELMKGLADLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLR--AQNDKLIDIPDMTTVLHSLY 507          

HSP 3 Score: 74.3294 bits (181), Expect = 2.882e-12
Identity = 33/45 (73.33%), Postives = 40/45 (88.89%), Query Frame = 1
Query: 11863 SEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
             +D++ EA++LRQHKGRLEARM +LE HNRQLEAQL RLRQL+DE
Sbjct:  898 GQDMMAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLLDE 942          
BLAST of Dystrophin vs. Ensembl Fly
Match: Dys (gene:FBgn0260003 transcript:FBtr0334563)

HSP 1 Score: 288.5 bits (737), Expect = 8.940e-79
Identity = 138/335 (41.19%), Postives = 207/335 (61.79%), Query Frame = 1
Query: 10156 MANIPSTRTLLSTGEY---EINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVE 11151
            + +IP   T+L +      +I++ + +DLA+NW+LNVYDS R G+IRVLS K  +V+L    L+EKY+YLF LV +   + D  RL  +L DC+ +P+ L E ++FG  N++PSV SC +       +++ D      Q I                           I L +FL WL+ EPQSLVWLPVL+R+ +AE+A HQAKC +CK  PIVG RYRCL+C NFD+CQ CFF+ + +K+HK++HPM EYC  T+S E+ RD++R  +N+F+S+ + ++  ++ YLPVQ+    D ++S  P+      ++    + +HSR+E YA+RLA+VE
Sbjct:  493 LIDIPDMTTVLHSLYVTIDKIDLTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQAG--ISQEAIDGN----QDIS--------------------------IELQHFLGWLQHEPQSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDVRDFTRALKNKFKSRKYFKKHPRVGYLPVQSVLEGDALESPAPSPQHTTHQL---QNDMHSRLEMYASRLAQVE 792          

HSP 2 Score: 103.99 bits (258), Expect = 2.879e-21
Identity = 50/110 (45.45%), Postives = 70/110 (63.64%), Query Frame = 1
Query: 9550 NESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
             +SV  PWER    + + VPYY +H  + T WDHP M +L+K   +LN IRFSAYRTAMKLR++QK L LD + M+   ++F   G+   A N++L+D+  +   L SLY
Sbjct:  402 GQSVKPPWERAT--TAANVPYYIDHERETTHWDHPEMIELMKGLADLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLR--AQNDKLIDIPDMTTVLHSLY 507          

HSP 3 Score: 74.3294 bits (181), Expect = 2.965e-12
Identity = 33/45 (73.33%), Postives = 40/45 (88.89%), Query Frame = 1
Query: 11863 SEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
             +D++ EA++LRQHKGRLEARM +LE HNRQLEAQL RLRQL+DE
Sbjct:  898 GQDMMAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLLDE 942          
BLAST of Dystrophin vs. Ensembl Fly
Match: Dys (gene:FBgn0260003 transcript:FBtr0334565)

HSP 1 Score: 289.656 bits (740), Expect = 1.729e-78
Identity = 137/336 (40.77%), Postives = 208/336 (61.90%), Query Frame = 1
Query: 10156 MANIPSTRTLLSTGEY---EINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFD-KKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVE 11151
            + +IP   T+L +      +I++ + +DLA+NW+LNVYDS R G+IRVLS K  +V+L    L+EKY+YLF LV +   + D  RL  +L DC+ +P+ L E ++FG  N++PSV SC +       +++ D  +D +                               I L +FL WL+ EPQSLVWLPVL+R+ +AE+A HQAKC +CK  PIVG RYRCL+C NFD+CQ CFF+ + +K+HK++HPM EYC  T+S E+ RD++R  +N+F+S+ + ++  ++ YLPVQ+    D ++S  P+      ++    + +HSR+E YA+RLA+VE
Sbjct:  765 LIDIPDMTTVLHSLYVTIDKIDLTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQAG--ISQEAIDGNQDIS-------------------------------IELQHFLGWLQHEPQSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDVRDFTRALKNKFKSRKYFKKHPRVGYLPVQSVLEGDALESPAPSPQHTTHQL---QNDMHSRLEMYASRLAQVE 1064          

HSP 2 Score: 104.375 bits (259), Expect = 2.387e-21
Identity = 50/110 (45.45%), Postives = 70/110 (63.64%), Query Frame = 1
Query: 9550 NESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
             +SV  PWER    + + VPYY +H  + T WDHP M +L+K   +LN IRFSAYRTAMKLR++QK L LD + M+   ++F   G+   A N++L+D+  +   L SLY
Sbjct:  674 GQSVKPPWERA--TTAANVPYYIDHERETTHWDHPEMIELMKGLADLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLR--AQNDKLIDIPDMTTVLHSLY 779          

HSP 3 Score: 73.9442 bits (180), Expect = 4.071e-12
Identity = 33/45 (73.33%), Postives = 40/45 (88.89%), Query Frame = 1
Query: 11863 SEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
             +D++ EA++LRQHKGRLEARM +LE HNRQLEAQL RLRQL+DE
Sbjct: 1170 GQDMMAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLLDE 1214          
BLAST of Dystrophin vs. Ensembl Fly
Match: Dys (gene:FBgn0260003 transcript:FBtr0334562)

HSP 1 Score: 290.812 bits (743), Expect = 1.008e-77
Identity = 137/336 (40.77%), Postives = 208/336 (61.90%), Query Frame = 1
Query: 10156 MANIPSTRTLLSTGEY---EINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFD-KKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVE 11151
            + +IP   T+L +      +I++ + +DLA+NW+LNVYDS R G+IRVLS K  +V+L    L+EKY+YLF LV +   + D  RL  +L DC+ +P+ L E ++FG  N++PSV SC +       +++ D  +D +                               I L +FL WL+ EPQSLVWLPVL+R+ +AE+A HQAKC +CK  PIVG RYRCL+C NFD+CQ CFF+ + +K+HK++HPM EYC  T+S E+ RD++R  +N+F+S+ + ++  ++ YLPVQ+    D ++S  P+      ++    + +HSR+E YA+RLA+VE
Sbjct: 2618 LIDIPDMTTVLHSLYVTIDKIDLTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQAG--ISQEAIDGNQDIS-------------------------------IELQHFLGWLQHEPQSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDVRDFTRALKNKFKSRKYFKKHPRVGYLPVQSVLEGDALESPAPSPQHTTHQL---QNDMHSRLEMYASRLAQVE 2917          

HSP 2 Score: 104.375 bits (259), Expect = 2.796e-21
Identity = 50/110 (45.45%), Postives = 70/110 (63.64%), Query Frame = 1
Query: 9550 NESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
             +SV  PWER    + + VPYY +H  + T WDHP M +L+K   +LN IRFSAYRTAMKLR++QK L LD + M+   ++F   G+   A N++L+D+  +   L SLY
Sbjct: 2527 GQSVKPPWERA--TTAANVPYYIDHERETTHWDHPEMIELMKGLADLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLR--AQNDKLIDIPDMTTVLHSLY 2632          

HSP 3 Score: 77.7962 bits (190), Expect = 2.766e-13
Identity = 121/638 (18.97%), Postives = 266/638 (41.69%), Query Frame = 1
Query:  142 ENENTQQLVFAKWFNNKLKKLYQPSIESLINGFRSGRRFYSITNMICQNENLEIPEQLTDQQLISTGIENILAKFSTTLPQSLQDKIEELLNGDEKIILSLAWWMITEYFAKQ--RSLSVNAIHSDTLFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVMELRERLSGTSQNDSQSCANEQMKITDSQIANPSFESL--ISNFNLDFSTIIQTLDTFFQHLEIAETRVKVHE-----TFKDAKEVLEAFKSEDDLFVQLKIIKESVV------------------EHEALMEKLTKHQDSIQSILMKGNAILEITSLDNTPQLKTNINNKRE---IITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEETRKNQKNFGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYXXXXXXXXXXXXXQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEERICTADQLLRKSNKNQFNDFVNYTESKWGRMISSLDKCGQKIKDLCENESLVVSTVDNKIDEMIQNWNDASEK 1965
            E ++ Q+  F KW N+ L       ++ L    R G R  ++ + + Q  NL+ PE+   +      +  ++ +      + +    ++++ G+ K+ L L W +  E+  +   +S S N +    L W +Q  + + G+ + +F++SW DG A L IL  +   L   ++ L +++ + L L   LA++ F   +LL+ ++  +    D KSI ++VM L   +        +   +E       ++   S   L  +   N   S  + T D+     + +   +K H      T  +A   +  ++S  +  + L +  E ++                  E+E+ M KLT+HQ+ +   L +G+ ++  +        + + N  R+   ++  +W  L   + + Q K+   L + Q   L ++   +  +E+   +  + G +++  + QL + + ++  +   ++ + +L + ++                     +   S + +D   E  ++++G +W+ +V W + R   LQ           + + IS WL+ R    +Q L+        D    T+      I+ L+ C    KDL E +  ++  +   +   +Q+ +D  E+
Sbjct:   41 ERQHIQKKTFTKWINSHLIDTQCTPVKDLFLDLRDGHRLLALLSTLTQT-NLK-PEKGRMRVHHINNLNKVITEIQQHGVKLVNISSDDIVGGNAKLTLGLIWLIALEFNGQHLVKSHSSNGVEKSLLAWARQYTEPH-GLQLNDFSSSWSDGRAFLMILDAHVEEL-NLQAALQQHALKRLHLAFDLAHRHFKIEKLLDAEDVHTHKP-DNKSIQMYVMCLYHAMESMRTRQQEQEQDEGQDQDPGRVPCTSITDLDEVPLDNDQTSLGLYTSDSAGSMEQRSSGELKTHSMRPLSTATNASVEISGYQSALEAVLTLLLEDEQLLSQNLPDPQDFQTAKLQFHENESFMLKLTEHQEYVGEALEEGSNLINESQKAGAGLSQEDQNEVRQQMVLLNERWETLRLRALDVQAKILMRLAEFQKQKLEQLRQFLTSVEDRISHMSDIGPTLEEAEKQLLEAQKLKADLSEQQELVDSLSSMVVI--------------------VNDTSGNFND--LEDRLSALGERWSHVVKWSDLRKEKLQ-----------QYKCISRWLDAR----EQDLKLMESRDVTDVGGITQR-----INELNYCA---KDLLELQRYLID-LRQMVAATLQDGDDKGER 627          

HSP 4 Score: 73.9442 bits (180), Expect = 4.504e-12
Identity = 33/45 (73.33%), Postives = 40/45 (88.89%), Query Frame = 1
Query: 11863 SEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
             +D++ EA++LRQHKGRLEARM +LE HNRQLEAQL RLRQL+DE
Sbjct: 3023 GQDMMAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLLDE 3067          

HSP 5 Score: 64.6994 bits (156), Expect = 2.714e-9
Identity = 80/377 (21.22%), Postives = 174/377 (46.15%), Query Frame = 1
Query: 3730 GQLVIEM-----QNQKLGYIEKLKQYISTDIFLEVNEKFENFCQFLENENQRFKDSDYHLKDVKNILSGEDKWMGKVDRVMQQSFSCDHLDVEELSENIDEIEKVVCDHSEEDFNRLEDLKYSLTNARILERSVSMEIEQIKEKSLVMKNKANKRLGSLTQLLEHIQSVERRVCQMTTWIYDTTNLLKARIVADLLGADLPDEFEILKQNFMEWEKFLLEIEDLEKGKMYQGKKETSEXXXXXXXXXXXSFRPLKELFSRYSR-PADFEPRLDNLKREVNRVAEHIYXXXXXXXXXXXXXNCETHAKQFKETLIASESDLNYVYDLGKEIAERKEIEFPERFSLQLDSLKKRYYNLLDQISEA----EEKLSLARPL 4830
            G+L+++M     Q+++  Y    KQ      F  +N ++    + +  +    +     L + K  +  E  ++ K++  ++ +   +  D EE+ E +D++E V+  HSEE  ++++++   L +   +  S+  +I++  ++   ++ +A KR   L Q +   +  E+ + Q   W+    ++L   +  D+   D P+EF+ L   F+  EK   EI +L       GK   + RL+ Q   ++  F+  +   S+ +     +E RL+    ++  V     ++D+ S     ++       Q   TL   +S++      G+ + E +  + P++ S ++D+LK  Y  L + ++++    E  L+LAR L
Sbjct: 1154 GELLLQMDELQDQDRESRYGSLAKQ------FTRINARWTEVTELVYAKTALLEHISTQLGEFKKFMVSETGYLDKLENKIRNTPE-NAADAEEIMEELDDLENVLRSHSEEWLDKIQEIGNELIDNEFMADSIRRDIDETVQRWTQLQQQAKKRTELLEQKVSEAEQSEKCIVQFEKWLTRVDDILSDHLDNDVTIVDQPEEFQRLAHEFVANEKNFKEISELIDEHTRNGKVGAANRLQEQLNLMEVRFKYCQAKLSKCTAIQHSYESRLNRAYTDLRNVERSTEVVDVASAGPNTVQTQYQKCLQIYRTLSEIKSEIESTIKTGRRVCEDRYTKSPKQLSQRIDALKHLYNTLGENVTQSKATLERLLTLARQL 1523          
BLAST of Dystrophin vs. Ensembl Fly
Match: Dys (gene:FBgn0260003 transcript:FBtr0083766)

HSP 1 Score: 289.271 bits (739), Expect = 1.090e-77
Identity = 137/336 (40.77%), Postives = 208/336 (61.90%), Query Frame = 1
Query: 10156 MANIPSTRTLLSTGEY---EINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFD-KKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVE 11151
            + +IP   T+L +      +I++ + +DLA+NW+LNVYDS R G+IRVLS K  +V+L    L+EKY+YLF LV +   + D  RL  +L DC+ +P+ L E ++FG  N++PSV SC +       +++ D  +D +                               I L +FL WL+ EPQSLVWLPVL+R+ +AE+A HQAKC +CK  PIVG RYRCL+C NFD+CQ CFF+ + +K+HK++HPM EYC  T+S E+ RD++R  +N+F+S+ + ++  ++ YLPVQ+    D ++S  P+      ++    + +HSR+E YA+RLA+VE
Sbjct: 1111 LIDIPDMTTVLHSLYVTIDKIDLTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQAG--ISQEAIDGNQDIS-------------------------------IELQHFLGWLQHEPQSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDVRDFTRALKNKFKSRKYFKKHPRVGYLPVQSVLEGDALESPAPSPQHTTHQL---QNDMHSRLEMYASRLAQVE 1410          

HSP 2 Score: 105.145 bits (261), Expect = 1.436e-21
Identity = 50/110 (45.45%), Postives = 70/110 (63.64%), Query Frame = 1
Query: 9550 NESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
             +SV  PWER    + + VPYY +H  + T WDHP M +L+K   +LN IRFSAYRTAMKLR++QK L LD + M+   ++F   G+   A N++L+D+  +   L SLY
Sbjct: 1020 GQSVKPPWERAT--TAANVPYYIDHERETTHWDHPEMIELMKGLADLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLR--AQNDKLIDIPDMTTVLHSLY 1125          

HSP 3 Score: 73.9442 bits (180), Expect = 3.756e-12
Identity = 33/45 (73.33%), Postives = 40/45 (88.89%), Query Frame = 1
Query: 11863 SEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
             +D++ EA++LRQHKGRLEARM +LE HNRQLEAQL RLRQL+DE
Sbjct: 1516 GQDMMAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLLDE 1560          
BLAST of Dystrophin vs. Ensembl Zebrafish
Match: utrn (utrophin [Source:ZFIN;Acc:ZDB-GENE-070228-6])

HSP 1 Score: 278.1 bits (710), Expect = 4.414e-80
Identity = 145/372 (38.98%), Postives = 212/372 (56.99%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKI------PTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNIIVKSGNVEPKYEPLLLSQDFNGDYKERNKDDEEHKIIFQHTETL 11304
            +NV +CVD++LNWLLNVYD+ R+GKIRVLS+K  ++ L    L+EKYK LF+ V +  G  D  +L  +L D + IP+ L E ++FG  N++PSV SCF++V +K VE                                        +    F+ W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PIVG RYR L+  N+D+CQ+CFF  +T+K HK+++PM EYC  T+S E+ RD++++ +N+FRSK +  +  +L YLPVQ     D +++ +      P   E+ P     +   HSR+ +YANRLA++E+ N S                 L  D +         DEEH +I Q+ +TL
Sbjct:   38 VNVPLCVDMSLNWLLNVYDTGRSGKIRVLSMKIGLLSLCKGHLEEKYKCLFNQVASAGGTCDQRQLGLLLHDAIQIPRQLGEVAAFGGSNIEPSVRSCFQHVTNK-VE----------------------------------------LEPRQFIDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKEFPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLNYPMVEYCTPTTSGEDMRDFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNMETPVTLISMCPEHYELCPSPQLPHDDTHSRIGEYANRLAQMERSNGS-----------------LPTDSSS---ATGSMDEEHALILQYCQTL 348          

HSP 2 Score: 67.3958 bits (163), Expect = 2.668e-10
Identity = 30/43 (69.77%), Postives = 38/43 (88.37%), Query Frame = 1
Query: 11869 DLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            DL+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+ +
Sbjct:  438 DLLAEAKLLRQHKGRLEARMQILEDHNKQLESQLYRLRQLLHQ 480          
BLAST of Dystrophin vs. Ensembl Zebrafish
Match: utrn (utrophin [Source:ZFIN;Acc:ZDB-GENE-070228-6])

HSP 1 Score: 277.33 bits (708), Expect = 5.670e-80
Identity = 144/366 (39.34%), Postives = 212/366 (57.92%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNIIVKSGNVEPKYEPLLLSQDFNGDYKERNKDDEEHKIIFQHTETL 11304
            +NV +CVD++LNWLLNVYD+ R+GKIRVLS+K  ++ L    L+EKYK LF+ V +  G  D  +L  +L D + IP+ L E ++FG  N++PSV SCF++V +K VE                                        +    F+ W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PIVG RYR L+  N+D+CQ+CFF  +T+K HK+++PM EYC  T+S E+ RD++++ +N+FRSK +  +  +L YLPVQ     D +++  P+     P++   +   HSR+ +YANRLA++E+ N S                 L  D +         DEEH +I Q+ +TL
Sbjct:   38 VNVPLCVDMSLNWLLNVYDTGRSGKIRVLSMKIGLLSLCKGHLEEKYKCLFNQVASAGGTCDQRQLGLLLHDAIQIPRQLGEVAAFGGSNIEPSVRSCFQHVTNK-VE----------------------------------------LEPRQFIDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKEFPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLNYPMVEYCTPTTSGEDMRDFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNMETLCPS-----PQL--PHDDTHSRIGEYANRLAQMERSNGS-----------------LPTDSSS---ATGSMDEEHALILQYCQTL 335          

HSP 2 Score: 67.3958 bits (163), Expect = 2.758e-10
Identity = 30/43 (69.77%), Postives = 38/43 (88.37%), Query Frame = 1
Query: 11869 DLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            DL+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+ +
Sbjct:  425 DLLAEAKLLRQHKGRLEARMQILEDHNKQLESQLYRLRQLLHQ 467          
BLAST of Dystrophin vs. Ensembl Zebrafish
Match: dmd (dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1])

HSP 1 Score: 275.404 bits (703), Expect = 1.048e-78
Identity = 137/331 (41.39%), Postives = 199/331 (60.12%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNIIVKSGNVEP 11199
            +NV +CVD+ LNWLLNVYD+ R GKIR LS KT I+ L  A L++KY++LF  V +  G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               + AS                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++  P +S   P++  ++   HSR+E YA+RLAE+E  N S +   + NV P
Sbjct:  101 VNVPLCVDMCLNWLLNVYDTGRAGKIRTLSFKTGIISLCKAHLEDKYRFLFREVASATGFCDQRRLGLLLHDAIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PELEASV----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMQYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTILEGDNMET--PASS---PQL--SHDDTHSRIEHYASRLAEMENRNGSYV---NDNVSP 380          

HSP 2 Score: 93.2041 bits (230), Expect = 3.721e-18
Identity = 45/94 (47.87%), Postives = 60/94 (63.83%), Query Frame = 1
Query: 9616 KNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQK 9897
            +NH TQ T WDHP MA+L +S  +LN++RFSAYRTAMKLR +QK LCLD + M    + F     H    NE+ +D+ Q+I  L S+Y    Q+
Sbjct:    6 RNHQTQTTCWDHPKMAELYQSLADLNNVRFSAYRTAMKLRRMQKALCLDLLSMPAACEAFE---QHNLKQNEQFMDIVQVINCLTSIYDRLEQQ 96          

HSP 3 Score: 74.7146 bits (182), Expect = 1.791e-12
Identity = 49/142 (34.51%), Postives = 75/142 (52.82%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +V++ LE + R+L AEY+RL+      + +  +SP+ S                           PP         ++P+SP +         P   +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL+RLRQL+++
Sbjct:  425 LERVLNDLEQENRKLQAEYDRLK----KAHDHKGLSPLPS---------------------------PP--------QMLPVSPQS---------PRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLTRLRQLLEQ 518          
BLAST of Dystrophin vs. Ensembl Zebrafish
Match: dmd (dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1])

HSP 1 Score: 280.026 bits (715), Expect = 2.960e-74
Identity = 138/341 (40.47%), Postives = 201/341 (58.94%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKI----------PTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNIIVKSGNVEP 11199
            +NV +CVD+ LNWLLNVYD+ R GKIR LS KT I+ L  A L++KY++LF  V +  G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               + AS                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++ +          P AS  +P++  ++   HSR+E YA+RLAE+E  N S +   + NV P
Sbjct: 3076 VNVPLCVDMCLNWLLNVYDTGRAGKIRTLSFKTGIISLCKAHLEDKYRFLFREVASATGFCDQRRLGLLLHDAIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PELEASV----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMQYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTILEGDNMETPVTLINFWPVDHPPAS--SPQL--SHDDTHSRIEHYASRLAEMENRNGSYV---NDNVSP 3368          

HSP 2 Score: 123.635 bits (309), Expect = 5.107e-27
Identity = 140/615 (22.76%), Postives = 253/615 (41.14%), Query Frame = 1
Query:  142 ENENTQQLVFAKWFNNKLKKLYQPSIESLINGFRSG------------------RRFYSITNMICQNENLEIPEQLTDQQLISTGIENILAKFSTTLPQSLQDKIEELLNGDEKIILSLAWWMITEYFAKQRSLSVNAIHSDT------LFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFES-RLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVMELRERLS-GTSQN---------------------DSQSCANEQMKITDSQI----ANPSFESLISNFNLDFSTIIQTLDTFFQHLEIAETRVKVHETFKDAKEV------LEAFKS------------EDDLFVQLKI------IKESVVEHEALMEKLTKHQDSIQSILMKGNAILEITSL--DNTPQLKTNINNKREIITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEE--TRKNQKNFGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYXXXXXXXXXXXXXQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEER 1749
            E E+ Q+  F KW N++  K  +P I+ L      G                  R F  + ++   N  L+I  Q  +  L++ G  +I+                   +G+ K+ L L W +I  +  K     V A    T      L W +Q  K Y+ V+V NF++SW DG A  A++H ++  LF +       N+ + L     +A +  G  RLL+ ++  +++  D KSI ++V  L + L  G S                        +Q   ++Q+ ++ +Q      +PS++    ++    +  ++T +   + L IA++  K  E       +      LE+++S            ED L  Q  I      +KE    HE  M +LT HQ S+  +L  G+ +L    L  D   +++  +N    ++ ++W  L   S E Q +LH  L  +Q   L ++   +D  E    R   +  G  +D +K Q+++ + ++  +E  +  + +L   ++                  DE     S   + ++ E+ + ++G +W  +  W   R+  LQKILL W+HF EE      WL ++
Sbjct:   29 EREDVQKKTFTKWINSQFAKTRRPPIDDLFTDLCDGRRLLELLEVLVGHEIVKERGFTRVHSLNNVNRALQI-LQKNNVDLVNIGGADIV-------------------DGNHKLTLGLIWSIILHWQVKDVMKDVMADLQQTNSEKILLSWVRQSLKNYQDVNVVNFSSSWADGFAFNALIHSHRPELFSWSVVEQQDNAIERLDHAFGVAEKSLGIDRLLDPEDV-ATVHPDKKSIIMYVTSLFKVLPHGVSLEAIQEVETLPRAAVTKEEHVLYQTQQRYSQQITVSVAQSRVRSPSPSYKPRFKSYAFTQAAYVKTPEQQRKFL-IAQSPDKADELRPSPSPLPQGLNELESYQSALEEVLTWLLSAEDGLQAQPPISSFVEEVKEQFHTHEGYMVELTSHQGSVGRVLKAGSVLLSGGQLTDDEEREVREQMN----LLNSRWEHLRVASMERQSRLHEVLMDLQHQQLKQLSDWLDTTETRIKRMGAQALGPELDDIKRQIEEQKLLQEDLELEQVRVNSLTHMVVVV----------------DEN----SGDGATAALEEKLQNLGERWAAICKWTEERWILLQKILLCWQHFSEEQLLFDSWLTQK 597          

HSP 3 Score: 110.538 bits (275), Expect = 5.267e-23
Identity = 143/610 (23.44%), Postives = 249/610 (40.82%), Query Frame = 1
Query: 8098 WQQTMNDYQSMSYELRNSFTGENCKDLEDNLEQMNKQWSTIMNKLAQCTRELNS-MRSPQEQKSHGVELASEKPQSTAAEVNSGISIEKLSGWLSSLEGQLETMEMGIVRWRSGSGLIATGNADKLKSKLISQLNDLYNEIDLYKTQF--------QLCSESEKNDSEYQISKR-------WKIFNDKINETKQCLEGTMESGHNLLTKLRLLNDWLAHKEADMLELKGNVCNTFNTAQNQLLKFENFISDIEAHRNQIEEAIELAQNQIGEAIDSNKLMEQSHTVNLESEGESDNSDTGSNGNVPXXXXXXXXXXXXXXXHYMKRKWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
            WQ  MN    ++ +L   +  ++   ++   E MN  W+ I  +      +L + +R  Q                     +  + +EK   WL+  E     ++    +     GL+      +    L+ Q  DL  EID ++  +        ++ S  E  D+   + KR       W    +K+   +  L+  ++   +L   L+ L +WL  K  + LE +  V     T   QLL  + F  ++ A    I                 N  ++ + T   E   E      G     P+++ + + R LR+    +  +W  L     D+ +  +     L  +     + +  L + E   ++W  V  + +  +   + + K+  + + P+ + +  +    +QL +   P + ++S ++    SRI  +      RL Q+  +E LS   T+  +                     LG S+N  F+   + SV  P ER + P+   VPYY NH TQ T WDHP MA+L +S  +LN++RFSAYRTAMKLR +QK LCLD + M    + F     H    NE+ +D+ Q+I  L S+Y
Sbjct: 2542 WQTQMNVTNELANKLLTLYADDDTSKVKQMTESMNLAWANIKKRAGDKEADLEAGLRQLQ---------------------HYYLDLEKFLNWLTEAETTANVLQDATFK----EGLLENPATVR---HLLEQWQDLQAEIDAHRETYHSLDENGHRIVSSLEGTDNAVVLQKRLDDMGQRWHELCNKVMSIRPYLDAGVDQWKHLHMSLQELLNWLQLKREE-LEKQKPVGGDVPTVHQQLLTHKAFRRELGAKEPVI-----------------NGTLDNAKTFLAEMPREGLKQRPGQKDVSPEERVQNVGRILRKEVEDVTVRWKNLGAASVDWQQQLELALERLMELQDAQDQLDYKLRQAESVKNSWKPVGELLVDDLQNHIDRVKAFQEEIAPIQDNVNHV----NQLASTFRPSDIQLSPDN---LSRIDDLN--MRWRLLQISIEEHLSQLTTAFKD---------------------LGPSQN--FL---HASVESPLERSISPNN--VPYYINHQTQTTCWDHPKMAELYQSLADLNNVRFSAYRTAMKLRRMQKALCLDLLSMPAACEAFE---QHNLKQNEQFMDIVQVINCLTSIY 3065          

HSP 4 Score: 75.8702 bits (185), Expect = 1.408e-12
Identity = 49/142 (34.51%), Postives = 75/142 (52.82%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +V++ LE + R+L AEY+RL+      + +  +SP+ S                           PP         ++P+SP +         P   +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL+RLRQL+++
Sbjct: 3413 LERVLNDLEQENRKLQAEYDRLK----KAHDHKGLSPLPS---------------------------PP--------QMLPVSPQS---------PRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLTRLRQLLEQ 3506          

HSP 5 Score: 56.225 bits (134), Expect = 1.476e-6
Identity = 106/585 (18.12%), Postives = 256/585 (43.76%), Query Frame = 1
Query: 3058 QRVDNRVNFLKDLSEKTAQWKSQTMEFNHWLDEVSSYLDECEQQKYDEDDLINEAIKETEAGIQDMENLIPTLENIEKSTVNLEAYFENDLRVEIFNKKKNLQLKWENLHKRYLNFMEYLKKPLFKNSSQSDPKYKTAPQKVAIIIESESRTEDSLIDIDMEHSNFSMESLDKSSESFNDLGGVDSSGNIDREFLADIESWIRTSTEKLGNYSNIHNTEDLNIFGQLVIEMQNQKLGYIEKLKQYISTDIFLEVNEKFENFCQFLENENQRFKDSDYHLKDVKNILSGEDKWMGKVDRVMQQSFSCDHLDVEELSENIDEIEKVVCDHSEEDFNRLEDLKYSLTNARILERSVSMEIEQIKEKSLVMKNKANKRLGSLTQLLEHIQSVERRVCQMTTWIYDTTNLLKARIVADLLGADLPDEFEILKQNFMEWEKFLLEIEDLEKGKMYQGKKETSEXXXXXXXXXXXSFRPLKELFSRYSRPADFEPRLDNLKREVNRVAEHIYXXXXXXXXXXXXXNCETHAKQFKETLIASESDLNYVYDLGKEIAERKEIEFPERFSLQLDSLKKRYYNLLDQISEAEEKL 4812
            ++++  +  L+D   K  Q+++ T     W+ EV  +L+E E     + + + + +++  A + D+  + P+L  I +  + L+   E    ++I      L  +WE + K+      Y KK   K         +   Q++   I   ++ E+  ++ D ++   + E L K+ E               +E +   E+ ++  T+K+ N+                  +        + LK  +       +   ++  C  L+ + +  ++      ++ + L  E+ WM  +++ + ++       +EE+ E +  ++ ++ +H E + N++ +L  +L + R+L+  +  ++E    +   +  +A++R   L + L   Q  ++ +  +   +  T   L A I   +  A +P E + ++      E   + ++D++K  M   + + SE++  +          +K  F  + +PA+F+ RL   +R +  V   + +L I S+  E +++      +F + L   +S++  V   G++I ++++ E P+    +L +LK  Y +L  Q++E +++L
Sbjct: 1052 EQLEENIQKLQDHMTKLQQFQNDTKTLQKWMAEVDVFLNE-EWPALGDAEALEKQLEQCTALVNDIHTVQPSLNGINEVGLALKREAETPFAIKIQKMLDELNAQWELICKQA-----YAKKSALKGGLDMTVSLRKEMQEMQEWI---TQAEEEYLERDFQYK--TPEELHKAVEELKRA----------QEEVHQKETKVKLLTDKVTNF------------------ISKAPPAAHDALKAELDV-----LTSNYQRLCSRLDGKCKTLEEVWACWCELLSYLELENAWMDLLEKKLDETEGLQG-GIEEIEEALTSLDTMIREHPEYNRNQIRELAQTLMDGRVLDELIHKKVEDYNTRWDELMQRASQRRQQLEKSLHWAQENDKTLRLIQDSLNTTDRHLTAYIADGIDAAQIPQEAQKIQTELNGHE---VTLDDMKKKAM---EVDASEKVIGEIDATLDKLLQVKGKFRLFQKPANFDQRLRECERVLEEVKVKLGVLSIRSVEQEVVQSQLEQCMKFYKNLSEVKSEVETVIKTGRQIVQKQQTEQPKELDDRLTALKLAYNDLGSQVTEGKQEL 1585          
BLAST of Dystrophin vs. Ensembl Zebrafish
Match: dmd (dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1])

HSP 1 Score: 280.026 bits (715), Expect = 3.232e-74
Identity = 138/341 (40.47%), Postives = 201/341 (58.94%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKI----------PTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNIIVKSGNVEP 11199
            +NV +CVD+ LNWLLNVYD+ R GKIR LS KT I+ L  A L++KY++LF  V +  G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               + AS                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++ +          P AS  +P++  ++   HSR+E YA+RLAE+E  N S +   + NV P
Sbjct: 3100 VNVPLCVDMCLNWLLNVYDTGRAGKIRTLSFKTGIISLCKAHLEDKYRFLFREVASATGFCDQRRLGLLLHDAIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PELEASV----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMQYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTILEGDNMETPVTLINFWPVDHPPAS--SPQL--SHDDTHSRIEHYASRLAEMENRNGSYV---NDNVSP 3392          

HSP 2 Score: 124.02 bits (310), Expect = 5.070e-27
Identity = 189/871 (21.70%), Postives = 359/871 (41.22%), Query Frame = 1
Query:  142 ENENTQQLVFAKWFNNKLKKLYQPSIESLINGFRSG------------------RRFYSITNMICQNENLEIPEQLTDQQLISTGIENILAKFSTTLPQSLQDKIEELLNGDEKIILSLAWWMITEYFAKQRSLSVNAIHSDT------LFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFES-RLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFV------------------MELRERLSGTSQN----DSQSCANEQMKITDSQI----ANPSFESLISNFNLDFSTIIQTLDTFFQHLEIAETRVKVHETFKDAKEV------LEAFKS------------EDDLFVQLKI------IKESVVEHEALMEKLTKHQDSIQSILMKGNAILEITSL--DNTPQLKTNINNKREIITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEE--TRKNQKNFGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYXXXXXXXXXXXXXQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWL---EERICTADQLLRKSNKNQFNDFVNYTESKWGRMISSLDKCGQKIKDLCENESLVVSTVDN--------KIDEMIQNWNDASEKWRDSIDNWMGSDGKRRSNRASSFSDMSSENCYM-------RRKMENVTR---NTPSSQSDMNISDFPIQAGYKTKFENDAERMMSWLENSAEKLELITLESISPEERPSITEQRKTI-DLVTKEINLEKSK----KNMETIKRMGLMYQEDLNKHGENTDEIEQLFEELDERW 2439
            E E+ Q+  F KW N++  K  +P I+ L      G                  R F  + ++   N  L+I  Q  +  L++ G  +I+                   +G+ K+ L L W +I  +  K     V A    T      L W +Q  K Y+ V+V NF++SW DG A  A++H ++  LF +       N+ + L     +A +  G  RLL+ ++  +++  D KSI ++V                  +E   R + T +      +Q   ++Q+ ++ +Q      +PS++    ++    +  ++T +   + L IA++  K  E       +      LE+++S            ED L  Q  I      +KE    HE  M +LT HQ S+  +L  G+ +L    L  D   +++  +N    ++ ++W  L   S E Q +LH  L  +Q   L ++   +D  E    R   +  G  +D +K Q+++ + ++  +E  +  + +L   ++                  DE     S   + ++ E+ + ++G +W  +  W   R+  LQKILL W+HF EE      WL   EE +    Q ++ S  N  N+ V     K   + + L+   Q +  LC   SLV   + N        K++  ++ +   +++W   +     +  K  +   +S S+++             ++KM   T+   +TP  Q    I    + +  + +F+ D   + S++  S   L+       +PE   SI+ +  ++ DL  K + +++ K    + ++   R      + L   G+N+++I+Q  ++L  RW
Sbjct:   29 EREDVQKKTFTKWINSQFAKTRRPPIDDLFTDLCDGRRLLELLEVLVGHEIVKERGFTRVHSLNNVNRALQI-LQKNNVDLVNIGGADIV-------------------DGNHKLTLGLIWSIILHWQVKDVMKDVMADLQQTNSEKILLSWVRQSLKNYQDVNVVNFSSSWADGFAFNALIHSHRPELFSWSVVEQQDNAIERLDHAFGVAEKSLGIDRLLDPED-VATVHPDKKSIIMYVTSLFKVLPHGVSLEAIQEVETLPRAAVTKEEHVLYQTQQRYSQQITVSVAQSRVRSPSPSYKPRFKSYAFTQAAYVKTPEQQRKFL-IAQSPDKADELRPSPSPLPQGLNELESYQSALEEVLTWLLSAEDGLQAQPPISSFVEEVKEQFHTHEGYMVELTSHQGSVGRVLKAGSVLLSGGQLTDDEEREVREQMN----LLNSRWEHLRVASMERQSRLHEVLMDLQHQQLKQLSDWLDTTETRIKRMGAQALGPELDDIKRQIEEQKLLQEDLELEQVRVNSLTHMVVVV----------------DEN----SGDGATAALEEKLQNLGERWAAICKWTEERWILLQKILLCWQHFSEEQLLFDSWLTQKEELV----QSIQSSGTNDPNE-VAANLRKLAILKADLELKRQTMDKLC---SLVQDLLTNIKSKEAAGKLEAKLERF---AQRWDKLVQALQLTSTKISTIVTTSQSEITHTTMATVTKVTTNQKKMVKHTKEGMSTPPPQKKRQIV---VDSELRKRFDVDFTEIHSFMTRSEAVLQ-------NPEF--SISRKEGSVADLYEKVLAIDREKPEKFRKLQEATRSAQALVDQLTSDGQNSEDIQQAAQQLRARW 830          

HSP 3 Score: 110.538 bits (275), Expect = 4.650e-23
Identity = 143/610 (23.44%), Postives = 249/610 (40.82%), Query Frame = 1
Query: 8098 WQQTMNDYQSMSYELRNSFTGENCKDLEDNLEQMNKQWSTIMNKLAQCTRELNS-MRSPQEQKSHGVELASEKPQSTAAEVNSGISIEKLSGWLSSLEGQLETMEMGIVRWRSGSGLIATGNADKLKSKLISQLNDLYNEIDLYKTQF--------QLCSESEKNDSEYQISKR-------WKIFNDKINETKQCLEGTMESGHNLLTKLRLLNDWLAHKEADMLELKGNVCNTFNTAQNQLLKFENFISDIEAHRNQIEEAIELAQNQIGEAIDSNKLMEQSHTVNLESEGESDNSDTGSNGNVPXXXXXXXXXXXXXXXHYMKRKWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
            WQ  MN    ++ +L   +  ++   ++   E MN  W+ I  +      +L + +R  Q                     +  + +EK   WL+  E     ++    +     GL+      +    L+ Q  DL  EID ++  +        ++ S  E  D+   + KR       W    +K+   +  L+  ++   +L   L+ L +WL  K  + LE +  V     T   QLL  + F  ++ A    I                 N  ++ + T   E   E      G     P+++ + + R LR+    +  +W  L     D+ +  +     L  +     + +  L + E   ++W  V  + +  +   + + K+  + + P+ + +  +    +QL +   P + ++S ++    SRI  +      RL Q+  +E LS   T+  +                     LG S+N  F+   + SV  P ER + P+   VPYY NH TQ T WDHP MA+L +S  +LN++RFSAYRTAMKLR +QK LCLD + M    + F     H    NE+ +D+ Q+I  L S+Y
Sbjct: 2566 WQTQMNVTNELANKLLTLYADDDTSKVKQMTESMNLAWANIKKRAGDKEADLEAGLRQLQ---------------------HYYLDLEKFLNWLTEAETTANVLQDATFK----EGLLENPATVR---HLLEQWQDLQAEIDAHRETYHSLDENGHRIVSSLEGTDNAVVLQKRLDDMGQRWHELCNKVMSIRPYLDAGVDQWKHLHMSLQELLNWLQLKREE-LEKQKPVGGDVPTVHQQLLTHKAFRRELGAKEPVI-----------------NGTLDNAKTFLAEMPREGLKQRPGQKDVSPEERVQNVGRILRKEVEDVTVRWKNLGAASVDWQQQLELALERLMELQDAQDQLDYKLRQAESVKNSWKPVGELLVDDLQNHIDRVKAFQEEIAPIQDNVNHV----NQLASTFRPSDIQLSPDN---LSRIDDLN--MRWRLLQISIEEHLSQLTTAFKD---------------------LGPSQN--FL---HASVESPLERSISPNN--VPYYINHQTQTTCWDHPKMAELYQSLADLNNVRFSAYRTAMKLRRMQKALCLDLLSMPAACEAFE---QHNLKQNEQFMDIVQVINCLTSIY 3089          

HSP 4 Score: 76.2554 bits (186), Expect = 1.386e-12
Identity = 49/142 (34.51%), Postives = 75/142 (52.82%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +V++ LE + R+L AEY+RL+      + +  +SP+ S                           PP         ++P+SP +         P   +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL+RLRQL+++
Sbjct: 3437 LERVLNDLEQENRKLQAEYDRLK----KAHDHKGLSPLPS---------------------------PP--------QMLPVSPQS---------PRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLTRLRQLLEQ 3530          

HSP 5 Score: 56.225 bits (134), Expect = 1.440e-6
Identity = 106/585 (18.12%), Postives = 256/585 (43.76%), Query Frame = 1
Query: 3058 QRVDNRVNFLKDLSEKTAQWKSQTMEFNHWLDEVSSYLDECEQQKYDEDDLINEAIKETEAGIQDMENLIPTLENIEKSTVNLEAYFENDLRVEIFNKKKNLQLKWENLHKRYLNFMEYLKKPLFKNSSQSDPKYKTAPQKVAIIIESESRTEDSLIDIDMEHSNFSMESLDKSSESFNDLGGVDSSGNIDREFLADIESWIRTSTEKLGNYSNIHNTEDLNIFGQLVIEMQNQKLGYIEKLKQYISTDIFLEVNEKFENFCQFLENENQRFKDSDYHLKDVKNILSGEDKWMGKVDRVMQQSFSCDHLDVEELSENIDEIEKVVCDHSEEDFNRLEDLKYSLTNARILERSVSMEIEQIKEKSLVMKNKANKRLGSLTQLLEHIQSVERRVCQMTTWIYDTTNLLKARIVADLLGADLPDEFEILKQNFMEWEKFLLEIEDLEKGKMYQGKKETSEXXXXXXXXXXXSFRPLKELFSRYSRPADFEPRLDNLKREVNRVAEHIYXXXXXXXXXXXXXNCETHAKQFKETLIASESDLNYVYDLGKEIAERKEIEFPERFSLQLDSLKKRYYNLLDQISEAEEKL 4812
            ++++  +  L+D   K  Q+++ T     W+ EV  +L+E E     + + + + +++  A + D+  + P+L  I +  + L+   E    ++I      L  +WE + K+      Y KK   K         +   Q++   I   ++ E+  ++ D ++   + E L K+ E               +E +   E+ ++  T+K+ N+                  +        + LK  +       +   ++  C  L+ + +  ++      ++ + L  E+ WM  +++ + ++       +EE+ E +  ++ ++ +H E + N++ +L  +L + R+L+  +  ++E    +   +  +A++R   L + L   Q  ++ +  +   +  T   L A I   +  A +P E + ++      E   + ++D++K  M   + + SE++  +          +K  F  + +PA+F+ RL   +R +  V   + +L I S+  E +++      +F + L   +S++  V   G++I ++++ E P+    +L +LK  Y +L  Q++E +++L
Sbjct: 1052 EQLEENIQKLQDHMTKLQQFQNDTKTLQKWMAEVDVFLNE-EWPALGDAEALEKQLEQCTALVNDIHTVQPSLNGINEVGLALKREAETPFAIKIQKMLDELNAQWELICKQA-----YAKKSALKGGLDMTVSLRKEMQEMQEWI---TQAEEEYLERDFQYK--TPEELHKAVEELKRA----------QEEVHQKETKVKLLTDKVTNF------------------ISKAPPAAHDALKAELDV-----LTSNYQRLCSRLDGKCKTLEEVWACWCELLSYLELENAWMDLLEKKLDETEGLQG-GIEEIEEALTSLDTMIREHPEYNRNQIRELAQTLMDGRVLDELIHKKVEDYNTRWDELMQRASQRRQQLEKSLHWAQENDKTLRLIQDSLNTTDRHLTAYIADGIDAAQIPQEAQKIQTELNGHE---VTLDDMKKKAM---EVDASEKVIGEIDATLDKLLQVKGKFRLFQKPANFDQRLRECERVLEEVKVKLGVLSIRSVEQEVVQSQLEQCMKFYKNLSEVKSEVETVIKTGRQIVQKQQTEQPKELDDRLTALKLAYNDLGSQVTEGKQEL 1585          
BLAST of Dystrophin vs. Ensembl Xenopus
Match: tg (thyroglobulin [Source:Xenbase;Acc:XB-GENE-6073495])

HSP 1 Score: 280.796 bits (717), Expect = 2.697e-77
Identity = 134/320 (41.88%), Postives = 196/320 (61.25%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKS 11166
            +NV +CVD+ LNWLLNVYD+ R G+IRVLS KT ++ L  A L++KY+YLF  V ++ G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               I A+                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++  P +S   P++  ++   HSR+E YA+RLAE+E  N S
Sbjct:  446 VNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGVISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDAIQIPRQLGEVASFGGSNIEPSVRSCFQYANNK-------------PEIEAAL----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMET--PASS---PQL--SHDDTHSRIEHYASRLAEMENTNGS 717          

HSP 2 Score: 111.309 bits (277), Expect = 2.620e-23
Identity = 89/290 (30.69%), Postives = 145/290 (50.00%), Query Frame = 1
Query: 9028 KWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQK 9897
            +W +LNL+  D+ +   +    L+ +   + E +  L + E    +W  V ++              LI SLQ  L KI  +E  K+++  +K  +N +++  + +  S +  +      RL+ L+ +    L Q S +E  +I   HE+                ++ F+   + SV  PWER + P+  +VPYY NH TQ T WDHP M +L +S  +LN++RFSAYRTAMKLR LQK LCLD + ++   +       H    N++L+D+ QII  L ++Y    Q+
Sbjct:  189 EWDKLNLRSTDWQKKLDEALQRLQELQEAMDELDHKLHQAEALKGSWQPVGDL--------------LIDSLQDHLGKIK-MEFSKTEIAPIKNNVN-QVNDLAHQFDSTVIQLSPYNFSRLEDLNTR--WKLLQVSIDE--RIRQLHEAHRDFG---------PTSQHFL---STSVQGPWERAISPN--KVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLGLSAACEAL---DQHNLKQNDQLMDILQIINCLTTIYDRLEQE 441          

HSP 3 Score: 68.5514 bits (166), Expect = 3.149e-10
Identity = 47/142 (33.10%), Postives = 72/142 (50.70%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +++  LE + + L +EY+RL+ Q    + +  +SP+ S                           PP         ++P SP +  D          +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct:  770 LERILADLEEENKNLQSEYDRLKEQ----HDHKGLSPLPS---------------------------PP--------EMMPSSPQSQRD---------AELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 863          
BLAST of Dystrophin vs. Ensembl Xenopus
Match: tg (thyroglobulin [Source:Xenbase;Acc:XB-GENE-6073495])

HSP 1 Score: 280.411 bits (716), Expect = 3.321e-77
Identity = 134/320 (41.88%), Postives = 196/320 (61.25%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKS 11166
            +NV +CVD+ LNWLLNVYD+ R G+IRVLS KT ++ L  A L++KY+YLF  V ++ G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               I A+                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++  P +S   P++  ++   HSR+E YA+RLAE+E  N S
Sbjct:  441 VNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGVISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDAIQIPRQLGEVASFGGSNIEPSVRSCFQYANNK-------------PEIEAAL----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMET--PASS---PQL--SHDDTHSRIEHYASRLAEMENTNGS 712          

HSP 2 Score: 111.694 bits (278), Expect = 1.650e-23
Identity = 77/290 (26.55%), Postives = 134/290 (46.21%), Query Frame = 1
Query: 9028 KWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQK 9897
            +W +LNL+  D+ +   +    L+ +   + E +  L + E    +W  V ++ +  +   + + K+    + P+   +  +     Q  +  + ++       E + +R   ++   + R++QLH+                    H      S+             F+   + SV  PWER + P+  +VPYY NH TQ T WDHP M +L +S  +LN++RFSAYRTAMKLR LQK LCLD + ++   +       H    N++L+D+ QII  L ++Y    Q+
Sbjct:  186 EWDKLNLRSTDWQKKLDEALQRLQELQEAMDELDHKLHQAEALKGSWQPVGDLLIDSLQDHLGKIKTFKAEIAPIKNNVNQVNDLAHQFDSTVIQLSPYNFSRLEDLNTRWKLLQVSIDERIRQLHEA-------------------HRDFGPTSQH------------FL---STSVQGPWERAISPN--KVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLGLSAACEAL---DQHNLKQNDQLMDILQIINCLTTIYDRLEQE 436          

HSP 3 Score: 68.1662 bits (165), Expect = 3.177e-10
Identity = 47/142 (33.10%), Postives = 72/142 (50.70%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +++  LE + + L +EY+RL+ Q    + +  +SP+ S                           PP         ++P SP +  D          +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct:  765 LERILADLEEENKNLQSEYDRLKEQ----HDHKGLSPLPS---------------------------PP--------EMMPSSPQSQRD---------AELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 858          
BLAST of Dystrophin vs. Ensembl Xenopus
Match: tg (thyroglobulin [Source:Xenbase;Acc:XB-GENE-6073495])

HSP 1 Score: 289.656 bits (740), Expect = 5.272e-77
Identity = 134/320 (41.88%), Postives = 196/320 (61.25%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKS 11166
            +NV +CVD+ LNWLLNVYD+ R G+IRVLS KT ++ L  A L++KY+YLF  V ++ G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               I A+                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++  P +S   P++  ++   HSR+E YA+RLAE+E  N S
Sbjct: 3065 VNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGVISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDAIQIPRQLGEVASFGGSNIEPSVRSCFQYANNK-------------PEIEAAL----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMET--PASS---PQL--SHDDTHSRIEHYASRLAEMENTNGS 3336          

HSP 2 Score: 110.923 bits (276), Expect = 5.315e-23
Identity = 53/108 (49.07%), Postives = 71/108 (65.74%), Query Frame = 1
Query: 9556 SVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
            SV  PWER + P+  +VPYY NH TQ T WDHP M +L +S  +LN++RFSAYRTAMKLR LQK LCLD + ++   +       H    N++L+D+ QII  L ++Y
Sbjct: 2952 SVQGPWERAISPN--KVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLGLSAACEAL---DQHNLKQNDQLMDILQIINCLTTIY 3054          

HSP 3 Score: 73.9442 bits (180), Expect = 7.984e-12
Identity = 64/251 (25.50%), Postives = 111/251 (44.22%), Query Frame = 1
Query: 1021 KEVLEAFKSEDDLFVQLKIIKESVVE-------HEALMEKLTKHQDSIQSILMKGNAILEITSLDNTPQLKTNINNKREIITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEE-TRKNQKNFGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYXXXXXXXXXXXXXQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEER 1749
            +EVL    S +D+    K I  +V E       HE  M +LT HQ ++ ++L  G+ +L    L +  +    I  +  ++  +W  L   S E Q  LHR L  +Q   L ++   + Q EE TRK     G  ++ +K Q+++++ ++  +E  +  + +L   ++                  DE     S   + +  E  +  +GN+W  +  W   R+  LQ+ILL W+ F EE      WL E+
Sbjct:  326 EEVLSWLLSAEDILQSQKTISNNVEEVKDQFHTHEGFMMELTSHQGNVGNVLQAGSQLLVTGKLSDDEE--NEIQEQMNLLNTRWESLRLASMERQSNLHRRLMDLQNQQLQQLSDWLSQTEERTRKMDAELGPDLEDIKRQIEEHKVLQDDLEQEQIRVNSLTHMVVVV----------------DES----SGEKATADLEDQLQHLGNRWAAICRWTEDRWVFLQEILLKWQRFAEEQCLFDVWLTEK 554          

HSP 4 Score: 73.9442 bits (180), Expect = 9.681e-12
Identity = 60/215 (27.91%), Postives = 106/215 (49.30%), Query Frame = 1
Query:  217 IESLINGFRSGRRFYSITNMICQNENLEIPEQLTDQQLI----STGIE--NILAKFSTTLPQSLQDKI----EELLNGDEKIILSLAWWMITEYFAKQ--RSLSVNAIHSDT----LFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVMELRERL 813
            IE L +  + GRR             L++ E LT Q+L+    ST +   N + K    L ++  D +     ++++G+ K+ L L W +I  +  K   + +  +   ++T    L W +Q  + Y  V+V NFT+SW DG A  A++H ++  LFE+ S L +++ + L    + A +  G   LL+ D+  ++   D KSI ++V  L + L
Sbjct:   14 IEDLFSDLQDGRRL------------LDLLEGLTGQKLVKEKGSTRVHALNNVNKALQVLQKNNIDLVNIGSADIVDGNHKLTLGLIWSIILHWQVKDVLKGIMADLQQTNTEKILLSWVRQSTRNYPQVNVINFTSSWSDGLAFNALIHSHRPDLFEWNSVLCQSALERLDHAFNAAQRHLGIANLLDPDDIATAHP-DKKSILMYVTSLFQAL 215          

HSP 5 Score: 73.1738 bits (178), Expect = 1.331e-11
Identity = 82/342 (23.98%), Postives = 171/342 (50.00%), Query Frame = 1
Query: 3829 FENFCQFLENENQRFKDSDYHLKDVKNILSGEDKWMGKVDRVMQQSFSCDHLDVEELSENIDEIEKVVCDHSEEDFNRLEDLKYSLTNARILERSVSMEIEQIKEKSLVMKNKANKRLGSLTQLLEHIQSVERRVCQMTTWIYDTTNLLKARIVADLLGADLPDEFEILKQNFMEWEKFLLEIEDLEKGKMYQGKKETSEXXXXXXXXXXXSFRPLKELFSRYSRPADFEPRLDNLKREVNRVAEHIYXXXXXXXXXXXXXNCETHAKQFKETLIASESDLNYVYDLGKEIAERKEIEFPERFSLQLDSLKKRYYNLLDQISEA----EEKLSLARPLVVEI 4842
            +E  C  L  + Q  K+      ++ + L  E+KW+ +V+  ++ + +      EE+SE +  IEK++  H E++ N++ +L  +LT+  +++  ++ ++E+       ++ +A +R   L Q ++  Q  ++ +  +   +  T   L A I   +  A +P E + ++ + M  E  L E++   +G      KE S+++  Q    QK F+ +   F  + +PA+FE RL   KR ++ V   + +L+I SI  E ++       +  + L   +S++  V   G++I ++++ E P+    +L +LK +Y  L  +++E     E+ L L+R L  E+
Sbjct: 1220 YERLCSRLNGKCQTLKEVWACWCELLSYLEAENKWLDEVEAKLKTTENVKG-GAEEISEALKSIEKIM-KHPEDNRNQIRELAQTLTDGGVMDELINEKLEKFNTHWEEVQQEAVRRQKVLEQSIQSAQETDKAIRMIQEALNTTDRQLTAYIADRIDAAQVPQEAQKIQSDLMSHEISLDEMKKRNQG------KEMSKKVLSQIEIAQKKFQEVSTKFRLFQKPANFEQRLIESKRILDEVTFELPVLEIKSIEQEVVQTQLDQCMKLYKILSEVKSEVETVIKTGRQIVQKQQTENPKDLDERLTALKMQYNELGAKVTEGKQNLEKCLKLSRKLRKEM 1553          

HSP 6 Score: 70.0922 bits (170), Expect = 1.117e-10
Identity = 47/142 (33.10%), Postives = 72/142 (50.70%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +++  LE + + L +EY+RL+ Q    + +  +SP+ S                           PP         ++P SP +  D          +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct: 3389 LERILADLEEENKNLQSEYDRLKEQ----HDHKGLSPLPS---------------------------PP--------EMMPSSPQSQRD---------AELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 3482          
BLAST of Dystrophin vs. Ensembl Xenopus
Match: tg (thyroglobulin [Source:Xenbase;Acc:XB-GENE-6073495])

HSP 1 Score: 289.656 bits (740), Expect = 5.385e-77
Identity = 134/320 (41.88%), Postives = 196/320 (61.25%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKS 11166
            +NV +CVD+ LNWLLNVYD+ R G+IRVLS KT ++ L  A L++KY+YLF  V ++ G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               I A+                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++  P +S   P++  ++   HSR+E YA+RLAE+E  N S
Sbjct: 3099 VNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGVISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDAIQIPRQLGEVASFGGSNIEPSVRSCFQYANNK-------------PEIEAAL----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMET--PASS---PQL--SHDDTHSRIEHYASRLAEMENTNGS 3370          

HSP 2 Score: 110.923 bits (276), Expect = 5.689e-23
Identity = 53/108 (49.07%), Postives = 71/108 (65.74%), Query Frame = 1
Query: 9556 SVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
            SV  PWER + P+  +VPYY NH TQ T WDHP M +L +S  +LN++RFSAYRTAMKLR LQK LCLD + ++   +       H    N++L+D+ QII  L ++Y
Sbjct: 2986 SVQGPWERAISPN--KVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLGLSAACEAL---DQHNLKQNDQLMDILQIINCLTTIY 3088          

HSP 3 Score: 80.1073 bits (196), Expect = 1.275e-13
Identity = 57/205 (27.80%), Postives = 100/205 (48.78%), Query Frame = 1
Query:  217 IESLINGFRSGRRFYSITNMICQNENLEIPEQLTDQQLISTGIENILAKFSTTLPQSLQDKIEELLNGDEKIILSLAWWMITEYFAKQ--RSLSVNAIHSDT----LFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVMELRERL 813
            IE L +  + GRR             L++ E LT Q+L+ +   NI+A               ++++G+ K+ L L W +I  +  K   + +  +   ++T    L W +Q  + Y  V+V NFT+SW DG A  A++H ++  LFE+ S L +++ + L    + A +  G   LL+ D+  ++   D KSI ++V  L + L
Sbjct:   14 IEDLFSDLQDGRRL------------LDLLEGLTGQKLVGSIKFNIIA---------------DIVDGNHKLTLGLIWSIILHWQVKDVLKGIMADLQQTNTEKILLSWVRQSTRNYPQVNVINFTSSWSDGLAFNALIHSHRPDLFEWNSVLCQSALERLDHAFNAAQRHLGIANLLDPDDIATAHP-DKKSILMYVTSLFQAL 190          

HSP 4 Score: 73.9442 bits (180), Expect = 8.834e-12
Identity = 64/251 (25.50%), Postives = 111/251 (44.22%), Query Frame = 1
Query: 1021 KEVLEAFKSEDDLFVQLKIIKESVVE-------HEALMEKLTKHQDSIQSILMKGNAILEITSLDNTPQLKTNINNKREIITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEE-TRKNQKNFGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYXXXXXXXXXXXXXQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEER 1749
            +EVL    S +D+    K I  +V E       HE  M +LT HQ ++ ++L  G+ +L    L +  +    I  +  ++  +W  L   S E Q  LHR L  +Q   L ++   + Q EE TRK     G  ++ +K Q+++++ ++  +E  +  + +L   ++                  DE     S   + +  E  +  +GN+W  +  W   R+  LQ+ILL W+ F EE      WL E+
Sbjct:  301 EEVLSWLLSAEDILQSQKTISNNVEEVKDQFHTHEGFMMELTSHQGNVGNVLQAGSQLLVTGKLSDDEE--NEIQEQMNLLNTRWESLRLASMERQSNLHRRLMDLQNQQLQQLSDWLSQTEERTRKMDAELGPDLEDIKRQIEEHKVLQDDLEQEQIRVNSLTHMVVVV----------------DES----SGEKATADLEDQLQHLGNRWAAICRWTEDRWVFLQEILLKWQRFAEEQCLFDVWLTEK 529          

HSP 5 Score: 73.1738 bits (178), Expect = 1.549e-11
Identity = 82/342 (23.98%), Postives = 171/342 (50.00%), Query Frame = 1
Query: 3829 FENFCQFLENENQRFKDSDYHLKDVKNILSGEDKWMGKVDRVMQQSFSCDHLDVEELSENIDEIEKVVCDHSEEDFNRLEDLKYSLTNARILERSVSMEIEQIKEKSLVMKNKANKRLGSLTQLLEHIQSVERRVCQMTTWIYDTTNLLKARIVADLLGADLPDEFEILKQNFMEWEKFLLEIEDLEKGKMYQGKKETSEXXXXXXXXXXXSFRPLKELFSRYSRPADFEPRLDNLKREVNRVAEHIYXXXXXXXXXXXXXNCETHAKQFKETLIASESDLNYVYDLGKEIAERKEIEFPERFSLQLDSLKKRYYNLLDQISEA----EEKLSLARPLVVEI 4842
            +E  C  L  + Q  K+      ++ + L  E+KW+ +V+  ++ + +      EE+SE +  IEK++  H E++ N++ +L  +LT+  +++  ++ ++E+       ++ +A +R   L Q ++  Q  ++ +  +   +  T   L A I   +  A +P E + ++ + M  E  L E++   +G      KE S+++  Q    QK F+ +   F  + +PA+FE RL   KR ++ V   + +L+I SI  E ++       +  + L   +S++  V   G++I ++++ E P+    +L +LK +Y  L  +++E     E+ L L+R L  E+
Sbjct: 1195 YERLCSRLNGKCQTLKEVWACWCELLSYLEAENKWLDEVEAKLKTTENVKG-GAEEISEALKSIEKIM-KHPEDNRNQIRELAQTLTDGGVMDELINEKLEKFNTHWEEVQQEAVRRQKVLEQSIQSAQETDKAIRMIQEALNTTDRQLTAYIADRIDAAQVPQEAQKIQSDLMSHEISLDEMKKRNQG------KEMSKKVLSQIEIAQKKFQEVSTKFRLFQKPANFEQRLIESKRILDEVTFELPVLEIKSIEQEVVQTQLDQCMKLYKILSEVKSEVETVIKTGRQIVQKQQTENPKDLDERLTALKMQYNELGAKVTEGKQNLEKCLKLSRKLRKEM 1528          

HSP 6 Score: 70.4774 bits (171), Expect = 1.081e-10
Identity = 47/142 (33.10%), Postives = 72/142 (50.70%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +++  LE + + L +EY+RL+ Q    + +  +SP+ S                           PP         ++P SP +  D          +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct: 3423 LERILADLEEENKNLQSEYDRLKEQ----HDHKGLSPLPS---------------------------PP--------EMMPSSPQSQRD---------AELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 3516          
BLAST of Dystrophin vs. Ensembl Xenopus
Match: tg (thyroglobulin [Source:Xenbase;Acc:XB-GENE-6073495])

HSP 1 Score: 289.656 bits (740), Expect = 5.648e-77
Identity = 134/320 (41.88%), Postives = 196/320 (61.25%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKS 11166
            +NV +CVD+ LNWLLNVYD+ R G+IRVLS KT ++ L  A L++KY+YLF  V ++ G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               I A+                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++  P +S   P++  ++   HSR+E YA+RLAE+E  N S
Sbjct: 3124 VNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGVISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDAIQIPRQLGEVASFGGSNIEPSVRSCFQYANNK-------------PEIEAAL----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMET--PASS---PQL--SHDDTHSRIEHYASRLAEMENTNGS 3395          

HSP 2 Score: 110.923 bits (276), Expect = 5.603e-23
Identity = 53/108 (49.07%), Postives = 71/108 (65.74%), Query Frame = 1
Query: 9556 SVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
            SV  PWER + P+  +VPYY NH TQ T WDHP M +L +S  +LN++RFSAYRTAMKLR LQK LCLD + ++   +       H    N++L+D+ QII  L ++Y
Sbjct: 3011 SVQGPWERAISPN--KVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLGLSAACEAL---DQHNLKQNDQLMDILQIINCLTTIY 3113          

HSP 3 Score: 73.9442 bits (180), Expect = 9.067e-12
Identity = 64/251 (25.50%), Postives = 111/251 (44.22%), Query Frame = 1
Query: 1021 KEVLEAFKSEDDLFVQLKIIKESVVE-------HEALMEKLTKHQDSIQSILMKGNAILEITSLDNTPQLKTNINNKREIITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEE-TRKNQKNFGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYXXXXXXXXXXXXXQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEER 1749
            +EVL    S +D+    K I  +V E       HE  M +LT HQ ++ ++L  G+ +L    L +  +    I  +  ++  +W  L   S E Q  LHR L  +Q   L ++   + Q EE TRK     G  ++ +K Q+++++ ++  +E  +  + +L   ++                  DE     S   + +  E  +  +GN+W  +  W   R+  LQ+ILL W+ F EE      WL E+
Sbjct:  326 EEVLSWLLSAEDILQSQKTISNNVEEVKDQFHTHEGFMMELTSHQGNVGNVLQAGSQLLVTGKLSDDEE--NEIQEQMNLLNTRWESLRLASMERQSNLHRRLMDLQNQQLQQLSDWLSQTEERTRKMDAELGPDLEDIKRQIEEHKVLQDDLEQEQIRVNSLTHMVVVV----------------DES----SGEKATADLEDQLQHLGNRWAAICRWTEDRWVFLQEILLKWQRFAEEQCLFDVWLTEK 554          

HSP 4 Score: 73.559 bits (179), Expect = 1.045e-11
Identity = 60/215 (27.91%), Postives = 106/215 (49.30%), Query Frame = 1
Query:  217 IESLINGFRSGRRFYSITNMICQNENLEIPEQLTDQQLI----STGIE--NILAKFSTTLPQSLQDKI----EELLNGDEKIILSLAWWMITEYFAKQ--RSLSVNAIHSDT----LFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVMELRERL 813
            IE L +  + GRR             L++ E LT Q+L+    ST +   N + K    L ++  D +     ++++G+ K+ L L W +I  +  K   + +  +   ++T    L W +Q  + Y  V+V NFT+SW DG A  A++H ++  LFE+ S L +++ + L    + A +  G   LL+ D+  ++   D KSI ++V  L + L
Sbjct:   14 IEDLFSDLQDGRRL------------LDLLEGLTGQKLVKEKGSTRVHALNNVNKALQVLQKNNIDLVNIGSADIVDGNHKLTLGLIWSIILHWQVKDVLKGIMADLQQTNTEKILLSWVRQSTRNYPQVNVINFTSSWSDGLAFNALIHSHRPDLFEWNSVLCQSALERLDHAFNAAQRHLGIANLLDPDDIATAHP-DKKSILMYVTSLFQAL 215          

HSP 5 Score: 73.1738 bits (178), Expect = 1.630e-11
Identity = 82/342 (23.98%), Postives = 171/342 (50.00%), Query Frame = 1
Query: 3829 FENFCQFLENENQRFKDSDYHLKDVKNILSGEDKWMGKVDRVMQQSFSCDHLDVEELSENIDEIEKVVCDHSEEDFNRLEDLKYSLTNARILERSVSMEIEQIKEKSLVMKNKANKRLGSLTQLLEHIQSVERRVCQMTTWIYDTTNLLKARIVADLLGADLPDEFEILKQNFMEWEKFLLEIEDLEKGKMYQGKKETSEXXXXXXXXXXXSFRPLKELFSRYSRPADFEPRLDNLKREVNRVAEHIYXXXXXXXXXXXXXNCETHAKQFKETLIASESDLNYVYDLGKEIAERKEIEFPERFSLQLDSLKKRYYNLLDQISEA----EEKLSLARPLVVEI 4842
            +E  C  L  + Q  K+      ++ + L  E+KW+ +V+  ++ + +      EE+SE +  IEK++  H E++ N++ +L  +LT+  +++  ++ ++E+       ++ +A +R   L Q ++  Q  ++ +  +   +  T   L A I   +  A +P E + ++ + M  E  L E++   +G      KE S+++  Q    QK F+ +   F  + +PA+FE RL   KR ++ V   + +L+I SI  E ++       +  + L   +S++  V   G++I ++++ E P+    +L +LK +Y  L  +++E     E+ L L+R L  E+
Sbjct: 1220 YERLCSRLNGKCQTLKEVWACWCELLSYLEAENKWLDEVEAKLKTTENVKG-GAEEISEALKSIEKIM-KHPEDNRNQIRELAQTLTDGGVMDELINEKLEKFNTHWEEVQQEAVRRQKVLEQSIQSAQETDKAIRMIQEALNTTDRQLTAYIADRIDAAQVPQEAQKIQSDLMSHEISLDEMKKRNQG------KEMSKKVLSQIEIAQKKFQEVSTKFRLFQKPANFEQRLIESKRILDEVTFELPVLEIKSIEQEVVQTQLDQCMKLYKILSEVKSEVETVIKTGRQIVQKQQTENPKDLDERLTALKMQYNELGAKVTEGKQNLEKCLKLSRKLRKEM 1553          

HSP 6 Score: 70.4774 bits (171), Expect = 1.055e-10
Identity = 47/142 (33.10%), Postives = 72/142 (50.70%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +++  LE + + L +EY+RL+ Q    + +  +SP+ S                           PP         ++P SP +  D          +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct: 3448 LERILADLEEENKNLQSEYDRLKEQ----HDHKGLSPLPS---------------------------PP--------EMMPSSPQSQRD---------AELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 3541          
BLAST of Dystrophin vs. Ensembl Mouse
Match: Dmd (dystrophin, muscular dystrophy [Source:MGI Symbol;Acc:MGI:94909])

HSP 1 Score: 278.485 bits (711), Expect = 1.705e-79
Identity = 135/320 (42.19%), Postives = 196/320 (61.25%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKS 11166
            +NV +CVD+ LNWLLNVYD+ R G+IRVLS KT I+ L  A L++KY+YLF  V ++ G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               I A+                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++  P +S   P++  ++   HSR+E YA+RLAE+E  N S
Sbjct:  101 VNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PEIEAAL----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMET--PASS---PQL--SHDDTHSRIEHYASRLAEMENSNGS 372          

HSP 2 Score: 87.4261 bits (215), Expect = 2.576e-16
Identity = 43/96 (44.79%), Postives = 59/96 (61.46%), Query Frame = 1
Query: 9610 YYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQK 9897
            + K H TQ T WDHP M +L +S  +LN++RFSAYRTAMKLR LQK LCLD + ++   D       H    N++ +D+ QII  L ++Y    Q+
Sbjct:    4 HLKGHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDAL---DQHNLKQNDQPMDILQIINCLTTIYDRLEQE 96          

HSP 3 Score: 72.4034 bits (176), Expect = 1.010e-11
Identity = 49/142 (34.51%), Postives = 72/142 (50.70%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +++  LE + R L AEY+RL+ Q    + +  +SP+ S                           PP         ++P SP +         P   +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct:  425 LERILADLEEENRNLQAEYDRLKQQ----HEHKGLSPLPS---------------------------PP--------EMMPTSPQS---------PRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 518          
BLAST of Dystrophin vs. Ensembl Mouse
Match: Dmd (dystrophin, muscular dystrophy [Source:MGI Symbol;Acc:MGI:94909])

HSP 1 Score: 277.33 bits (708), Expect = 5.023e-79
Identity = 134/328 (40.85%), Postives = 197/328 (60.06%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIP--------TASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKS 11166
            +NV +CVD+ LNWLLNVYD+ R G+IRVLS KT I+ L  A L++KY+YLF  V ++ G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               I A+                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++ +         +A   +P++  ++   HSR+E YA+RLAE+E  N S
Sbjct:  101 VNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PEIEAAL----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQL--SHDDTHSRIEHYASRLAEMENSNGS 385          

HSP 2 Score: 87.0409 bits (214), Expect = 3.034e-16
Identity = 43/96 (44.79%), Postives = 59/96 (61.46%), Query Frame = 1
Query: 9610 YYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQK 9897
            + K H TQ T WDHP M +L +S  +LN++RFSAYRTAMKLR LQK LCLD + ++   D       H    N++ +D+ QII  L ++Y    Q+
Sbjct:    4 HLKGHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDAL---DQHNLKQNDQPMDILQIINCLTTIYDRLEQE 96          

HSP 3 Score: 72.4034 bits (176), Expect = 1.015e-11
Identity = 49/142 (34.51%), Postives = 72/142 (50.70%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +++  LE + R L AEY+RL+ Q    + +  +SP+ S                           PP         ++P SP +         P   +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct:  438 LERILADLEEENRNLQAEYDRLKQQ----HEHKGLSPLPS---------------------------PP--------EMMPTSPQS---------PRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 531          
BLAST of Dystrophin vs. Ensembl Mouse
Match: Dmd (dystrophin, muscular dystrophy [Source:MGI Symbol;Acc:MGI:94909])

HSP 1 Score: 280.411 bits (716), Expect = 1.445e-74
Identity = 134/328 (40.85%), Postives = 197/328 (60.06%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIP--------TASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKS 11166
            +NV +CVD+ LNWLLNVYD+ R G+IRVLS KT I+ L  A L++KY+YLF  V ++ G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               I A+                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++ +         +A   +P++  ++   HSR+E YA+RLAE+E  N S
Sbjct: 1816 VNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PEIEAAL----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQL--SHDDTHSRIEHYASRLAEMENSNGS 2100          

HSP 2 Score: 115.161 bits (287), Expect = 2.122e-24
Identity = 81/284 (28.52%), Postives = 132/284 (46.48%), Query Frame = 1
Query: 9028 KWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
            +W +LNL+  D+     +    L+ +     E +  L + E    +W  V ++ +  +   + + K+L   + PL E +  +     QL  + + ++       E + +R   ++   E R++QLH+                    H      S+             F+   + SV  PWER + P+  +VPYY NH TQ T WDHP M +L +S  +LN++RFSAYRTAMKLR LQK LCLD + ++   D       H    N++ +D+ QII  L ++Y
Sbjct: 1561 EWDKLNLRSADWQRKIDEALERLQELQEAADELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVNRVNDLAHQLTTLGIQLSPYNLSTLEDLNTRWRLLQVAVEDRVRQLHE-------------------AHRDFGPASQH------------FL---STSVQGPWERAISPN--KVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDAL---DQHNLKQNDQPMDILQIINCLTTIY 1805          

HSP 3 Score: 73.559 bits (179), Expect = 7.957e-12
Identity = 49/142 (34.51%), Postives = 72/142 (50.70%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +++  LE + R L AEY+RL+ Q    + +  +SP+ S                           PP         ++P SP +         P   +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct: 2153 LERILADLEEENRNLQAEYDRLKQQ----HEHKGLSPLPS---------------------------PP--------EMMPTSPQS---------PRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 2246          
BLAST of Dystrophin vs. Ensembl Mouse
Match: Dmd (dystrophin, muscular dystrophy [Source:MGI Symbol;Acc:MGI:94909])

HSP 1 Score: 281.182 bits (718), Expect = 1.518e-74
Identity = 134/328 (40.85%), Postives = 197/328 (60.06%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIP--------TASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKS 11166
            +NV +CVD+ LNWLLNVYD+ R G+IRVLS KT I+ L  A L++KY+YLF  V ++ G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               I A+                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++ +         +A   +P++  ++   HSR+E YA+RLAE+E  N S
Sbjct: 3162 VNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PEIEAAL----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQL--SHDDTHSRIEHYASRLAEMENSNGS 3446          

HSP 2 Score: 135.576 bits (340), Expect = 1.606e-30
Identity = 152/609 (24.96%), Postives = 268/609 (44.01%), Query Frame = 1
Query:  133 DKLENENTQQLVFAKWFNNKLKKLYQPSIESLINGFRSGRRFYSITNMICQNENLEIPEQLTDQQLI----STGIE--NILAKFSTTLPQSLQDKI----EELLNGDEKIILSLAWWMITEYFAKQRSLSVNAIHSDT------LFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSG-QNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVMEL---------------RERLSGTS---------QNDSQSCANEQMKITDSQ-------IANPSFESLISNFNLDFSTIIQTLDTFF-QHLE----------IAETRVKVHETFKDAKEVLE-AFKSEDDLFVQLKI------IKESVVEHEALMEKLTKHQDSIQSILMKGNAILEITSL--DNTPQLKTNINNKREIITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEETRKN--QKNFGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYXXXXXXXXXXXXXQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEER 1749
            D  E E+ Q+  F KW N +  K  +  I++L +  + G+R             L++ E LT Q+L     ST +   N + K    L ++  D +     ++++G+ K+ L L W +I  +  K    ++ A    T      L W +Q  + Y  V+V NFT+SW DG AL A++H ++  LF++ S +S++S  Q L    ++A  + G  +LL+ ++  ++   D KSI +++  L                E L  TS         Q   Q   ++Q+ ++ +Q          P F+S         +T   T   +  QHLE          + ET V +       +EVL     +ED L  Q +I      +KE    HE  M  LT HQ  + ++L  G+ ++    L  D   +++  +N    ++ ++W  L   S E Q KLH+ L  +Q   L +++  + + EE  K   ++ FG  ++ LK Q++ ++ ++  +E  +  + +L   ++                  DE     S   + ++ E+ +  +G++W  +  W   R+  LQ ILL W+HF EE    S WL E+
Sbjct:    9 DCYEREDVQKKTFTKWINAQFSKFGKQHIDNLFSDLQDGKRL------------LDLLEGLTGQKLPKEKGSTRVHALNNVNKALRVLQKNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQVKNVMKTIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTSSWSDGLALNALIHSHRPDLFDWNSVVSQHSATQRLEHAFNIAKCQLGIEKLLDPEDVATTYP-DKKSILMYITSLFQVLPQQVSIEAIQEVEMLPRTSSKVTREEHFQLHHQMHYSQQITVSLAQGYEQTSSSPKPRFKSYAFTQAAYVATSDSTQSPYPSQHLEAPRDKSLDSSLMETEVNLDSYQTALEEVLSWLLSAEDTLRAQGEISNDVEEVKEQFHAHEGFMMDLTSHQGLVGNVLQLGSQLVGKGKLSEDEEAEVQEQMN----LLNSRWECLRVASMEKQSKLHKVLMDLQNQKLKELDDWLTKTEERTKKMEEEPFGPDLEDLKCQVQQHKVLQEDLEQEQVRVNSLTHMVVVV----------------DES----SGDHATAALEEQLKVLGDRWANICRWTEDRWIVLQDILLKWQHFTEEQCLFSTWLSEK 580          

HSP 3 Score: 114.39 bits (285), Expect = 4.466e-24
Identity = 81/284 (28.52%), Postives = 132/284 (46.48%), Query Frame = 1
Query: 9028 KWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
            +W +LNL+  D+     +    L+ +     E +  L + E    +W  V ++ +  +   + + K+L   + PL E +  +     QL  + + ++       E + +R   ++   E R++QLH+                    H      S+             F+   + SV  PWER + P+  +VPYY NH TQ T WDHP M +L +S  +LN++RFSAYRTAMKLR LQK LCLD + ++   D       H    N++ +D+ QII  L ++Y
Sbjct: 2907 EWDKLNLRSADWQRKIDEALERLQELQEAADELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEIAPLKENVNRVNDLAHQLTTLGIQLSPYNLSTLEDLNTRWRLLQVAVEDRVRQLHEA-------------------HRDFGPASQH------------FL---STSVQGPWERAISPN--KVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDAL---DQHNLKQNDQPMDILQIINCLTTIY 3151          

HSP 4 Score: 73.9442 bits (180), Expect = 6.166e-12
Identity = 49/142 (34.51%), Postives = 72/142 (50.70%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +++  LE + R L AEY+RL+ Q    + +  +SP+ S                           PP         ++P SP +         P   +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct: 3499 LERILADLEEENRNLQAEYDRLKQQ----HEHKGLSPLPS---------------------------PP--------EMMPTSPQS---------PRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 3592          

HSP 5 Score: 57.7658 bits (138), Expect = 4.773e-7
Identity = 71/333 (21.32%), Postives = 158/333 (47.45%), Query Frame = 1
Query: 3814 EVNEKFENFCQFLENENQRFKDSDYHLKDVKNILSGEDKWMGKVDRVMQQSFSCDHLDVEELSENIDEIEKVVCDHSEEDFNRLEDLKYSLTNARILERSVSMEIEQIKEKSLVMKNKANKRLGSLTQLLEHIQSVERRVCQMTTWIYDTTNLLKARIVADLLGADLPDEFEILKQNFMEWEKFLLEIEDLEKGKMYQGKKETSEXXXXXXXXXXXSFRPLKELFSRYSRPADFEPRLDNLKREVNRVAEHIYXXXXXXXXXXXXXNCETHAKQFKETLIASESDLNYVYDLGKEIAERKEIEFPERFSLQLDSLKKRYYNLLDQISEAEEKL 4812
            EV   +     +LE  N+   + +  LK ++N+ +G                       EE++E ++ +E ++  HSEE+ N++  L  +LT+  +++  ++ E+E    +   +  +A ++   L Q ++  Q +E+ +  +   +      L A I   +  A +P E + ++ +    E  L E++   +G      K+ ++R+  Q    QK  + +   F  + +PA+FE RL+  K  ++ V  H+  L+  S+  E +++  +H     ++L   +S++  V   G++I ++K+ E P+    ++ +LK  Y  L  +++E +++L
Sbjct: 1265 EVWACWHELLSYLEKANKWLNEVELKLKTMENVPAGP----------------------EEITEVLESLENLM-HHSEENPNQIRLLAQTLTDGGVMDELINEELETFNSRWRELHEEAVRKQKLLEQSIQSAQEIEKSLHLIQESLEFIDKQLAAYITDKVDAAQMPQEAQKIQSDLTSHEISLEEMKKHNQG------KDANQRVLSQIDVAQKKLQDVSMKFRLFQKPANFEQRLEESKMILDEVKMHLPALETKSVEQEVIQSQLSHCVNLYKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVTERKQQL 1568          
BLAST of Dystrophin vs. Ensembl Mouse
Match: Dmd (dystrophin, muscular dystrophy [Source:MGI Symbol;Acc:MGI:94909])

HSP 1 Score: 259.996 bits (663), Expect = 4.837e-74
Identity = 119/283 (42.05%), Postives = 173/283 (61.13%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKI 11055
            +NV +CVD+ LNWLLNVYD+ R G+IRVLS KT I+ L  A L++KY+YLF  V ++ G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               I A+                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++ +
Sbjct:  101 VNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PEIEAAL----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETNL 342          

HSP 2 Score: 86.6557 bits (213), Expect = 3.467e-16
Identity = 43/96 (44.79%), Postives = 59/96 (61.46%), Query Frame = 1
Query: 9610 YYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQK 9897
            + K H TQ T WDHP M +L +S  +LN++RFSAYRTAMKLR LQK LCLD + ++   D       H    N++ +D+ QII  L ++Y    Q+
Sbjct:    4 HLKGHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDAL---DQHNLKQNDQPMDILQIINCLTTIYDRLEQE 96          

HSP 3 Score: 69.707 bits (169), Expect = 6.043e-11
Identity = 33/67 (49.25%), Postives = 48/67 (71.64%), Query Frame = 1
Query: 11797 NRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            ++ L P+     +  T+   P   +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct:  355 HKGLSPLPSPPEMMPTSPQSPRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 421          
BLAST of Dystrophin vs. UniProt/SwissProt
Match: sp|Q7YU29|DMDE_DROME (Dystrophin, isoform E OS=Drosophila melanogaster OX=7227 GN=Dys PE=1 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 6.219e-78
Identity = 138/335 (41.19%), Postives = 207/335 (61.79%), Query Frame = 1
Query: 10156 MANIPSTRTLLSTGEY---EINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVE 11151
            + +IP   T+L +      +I++ + +DLA+NW+LNVYDS R G+IRVLS K  +V+L    L+EKY+YLF LV +   + D  RL  +L DC+ +P+ L E ++FG  N++PSV SC +       +++ D      Q I                           I L +FL WL+ EPQSLVWLPVL+R+ +AE+A HQAKC +CK  PIVG RYRCL+C NFD+CQ CFF+ + +K+HK++HPM EYC  T+S E+ RD++R  +N+F+S+ + ++  ++ YLPVQ+    D ++S  P+      ++    + +HSR+E YA+RLA+VE
Sbjct:  493 LIDIPDMTTVLHSLYVTIDKIDLTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQAG--ISQEAIDGN----QDIS--------------------------IELQHFLGWLQHEPQSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDVRDFTRALKNKFKSRKYFKKHPRVGYLPVQSVLEGDALESPAPSPQHTTHQL---QNDMHSRLEMYASRLAQVE 792          

HSP 2 Score: 103.605 bits (257), Expect = 3.281e-20
Identity = 50/110 (45.45%), Postives = 70/110 (63.64%), Query Frame = 1
Query: 9550 NESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
             +SV  PWER    + + VPYY +H  + T WDHP M +L+K   +LN IRFSAYRTAMKLR++QK L LD + M+   ++F   G+   A N++L+D+  +   L SLY
Sbjct:  402 GQSVKPPWERAT--TAANVPYYIDHERETTHWDHPEMIELMKGLADLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLR--AQNDKLIDIPDMTTVLHSLY 507          

HSP 3 Score: 74.3294 bits (181), Expect = 2.889e-11
Identity = 33/45 (73.33%), Postives = 40/45 (88.89%), Query Frame = 1
Query: 11863 SEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
             +D++ EA++LRQHKGRLEARM +LE HNRQLEAQL RLRQL+DE
Sbjct:  898 GQDMMAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLLDE 942          
BLAST of Dystrophin vs. UniProt/SwissProt
Match: sp|Q9VDW3|DMDB_DROME (Dystrophin, isoform B OS=Drosophila melanogaster OX=7227 GN=Dys PE=1 SV=3)

HSP 1 Score: 289.271 bits (739), Expect = 1.092e-76
Identity = 137/336 (40.77%), Postives = 208/336 (61.90%), Query Frame = 1
Query: 10156 MANIPSTRTLLSTGEY---EINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFD-KKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVE 11151
            + +IP   T+L +      +I++ + +DLA+NW+LNVYDS R G+IRVLS K  +V+L    L+EKY+YLF LV +   + D  RL  +L DC+ +P+ L E ++FG  N++PSV SC +       +++ D  +D +                               I L +FL WL+ EPQSLVWLPVL+R+ +AE+A HQAKC +CK  PIVG RYRCL+C NFD+CQ CFF+ + +K+HK++HPM EYC  T+S E+ RD++R  +N+F+S+ + ++  ++ YLPVQ+    D ++S  P+      ++    + +HSR+E YA+RLA+VE
Sbjct: 1111 LIDIPDMTTVLHSLYVTIDKIDLTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQAG--ISQEAIDGNQDIS-------------------------------IELQHFLGWLQHEPQSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDVRDFTRALKNKFKSRKYFKKHPRVGYLPVQSVLEGDALESPAPSPQHTTHQL---QNDMHSRLEMYASRLAQVE 1410          

HSP 2 Score: 105.145 bits (261), Expect = 1.439e-20
Identity = 50/110 (45.45%), Postives = 70/110 (63.64%), Query Frame = 1
Query: 9550 NESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
             +SV  PWER    + + VPYY +H  + T WDHP M +L+K   +LN IRFSAYRTAMKLR++QK L LD + M+   ++F   G+   A N++L+D+  +   L SLY
Sbjct: 1020 GQSVKPPWERAT--TAANVPYYIDHERETTHWDHPEMIELMKGLADLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLR--AQNDKLIDIPDMTTVLHSLY 1125          

HSP 3 Score: 73.9442 bits (180), Expect = 3.765e-11
Identity = 33/45 (73.33%), Postives = 40/45 (88.89%), Query Frame = 1
Query: 11863 SEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
             +D++ EA++LRQHKGRLEARM +LE HNRQLEAQL RLRQL+DE
Sbjct: 1516 GQDMMAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLLDE 1560          
BLAST of Dystrophin vs. UniProt/SwissProt
Match: sp|Q0KI50|DMDD_DROME (Dystrophin, isoform D OS=Drosophila melanogaster OX=7227 GN=Dys PE=1 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 1.798e-76
Identity = 137/320 (42.81%), Postives = 199/320 (62.19%), Query Frame = 1
Query: 10204 EINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQI----HSRVEQYANRLAEVE 11151
            +I++ + +DLA+NW+LNVYDS R G+IRVLS K  +V+L    L+EKY+YLF LV +   + D  RL  +L DC+ +P+ L E ++FG  N++PSV SC +       +++ D      Q I                           I L +FL WL+ EPQSLVWLPVL+R+ +AE+A HQAKC +CK  PIVG RYRCL+C NFD+CQ CFF+ + +K+HK++HPM EYC  T+S E+ RD++R  +N+F+S+ + ++  ++ YLPVQ+    D ++S  P+          T HQ+    HSR+E YA+RLA+VE
Sbjct: 1315 KIDLTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQAG--ISQEAIDGN----QDIS--------------------------IELQHFLGWLQHEPQSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDVRDFTRALKNKFKSRKYFKKHPRVGYLPVQSVLEGDALESPAPSPQH-------TTHQLQNDMHSRLEMYASRLAQVE 1595          

HSP 2 Score: 105.531 bits (262), Expect = 1.275e-20
Identity = 50/110 (45.45%), Postives = 70/110 (63.64%), Query Frame = 1
Query: 9550 NESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
             +SV  PWER    + + VPYY +H  + T WDHP M +L+K   +LN IRFSAYRTAMKLR++QK L LD + M+   ++F   G+   A N++L+D+  +   L SLY
Sbjct: 1205 GQSVKPPWERAT--TAANVPYYIDHERETTHWDHPEMIELMKGLADLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLR--AQNDKLIDIPDMTTVLHSLY 1310          

HSP 3 Score: 75.0998 bits (183), Expect = 1.903e-11
Identity = 33/45 (73.33%), Postives = 40/45 (88.89%), Query Frame = 1
Query: 11863 SEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
             +D++ EA++LRQHKGRLEARM +LE HNRQLEAQL RLRQL+DE
Sbjct: 1701 GQDMMAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLLDE 1745          
BLAST of Dystrophin vs. UniProt/SwissProt
Match: sp|Q9VDW6|DMDA_DROME (Dystrophin, isoforms A/C/F/G/H OS=Drosophila melanogaster OX=7227 GN=Dys PE=1 SV=3)

HSP 1 Score: 288.886 bits (738), Expect = 4.163e-76
Identity = 137/336 (40.77%), Postives = 208/336 (61.90%), Query Frame = 1
Query: 10156 MANIPSTRTLLSTGEY---EINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFD-KKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVE 11151
            + +IP   T+L +      +I++ + +DLA+NW+LNVYDS R G+IRVLS K  +V+L    L+EKY+YLF LV +   + D  RL  +L DC+ +P+ L E ++FG  N++PSV SC +       +++ D  +D +                               I L +FL WL+ EPQSLVWLPVL+R+ +AE+A HQAKC +CK  PIVG RYRCL+C NFD+CQ CFF+ + +K+HK++HPM EYC  T+S E+ RD++R  +N+F+S+ + ++  ++ YLPVQ+    D ++S  P+      ++    + +HSR+E YA+RLA+VE
Sbjct: 2939 LIDIPDMTTVLHSLYVTIDKIDLTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQA--GISQEAIDGNQDIS-------------------------------IELQHFLGWLQHEPQSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDVRDFTRALKNKFKSRKYFKKHPRVGYLPVQSVLEGDALESPAPSPQHTTHQL---QNDMHSRLEMYASRLAQVE 3238          

HSP 2 Score: 103.99 bits (258), Expect = 3.456e-20
Identity = 50/110 (45.45%), Postives = 70/110 (63.64%), Query Frame = 1
Query: 9550 NESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
             +SV  PWER    + + VPYY +H  + T WDHP M +L+K   +LN IRFSAYRTAMKLR++QK L LD + M+   ++F   G+   A N++L+D+  +   L SLY
Sbjct: 2848 GQSVKPPWERA--TTAANVPYYIDHERETTHWDHPEMIELMKGLADLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLR--AQNDKLIDIPDMTTVLHSLY 2953          

HSP 3 Score: 77.411 bits (189), Expect = 3.793e-12
Identity = 121/638 (18.97%), Postives = 266/638 (41.69%), Query Frame = 1
Query:  142 ENENTQQLVFAKWFNNKLKKLYQPSIESLINGFRSGRRFYSITNMICQNENLEIPEQLTDQQLISTGIENILAKFSTTLPQSLQDKIEELLNGDEKIILSLAWWMITEYFAKQ--RSLSVNAIHSDTLFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVMELRERLSGTSQNDSQSCANEQMKITDSQIANPSFESL--ISNFNLDFSTIIQTLDTFFQHLEIAETRVKVHE-----TFKDAKEVLEAFKSEDDLFVQLKIIKESVV------------------EHEALMEKLTKHQDSIQSILMKGNAILEITSLDNTPQLKTNINNKRE---IITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEETRKNQKNFGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYXXXXXXXXXXXXXQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEERICTADQLLRKSNKNQFNDFVNYTESKWGRMISSLDKCGQKIKDLCENESLVVSTVDNKIDEMIQNWNDASEK 1965
            E ++ Q+  F KW N+ L       ++ L    R G R  ++ + + Q  NL+ PE+   +      +  ++ +      + +    ++++ G+ K+ L L W +  E+  +   +S S N +    L W +Q  + + G+ + +F++SW DG A L IL  +   L   ++ L +++ + L L   LA++ F   +LL+ ++  +    D KSI ++VM L   +        +   +E       ++   S   L  +   N   S  + T D+     + +   +K H      T  +A   +  ++S  +  + L +  E ++                  E+E+ M KLT+HQ+ +   L +G+ ++  +        + + N  R+   ++  +W  L   + + Q K+   L + Q   L ++   +  +E+   +  + G +++  + QL + + ++  +   ++ + +L + ++                     +   S + +D   E  ++++G +W+ +V W + R   LQ           + + IS WL+ R    +Q L+        D    T+      I+ L+ C    KDL E +  ++  +   +   +Q+ +D  E+
Sbjct:    9 ERQHIQKKTFTKWINSHLIDTQCTPVKDLFLDLRDGHRLLALLSTLTQT-NLK-PEKGRMRVHHINNLNKVITEIQQHGVKLVNISSDDIVGGNAKLTLGLIWLIALEFNGQHLVKSHSSNGVEKSLLAWARQYTEPH-GLQLNDFSSSWSDGRAFLMILDAHVEEL-NLQAALQQHALKRLHLAFDLAHRHFKIEKLLDAEDVHTHKP-DNKSIQMYVMCLYHAMESMRTRQQEQEQDEGQDQDPGRVPCTSITDLDEVPLDNDQTSLGLYTSDSAGSMEQRSSGELKTHSMRPLSTATNASVEISGYQSALEAVLTLLLEDEQLLSQNLPDPQDFQTAKLQFHENESFMLKLTEHQEYVGEALEEGSNLINESQKAGAGLSQEDQNEVRQQMVLLNERWETLRLRALDVQAKILMRLAEFQKQKLEQLRQFLTSVEDRISHMSDIGPTLEEAEKQLLEAQKLKADLSEQQELVDSLSSMVVI--------------------VNDTSGNFND--LEDRLSALGERWSHVVKWSDLRKEKLQ-----------QYKCISRWLDAR----EQDLKLMESRDVTDVGGITQR-----INELNYCA---KDLLELQRYLID-LRQMVAATLQDGDDKGER 595          

HSP 4 Score: 74.3294 bits (181), Expect = 3.860e-11
Identity = 33/45 (73.33%), Postives = 40/45 (88.89%), Query Frame = 1
Query: 11863 SEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
             +D++ EA++LRQHKGRLEARM +LE HNRQLEAQL RLRQL+DE
Sbjct: 3344 GQDMMAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLLDE 3388          

HSP 5 Score: 64.3142 bits (155), Expect = 3.273e-8
Identity = 80/377 (21.22%), Postives = 174/377 (46.15%), Query Frame = 1
Query: 3730 GQLVIEM-----QNQKLGYIEKLKQYISTDIFLEVNEKFENFCQFLENENQRFKDSDYHLKDVKNILSGEDKWMGKVDRVMQQSFSCDHLDVEELSENIDEIEKVVCDHSEEDFNRLEDLKYSLTNARILERSVSMEIEQIKEKSLVMKNKANKRLGSLTQLLEHIQSVERRVCQMTTWIYDTTNLLKARIVADLLGADLPDEFEILKQNFMEWEKFLLEIEDLEKGKMYQGKKETSEXXXXXXXXXXXSFRPLKELFSRYSR-PADFEPRLDNLKREVNRVAEHIYXXXXXXXXXXXXXNCETHAKQFKETLIASESDLNYVYDLGKEIAERKEIEFPERFSLQLDSLKKRYYNLLDQISEA----EEKLSLARPL 4830
            G+L+++M     Q+++  Y    KQ      F  +N ++    + +  +    +     L + K  +  E  ++ K++  ++ +   +  D EE+ E +D++E V+  HSEE  ++++++   L +   +  S+  +I++  ++   ++ +A KR   L Q +   +  E+ + Q   W+    ++L   +  D+   D P+EF+ L   F+  EK   EI +L       GK   + RL+ Q   ++  F+  +   S+ +     +E RL+    ++  V     ++D+ S     ++       Q   TL   +S++      G+ + E +  + P++ S ++D+LK  Y  L + ++++    E  L+LAR L
Sbjct: 1122 GELLLQMDELQDQDRESRYGSLAKQ------FTRINARWTEVTELVYAKTALLEHISTQLGEFKKFMVSETGYLDKLENKIRNTPE-NAADAEEIMEELDDLENVLRSHSEEWLDKIQEIGNELIDNEFMADSIRRDIDETVQRWTQLQQQAKKRTELLEQKVSEAEQSEKCIVQFEKWLTRVDDILSDHLDNDVTIVDQPEEFQRLAHEFVANEKNFKEISELIDEHTRNGKVGAANRLQEQLNLMEVRFKYCQAKLSKCTAIQHSYESRLNRAYTDLRNVERSTEVVDVASAGPNTVQTQYQKCLQIYRTLSEIKSEIESTIKTGRRVCEDRYTKSPKQLSQRIDALKHLYNTLGENVTQSKATLERLLTLARQL 1491          
BLAST of Dystrophin vs. UniProt/SwissProt
Match: sp|Q5GN48|DMD_PIG (Dystrophin OS=Sus scrofa OX=9823 GN=DMD PE=1 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 1.035e-73
Identity = 135/328 (41.16%), Postives = 197/328 (60.06%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIP--------TASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKS 11166
            +NV +CVD+ LNWLLNVYD+ R G+IRVLS KT IV L  A L++KY+YLF  V ++ G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               I A+                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++ +         +A   +P++  ++   HSR+E YA+RLAE+E  N S
Sbjct: 3158 VNVPLCVDMCLNWLLNVYDTGRTGRIRVLSFKTGIVSLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PEIEAAL----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQL--SHDDTHSRIEHYASRLAEMENSNGS 3442          

HSP 2 Score: 139.813 bits (351), Expect = 5.689e-31
Identity = 166/642 (25.86%), Postives = 273/642 (42.52%), Query Frame = 1
Query:  142 ENENTQQLVFAKWFNNKLKKLYQPSIESLINGFRSGRRFYSITNMICQNENLEIPEQLTDQQLI----STGIENILAKFSTTLPQSLQDKIEELLN--------GDEKIILSLAWWMITEYFAKQRSLSVNAIHSDT------LFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSG-QNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFV------------------MELRERLSGTSQNDS-----QSCANEQMKITDSQ------IANPSFESLISNFNLDFSTIIQTLDTFF-QHLE----------IAETRVKVHETFKDAKEVLE-AFKSEDDLFVQLKI------IKESVVEHEALMEKLTKHQDSIQSILMKGNAILEITSLDNTPQLKTNINNKREIITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEE-TRKNQKN-FGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYXXXXXXXXXXXXXQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEERICTADQLLRKSNKNQFNDFVNYTESKWGRMISSLDKCG 1863
            E E+ Q+  F KW N +  K  +  IE+L N  + GRR             L++ E LT Q+L     ST + + L   +  L Q LQ    +L+N        G+ K+ L L W +I  +  K    ++ A    T      L W +Q  + Y  V+V NFT SW DG AL A++H ++  LF++ S + + S  Q L    ++A  + G  +LL+ ++  ++   D KSI ++V                  +E+  R S  ++ +      Q   ++Q+ +  +Q         P F+S         +T   T   F  Q LE          + ET V +       +EVL     +ED L  Q +I      +KE    HE  M  LT HQ  I S+L  G+ ++    L    +  T +  +  ++ ++W  L   S E Q  LH+ L  +Q   L ++   + + EE TRK +K   G  ++ LKHQ++ ++ ++  +E  +  + +L   ++                  DE     S   + ++ E+ +  +G++W  +  W   R+  LQ ILL W+ F EE    S WL E+    +  L K +   F D         G M+SSL K  
Sbjct:    8 EREDVQKKTFTKWINAQFSKFGKQHIENLFNDLQDGRRL------------LDLLEGLTGQKLPKEKGSTRV-HALNNVNKAL-QVLQKNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQVKNVMKNIMAGLQQTNSEKILLSWVRQSTRNYPQVNVINFTTSWSDGLALNALIHSHRPDLFDWNSVVCQQSATQRLEHAFNIAKYQLGIEKLLDPEDVATTYP-DKKSILMYVTSLFQVLPQQVSIEAIQEVEMLPRPSKVTREEHFQLHHQMHYSQQITVCLAQGYERTPSPKPRFKSYAYTQAAYVTTSDPTRSPFPSQRLESPEDKSFGSSLLETEVNLDSYQTALEEVLSWLLSAEDTLQAQGEISNDVEEVKEQFHTHEGYMMDLTSHQGRIGSVLQLGSQLIGKGKLSEDEE--TEVQEQMNLLNSRWECLRVASVEKQSNLHKVLMDLQNQQLKELNDWLTKTEEKTRKMEKEPLGPDLEDLKHQIQQHKVLQEDLEQEQVRVNSLTHMVVVV----------------DES----SGDHATAALEEQLKVLGDRWANICRWTEDRWVLLQDILLKWQRFTEEQCLFSTWLSEK----EDALNKIHTTGFKD--------QGEMLSSLQKLA 600          

HSP 3 Score: 112.464 bits (280), Expect = 1.044e-22
Identity = 81/284 (28.52%), Postives = 131/284 (46.13%), Query Frame = 1
Query: 9028 KWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
            +W +LNL   D+     +    L+ +     E +  L + E    +W  V ++ +  +   + + K+L     PL E ++ +     QL  + + ++       E + +R   ++   E R++QLH+                    H      S+             F+   + SV  PWER + P+  +VPYY NH TQ T WDHP M +L +S  +LN++RFSAYRTAMKLR LQK LCLD + ++   D       H    N++ +D+ QII  L ++Y
Sbjct: 2903 EWEKLNLHSADWQRKIDEALERLQELQEATDELDLKLRQAEVIKGSWQPVGDLLIDSLQDHLEKVKALRGEKAPLKENVSHVNDLARQLTTLGIQLSPYNLSTLEDLNTRWKLLQVAVEDRIRQLHE-------------------AHRDFGPASQH------------FL---STSVQGPWERAISPN--KVPYYINHETQTTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACDAL---DQHNLKQNDQPMDILQIINCLTTVY 3147          

HSP 4 Score: 73.1738 bits (178), Expect = 8.938e-11
Identity = 49/142 (34.51%), Postives = 71/142 (50.00%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +++  LE + R L AEY+RL+ Q    + +  +SP+ S                           PP         ++P SP +         P   +L+ EA++LRQHKGRLEARM  LE HN+QLE+QL RLRQL+++
Sbjct: 3495 LERILADLEEENRNLQAEYDRLKQQ----HEHKGLSPLPS---------------------------PP--------EMMPTSPQS---------PRDAELIAEAKLLRQHKGRLEARMQTLEDHNKQLESQLHRLRQLLEQ 3588          

HSP 5 Score: 64.6994 bits (156), Expect = 2.868e-8
Identity = 77/333 (23.12%), Postives = 157/333 (47.15%), Query Frame = 1
Query: 3814 EVNEKFENFCQFLENENQRFKDSDYHLKDVKNILSGEDKWMGKVDRVMQQSFSCDHLDVEELSENIDEIEKVVCDHSEEDFNRLEDLKYSLTNARILERSVSMEIEQIKEKSLVMKNKANKRLGSLTQLLEHIQSVERRVCQMTTWIYDTTNLLKARIVADLLGADLPDEFEILKQNFMEWEKFLLEIEDLEKGKMYQGKKETSEXXXXXXXXXXXSFRPLKELFSRYSRPADFEPRLDNLKREVNRVAEHIYXXXXXXXXXXXXXNCETHAKQFKETLIASESDLNYVYDLGKEIAERKEIEFPERFSLQLDSLKKRYYNLLDQISEAEEKL 4812
            EV   +     +LE  N+   + ++ LK  +NI  G                       EE+SE ++ +E ++  HSE++ N++  L  +LT+  +++  ++ E+E    +   +  +A +R   L Q ++  Q +E+ +  +   +    + L   I   +  A +P E + ++ +    E  L E++     K YQG KE + R+  Q    QK  + +   F  + +PA+FE RL   K  ++ V  H+  L+I S+  E +++   H     ++L   +S++  V   G++I ++K+ E P+    ++ +LK  Y  L  +++E +++L
Sbjct: 1259 EVWACWHELLSYLEKANKWLSEVEFKLKTTENIPGG----------------------AEEISEVLESLENLM-QHSEDNPNQIRILAQTLTDGGVMDELINEELETFNSRWRELHEEAVRRQKLLEQSIQSAQEIEKSLHLIQDSLSSIDHQLAVYIADKVDAAQMPQEAQKIQSDLTSHEISLEEMK-----KHYQG-KEAAPRVLSQIELAQKKLQDVSMKFRLFQKPANFEQRLQESKMILDEVKMHLPALEIKSVEQEVVQSQLNHCVNLYKSLSEVKSEVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVTERKQQL 1562          
BLAST of Dystrophin vs. TrEMBL
Match: A0A1S8XBH6 (Zinc finger, ZZ type (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_00004 PE=4 SV=1)

HSP 1 Score: 461.84 bits (1187), Expect = 1.431e-128
Identity = 338/1116 (30.29%), Postives = 553/1116 (49.55%), Query Frame = 1
Query: 7963 KLDDTEMSLRKWMEDSEEKLNRLLS-------EGFNLK---------NQKILDDLKIVIPSWQQTMNDYQSMSYELRNSFTGENCKDLEDNLEQMNKQWSTIMNKLAQCTRELNSMRSPQE---QKSHGVELASEKPQSTAAEVNSGISIEKLSGWLSSLEGQLETM-EMGIVRWRSGSGLIATGNADKLKSKLISQLNDLYNEIDLYKTQFQ---LCSESEKN---DSEYQISKRWKIFNDKINETKQCLEGTMESGHNLLTKLRLLNDWLAHKEAD----MLELKGNVCNTFNTAQNQLLKFENFISDIEAHRNQIEEAIELAQNQIGEAIDSNKLMEQSHT-VNLESEGESDNSDTGSNGN---------VPXXXXXXXXXXXXXXXHYMKRKWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQI---PMFHESLES------------MSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNE-------RLLDVGQIIVFLASLYRAANQ--KITKRKESPNTIANDESDKLSHSILGC-ARGSSIRHSRSKDKS--HHTRSNSFGGFKG------------ENEKDDMGTKPSCIKSP-SKTIPSQAAIMKCSGMANIPSTRTLLST-------------------------GEYEINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQT 10995
            KL D E  L +W+  +E +L+ L         E F+           ++K L DL   +   ++ + +Y   +  L   F  E+   +  +LEQ+  +W    NK  Q T      R  ++   +    V L  ++  S    + S  S EKL+  L  ++ ++  + +M I   R    L  + N  + +S+LI++L  L  EI+    Q     + S  + N   DSE+    RW+   DK+   +Q ++ +    H  L +L+ +N+W+AH++A     +  L GN+       +  L    N   +IEAHR QIEE ++    Q G+        E+S T +  +SE ESD SD   +G+           DD+SKR+ RR+RR+ ++++++W+ LN  M +Y +     S  L +      +  + +         W  V  + +  I  E+ Q +S  ++  PL+  +  ++ Q  Q  + ++ ++  I  +   + +    ++ L E R++ L  Q  +S++      +PQ+   P     +E             ++ K+E P+ +    + + L ++SVS PWERC+HPSG++VPYYKNH++QDTQWDHPI++DL++S  ++N+ RF+ YRTA+KLR LQK LCLD + ++++++  +  G H+  V+E       R ++V Q+I  L  L+  AN    ++  + +P           S    G  A+ S++  +RS D    H +R       KG             N  D   T+P  I SP   ++   + +   +  A++P + T  +T                         G   + V VCVDL LNWLLNVYD  R G +R LS K A+  L+ A+LDEKY+YLFSL+ +  G +   RL A+L +C+LIP++L E    G ++   +V  CF+ V +  + +S D                                + R I + +FL WLR  P++++WLP+L+RI+ AE  VH  +CGVC+ QP+ GLRYRCLRCLNFDLCQ CFF   T+++HK+SHPMQEYC  ++S ++FRD++RI RNR RS+    Q++
Sbjct:   17 KLKDHERDLDRWLTKAEAELDLLTGSKGSGDGETFDSPRRLPLSPDSSRKRLQDLGDSLALGREKLRNYTHEAESLMTRFQSEDTSKIRKDLEQITDRWDQF-NKRLQQTVSSGIERICEDFLLESEKTVALKGQQTSSFEPRLISASSTEKLTEKLDHIDRKVNRIAQMEIDLKRQHGKLDESVNVTEQRSQLINELQALQTEINSLSAQITGGTMLSHEDVNLLPDSEFLT--RWRQLRDKVASLRQTVQTSSGQAHLFLARLKEMNNWVAHRDATFRATICPLSGNLLFILKLRETML----NLFKEIEAHRPQIEEVLQQGLVQYGD--------ERSETGLGCDSELESDASDMPVHGSSQRQDSRDSTGDDQSKRVTRRIRRYLYHLRKRWLALNSSMLEYKQKLDAVSDRLSNFQSMFNDVVEQVRSAHAVALRWMPVDCLPVDRIGTELEQAQSFYEACDPLVILLNNLDRQIVQFHDSQIALDPHIITQQAALRNDFDQVRFLTEARIRAL-SQTLVSIQTLDQRTQPQLTRSPSHRTPIEGGRYIGMDPTENFVNGKMESPVPMQA--EAVPL-SDSVSPPWERCVHPSGTQVPYYKNHASQDTQWDHPILSDLMQSMKQMNAFRFAEYRTALKLRKLQKTLCLDSLSISILAENLKHIG-HSQPVDEHNQDPFDRTINVPQMIDCLLDLFNCANGMFGLSDTQGTPAKHQAGGDWAASQQKTGASAKYSTLPSTRSSDTDALHQSRVTPTKCGKGFRRHSSTTRDQQRNSGDPASTRP-LISSPVPGSVQPTSLLTPGTRCASLPESVTFTATASPIHRTGSDKARRSTRKGKRHFLVGPTRLPVNVCVDLTLNWLLNVYDRMRKGNVRALSFKVALTTLSVANLDEKYRYLFSLIADPNGCVTEQRLYALLCECILIPRNLGEGGWIGKEDFATTVKHCFEQVAE--IARSSDSG---------------------------SHFSPRSIPVRHFLTWLRFGPKTIIWLPLLHRIMLAEQVVHNVRCGVCQRQPLTGLRYRCLRCLNFDLCQQCFFCGWTARNHKLSHPMQEYCTNSTSGDSFRDFTRIVRNRLRSRDRGGQRS 1082          
BLAST of Dystrophin vs. TrEMBL
Match: G7YU45 (Dystrophin isoforms A/C/F/G/H OS=Clonorchis sinensis OX=79923 GN=CLF_110964 PE=4 SV=1)

HSP 1 Score: 459.529 bits (1181), Expect = 8.035e-128
Identity = 331/1146 (28.88%), Postives = 549/1146 (47.91%), Query Frame = 1
Query: 7870 TVDKVDRLWNNTXXXXXXXXXXXXSIHHLKTKLDDTEMSLRKWMEDSEEKLNRLLSEGFNLKNQ----------------KILDDLKIVIPSWQQTMNDYQSMSYELRNSFTGENCKDLEDNLEQMNKQWSTIMNKLAQCTRELNSMRSPQEQKSHGVELASEKP------QSTAAEVN--SGISIEKLSGWLSSLEGQLETMEMGIVRWRSGSGLI-ATGNADKLKSKLISQLNDLYNEIDLYKTQFQ---LCSESEKN---DSEYQISKRWKIFNDKINETKQCLEGTMESGHNLLTKLRLLNDWLAHKEA----DMLELKGNVCNTFNTAQNQLLKFENFISDIEAHRNQIEEAIELAQNQIGEAIDSNKLMEQSHT-VNLESEGESDNSDTGSNGNVPXXXXXXXXXXXXXXX----------HYMKRKWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQI---PMFHESLES------------MSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNE-------RLLDVGQIIVFLASLYRAANQKITKRKESPNTIANDESDKLSHS---ILGCARGSSIRHSRSKDKS--HHTRSNSFGGFKG------------ENEKDDMGTKPSCIKSP-SKTIPSQAAIMKCSGMANIPSTRTLLST-------------------------GEYEINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSK 10974
            + + +  LW NT+D+++ R  EL  I     KL D E  L +W+  +E +L+ L S   +   Q                K L DL   +   ++ + +Y   +  L   F  E+   +  +LEQ+  +W     +L Q      ++ S  E+      L SEK       Q+++ E    S  S EKL+  L  ++ ++  +    +  +   G++  + N  + +S+LI++L  L  EI+    Q     + S  + N   DSE+    RW+   DK+   +Q ++ +    H  L +L+ +N+W+AH++A     +  L GN+       +  L    N   +IEAHR QIE+ ++    Q G+        E+S T +  +SE ESD SD   +G+     S+      +             ++++++W+ LN  M +Y +     S  L +      +  + +         W  V  + +  I  E+ Q KS  ++  PL+  +  ++ Q  Q  + ++ ++  I  +   + +    ++ L E R++ L  Q  +S++      +PQ+   P     +E             ++ K+E P+ +      +   ++SVS PWERC+HPSG++VPYYKNH++QDTQWDHPI++DL++S  ++N+ RF+ YRTA+KLR LQK LCLD + ++++++  +  G H+  ++E       R ++V Q+I  L  L+  AN            +        + S       A+ S++  +RS D    H +R       KG               +D    +P  I SP    +   + +   +  A++P + T  +T                         G   + V VCVDL LNWLLNVYD  R G +R LS K A+  L+ A+LDEKY+YLFSL+ +  G +   RL A+L +C+LIP++L E    G ++   +V  CF+ V +  + +S +                                + R I + +FL WLR  P++++WLP+L+RI+ AE  VH  +CGVC+ QP+ GLRYRCLRCLNFDLCQ CFF   T++SHK+SHPMQEYC  ++S ++FRD++RI RNR RS+
Sbjct:    7 SAENLSELWANTEDQMQRRTLELEEIIADTQKLKDHERDLDRWLTKAEAELDLLTSSKGSGGGQAFDSPRRLPLSPDTSRKRLQDLGDSLALGREKLRNYTHEAESLMTRFQSEDTSKIRKDLEQITDRWDQFNKRLKQ------TVSSGIERICEDFMLESEKTVGPKGQQTSSFEPRLISASSREKLTEKLDHIDRKVNRIAQMEIDLKRQHGMVDESVNVTEQRSQLINELQALQTEINNLSAQITGGTMLSHEDMNLLPDSEFLT--RWRQLRDKVASLRQTVQTSSGQAHLFLARLKEMNNWVAHRDAAFRATICPLSGNLLFILKLRETML----NLFKEIEAHRPQIEDVLQQGLVQYGD--------ERSETGLGCDSELESDASDMAVHGSSQRQDSRDSTGDDQSKQRVIRRIRRYLYHLRKRWLALNSSMLEYKQKLDAVSDRLSNFQSMFNDVVEQVRSAHAVALRWMPVDCLPVDRIGTELEQAKSFYEACDPLVILLNNLDRQIVQFHDSQIALDPHIITQQAALRNDFDQVRFLTEARIRAL-SQTLVSIQAIDQRTQPQLTRSPSHRTPIEGGRYTGMDDTENFVNGKMESPVPMQAESVPL---SDSVSPPWERCVHPSGTQVPYYKNHASQDTQWDHPILSDLMQSMKQMNAFRFAEYRTALKLRKLQKTLCLDSLSISILAENLKHIG-HSQPIDEHNQDPFDRTINVPQMIDCLLDLFSCANGMFGLSDSQGTPVKQQAGGDWAASQQKTGASAKYSTLPSTRSSDTDALHQSRVTPTKCGKGFRRHSSTIRDQQRTSRDPASARP-LISSPVPGGVQPTSPLTPGTRCASLPESVTFTATASPVHRTGSDRTRRSTRKGKRHFLVGPTRLPVHVCVDLTLNWLLNVYDRMRKGNVRALSFKVALTTLSVANLDEKYRYLFSLIADPNGCVTEQRLYALLCECILIPRNLGEGGWIGKEDFASTVKHCFEQVAE--IARSSESG---------------------------PHFSPRNIPVRHFLTWLRFGPKTIIWLPLLHRIMLAEQVVHNVRCGVCQRQPLTGLRYRCLRCLNFDLCQQCFFCGWTARSHKLSHPMQEYCTNSTSGDSFRDFTRIVRNRLRSR 1097          
BLAST of Dystrophin vs. TrEMBL
Match: A0A4S2M0K0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003571 PE=4 SV=1)

HSP 1 Score: 457.603 bits (1176), Expect = 1.218e-124
Identity = 337/1150 (29.30%), Postives = 560/1150 (48.70%), Query Frame = 1
Query: 7855 SDFSETVDKVDRLWNNTXXXXXXXXXXXXSIHHLKTKLDDTEMSLRKWMEDSEEKLNRLLSEGFNLKNQ----------------KILDDLKIVIPSWQQTMNDYQSMSYELRNSFTGENCKDLEDNLEQMNKQWSTIMNKLAQCTRELNSMRSPQEQKSHGVELASEKP------QSTAAEVN--SGISIEKLSGWLSSLEGQLETMEMGIVRWRSGSGLI-ATGNADKLKSKLISQLNDLYNEIDLYKTQFQ---LCSESEKN---DSEYQISKRWKIFNDKINETKQCLEGTMESGHNLLTKLRLLNDWLAHKEA----DMLELKGNVCNTFNTAQNQLLKFENFISDIEAHRNQIEEAIELAQNQIGEAIDSNKLMEQSHT-VNLESEGESDNSDTGSNGN---------VPXXXXXXXXXXXXXXXHYMKRKWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQI---PMFHESLES------------MSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNE-------RLLDVGQIIVFLASLYRAANQKITKRKESPNTIANDESDKLSHS---ILGCARGSSIRHSRSKDKS--HHTRSNSFGGFKG------------ENEKDDMGTKPSCIKSP-SKTIPSQAAIMKCSGMANIPSTRTLLS-------------------------TGEYEINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSK 10974
            ++ S   + +  LW NT+D+++ R  EL  I     KL D E    +W+  +E +L+ L     +   Q                K L DL   +   ++ +++Y   +  L   F  E+   +  +LEQ+  +W     +L Q      ++ S  E+      L SEK       Q+++ E    S  S EKL+  L  ++ ++  +    +  +   GL+  + N  + +SKL S+L  L  EI+    Q     + S  + N   DSE+    RW+   DK+   +Q ++ +    H  L +++ +N+W+AH++A     M  L GN+       +  L    N   +IE HR QIE+ ++    Q G+        E+  T +  +SE ESD SD   +G+           DD+SKR+ RR+RR+ ++++++W+ LN  M +Y +     S  L +      +  + +         W  V  + +  I  E+ Q +S  ++  PL+  +  ++ Q  Q  + ++ ++  +  +   + +    ++ L E R++ L  Q  +S++      +PQ+   P     +E             ++ K+E P+ +    + + L ++SVS PWERC+HPSG++VPYYKNH++QDTQWDHPI+++L++S  ++N+ RF+ YRTA+KLR LQK LCLD + ++++++  +  G H+  V+E       R ++V Q+I  L  L+  AN            + +      + S       A+ S++  +RS D    H +R       KG                D   T+P  I SP   ++   + +   +  A++P + T  +                          G   + V VCVDL LNWLLNVYD  R G +R LS K A+  L+ A+LDEKY+YLFSL+ +  G +   RL A+L +C+LIP++L E    G ++   +V  CF+ V +  + +S +                                + R I + +FL WLR  P++++WLP+L+RI+ AE  VH  +CGVC+ QP+ GLRYRCLRCLNFDLCQ CFF   T++SHK+SHPMQEYC  ++S ++FRD++RI RNR RS+
Sbjct: 2940 AELSSQAENLSELWANTEDQMQRRTLELEEIIADTQKLKDHEREFDRWLTKAEAELDLLTGSKGSGDGQVFGSARRLPLSPDTSRKRLQDLGDSLALGREKLSNYTREAESLMRRFQSEDTSKICKDLEQITDRWDQFNKRLQQ------TVSSGIERICEDFILESEKTLALKGQQTSSFEPRLISASSTEKLTEKLDHIDRKVNRIAQMEIDLKRQHGLLDESVNVTEQRSKLFSELQALQTEINNLSAQITGGTMLSPEDVNLLPDSEFLT--RWRQLRDKVASLRQTVQTSSGQAHLFLARIKEMNNWVAHRDAAFRATMCPLSGNLLFILKLRETML----NLFKEIEGHRPQIEDVLQQGLVQFGD--------ERGETGLGCDSELESDASDMAVHGSSQRQDSRDSTGDDQSKRVIRRIRRYLYHLRKRWLALNSNMLEYKQKLDAVSDRLSNFQSMFNDVVEQVRSAHAVALRWMPVDCLPVDRIGTELEQAQSFYEACDPLVILLNNLDRQIVQFHDSQIALDPHVITQQAALRNDFDQVRFLTEARIRAL-SQTLVSIQALDQRTQPQLTRSPSHRTPIEGGQYTGMDPTENFVNGKMESPVPVQA--EVVPL-SDSVSPPWERCVHPSGTQVPYYKNHASQDTQWDHPILSELMQSMKQMNAFRFAEYRTALKLRKLQKTLCLDSLSISILAENLKHIG-HSQPVDEHNQDPFDRTINVPQMIDCLLDLFSCANGMFGLSDTQGTPVKHHTGGDWAASQQKTGASAKYSTLPSTRSSDTDTLHQSRGTPTKCGKGFRRYSSTSRDQQRTSGDPASTRP-LISSPVPGSVQPTSLLTPGTRCASLPESVTFTANASPIHRTGSDKTRRSTRKGKRHFLVGPTRLPVHVCVDLTLNWLLNVYDRMRKGNVRALSFKVALTTLSVANLDEKYRYLFSLIADPNGCVTEQRLYALLCECILIPRNLGEGGWIGKEDFASTVKHCFEQVAE--IARSSES---------------------------ASHFSPRSIPVRHFLTWLRFGPKTIIWLPLLHRIMLAEQVVHNVRCGVCQRQPLTGLRYRCLRCLNFDLCQQCFFCGWTARSHKLSHPMQEYCTNSTSGDSFRDFTRIVRNRLRSR 4034          

HSP 2 Score: 190.274 bits (482), Expect = 1.094e-43
Identity = 200/918 (21.79%), Postives = 384/918 (41.83%), Query Frame = 1
Query: 1795 FNDFVNYTESKWGRMISSLDKCGQKIKDLCENESLVVSTVDNKIDEMIQNWNDASEKWRDSIDNWMGSDGKRRSNRASSFSDMSSENCYM--RRKMENVT-RNTPSSQSD----------------------------MNISDFPIQAGYKTKFENDAERMMSWLENSAEKLELITLE------------------------SISPEERPSITEQRKTIDLVTKEINLEKSKKNMETIKRMGLMYQEDLNKHGENTDEIEQLFEELDERWSYLENQLLKSRQKVLTVEISSQLDHETQEL-----EKCIENANKFLQNIHYNKNLIEIDKLIKCATEFREKFIEKKIFLKQFTDKYQVVKSDFSRINEEIFSKQISDLNQKVXXXXXXXXXXXXKMRNLKSIIEMNLVETENFINNLSNI---INEKLNINNFDDLEKN--SIKYMSLKNTLESHFE---LLEKISIT---DSSSRKHKILVELKKNCHNTKQRVDNRVNFLKDLSEKTAQWKSQTMEFNHWLDEVSSYLDECEQQKYDEDDLINEAIKETEAGIQDMENLIPTLENIEKSTVNLEAYFENDLRVEIFNKKKNLQLKWENLHKRYLNFMEYLKKPLFKNSSQSDPKYKTAPQKVAIIIESESRTE--DSLIDIDMEHSNFSMESLDKSSESFNDLGGVDSSGNID----REFLADIESWIRTSTEKLGNYSNIHNTEDLNIFGQLVIEMQNQ------------KLGYIEKLKQYISTDIFLEVNEKFENFCQFLENENQRFKDSDYHLKDVKNILSGEDKWMGKVDRVMQQSFSCDHLDVEELSENIDEIEKVVCDHSEEDFNRLEDLKYSLTNARILERSVSMEIEQIKEKSLVMKNKANKRLGSLTQLLEHIQSVERRVCQMTTWIYDTTNLLKA 4281
             ++++N  E +W ++++SLD+  Q +++ C +   V   V++ ++ ++  W+   E    S+D+W+  D   R     + S    +N  M  +  ++ VT  +T  ++ D                            ++    P   GY+ +FE  AE +++WLEN AE LEL+T++                        + +P E P+       I+ +++E+     ++ M+ +  MG  Y+E+L + GE+ +E++QLFEE++ERW+YL + L ++ ++V     S+Q   E  +L     E+ I +              +E+D   K +TE  E                 V+      + E++ SK                                    TE   N LS +   + E+L   N DDLE    S++ + L++ L+ H     LLEK+  T   D  S     +  LK  C + K R+ +     +DLSEK   + +Q      WL ++  YLD           +I   ++E+   ++DME L PTL+ +     +L+ YF  + +  + ++   LQ  W+ + +   +  E+L+  L   S+++                S+ R    D+L      +   S+  L     S      V +S        R  + D+E W+  + EKL  ++ +    +L     ++  + N+                +    Q +S  + L     F +    +  E +R + + Y+L+D   +++GE +W   V ++ ++  S  + D+ EL+E+++ + ++  +HS ED  RL  L  SL+ A+++   V  E+E   +K    K++ N+    L  +++  Q VE +  +  T +  T   + A
Sbjct:  791 VSNYINSHEPRWAQLLASLDRRAQAVREACGDTEEVSRLVESMVERLVNRWSQLDEP-EFSVDDWI--DRYTRDGNDLNVSPEPEQNARMMTQEDLQKVTNHSTAQAREDFERGTIPKENKRPHEDTLTLPKGSKIPCLDTVPPPSPTGYRAEFEAKAEELLNWLENCAEALELVTMDKNGNPLDAPGGQMKVSERKVNETGATAPPENPA-----NVINRISREV--ADWRETMQKVLTMGERYREELLEVGESVEELDQLFEEVEERWAYLTSLLTEAERQVRVATNSAQFHEEVSKLLSRPQEEAITSP-------------VEVDNAAKASTEAPE-----------------VITYPAESVTEQLRSK------------------------------------TEQLHNQLSRVEETLQEQLVFTNPDDLEDQLLSVRKL-LEDLLDEHSNLNVLLEKLDTTRNADLVSSTSAAINRLKSACASLKARLGH----TQDLSEKVDFFMNQLEGIEKWLADMRDYLDSVSHAVLPSPTVIQAQMQESCEALKDMETLEPTLQKVSNIATHLQGYFREEYQKLLADRLVLLQANWDEVRELTKSNREHLETLLSSKSAETP--------------GSQGRLTNLDALEQTTPVNKQLSLPELTVQPVSVTGAAAVHTSEPTHLQKLRVDVDDLELWMTEAKEKLAKFATVETQAELTAMENIIQTLNNEISERRYILAALDTHAAVSMTDQPLSDTVSLLTRAHFADLESAVAAERERLRGAKYYLEDFTTLMNGESRWFDSVSQLAERLKSETYADLSELAEDLESLNRLSEEHSAEDEERLNSLAKSLSVAKVMSYHVRTELEAYNKKLAATKDQMNRVQSDLKAIVDCGQRVEIKTQEWETLLLSTVRQVNA 1613          

HSP 3 Score: 96.6709 bits (239), Expect = 1.969e-15
Identity = 63/190 (33.16%), Postives = 92/190 (48.42%), Query Frame = 1
Query: 1219 INNKREIITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEETRKNQKN--FGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYXXXXXXXXXXXXXQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEERICTADQLLRKS 1782
            I  +  +++++WN L   +    R++   L + Q   L+ I   +++LEE R  Q    FG SI  LK+QL+ NR +E  IE  E     L  F++                 + E+ +R+         E  I  + N+W  LV WVN+RY  LQ  LL WRHFEEE   ++DWL ER   AD+  R S
Sbjct:  555 IQRQTALLSSRWNNLCRVNQTLGRRITNCLLRRQGILLVAIRLQLEKLEEERSRQAELLFGPSIRELKNQLEVNRCLEEGIEIGEVLAARLDNFIMLVPL------------HNAEETERVI------GLEAIITDLANRWGRLVDWVNTRYAKLQNALLHWRHFEEEYNVLTDWLNER---ADEASRVS 723          

HSP 4 Score: 91.6633 bits (226), Expect = 5.946e-14
Identity = 38/97 (39.18%), Postives = 59/97 (60.82%), Query Frame = 1
Query:  517 LFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVMELRE 807
            + WC  + +GY G+++ NFT+SWRDG A LAI+H  +  LF + +RL +   QNL+L  HLA  EF   RLLE  +     + D ++   +++E R+
Sbjct:  212 MAWCVAVTEGYSGINIINFTHSWRDGLAFLAIVHQSRPDLFTYGTRLERTVNQNLSLAFHLATAEFATPRLLEPIDMHPEQV-DARATATYILEFRK 307          

HSP 5 Score: 70.4774 bits (171), Expect = 1.371e-7
Identity = 83/361 (22.99%), Postives = 149/361 (41.27%), Query Frame = 1
Query: 5575 ILQQVSMEIKDHIHSFILFCQNNLGSGISLTG-------------SASKSITTLNDLKFKINCIKETITEIFKEQRFYIDHRLREL--SAYADT-SEQLEELDKIQRYWLESIGKLNKRIGRLADINKRIEEVEATLKEYEVQPSEKLRTKALRFVTQLEEELSVNLQKDRLRLTSCGRLGTQDTNISKSNSNNSVTQLLNQDMLTTHDNYRESLKTVRE-QLKEIGRRLNSVRIYIDDSRRGCLSKLSERIQDIDDKLADCSHMLAEVQYIMASG-------------------IEHQNTDSIN---------LNFLIEAQKKRLGKYQNEYQTHLNKWMENASRWQEFIEKLEKLQTDL 6522
            +L+Q++ EIKDH  S +LF +  LG+   L                 S  +TT+ + K  +        +   +Q+ ++  RLREL  +A  D    +L++L  +Q  W E+  KL++R   +A + +++   E  L EY    S   R+K +  +++LEE     L  D   L+             K+ S+   T    +D +     + E+L    E QL+ + + LN+ ++ +   +RG +  L   ++  +++   C       Q + A+G                   ++  + D  +         L  L+EAQK R   Y + +  H N W   A +W  F   L  L+  L
Sbjct: 1951 MLRQLAREIKDHFKSVVLFYRYCLGTNAPLPSVREEEMEVNSHISKGSDYVTTVAERKAVVQVFFRFSNKYLCQQKTHLGDRLRELIVNAGGDGIGYRLQDLLSLQNVWHETNDKLDRRGEHMATLEQQLNAAEQALSEYMACCSTAQRSKCISLLSRLEETYGWKLTADHEMLS------------QKTLSDAYFTDRSKKDKI-----WDENLVNKYEAQLRTLAQLLNASQLDLALIKRGSIVDLGAILKRSENRFIQC------CQAVEATGQTLDQLKKTYNPVENTQIPMDRADPDCTSILKGDDLMWLKILLEAQKNRFDDYSSHFSFHKNVWQHRADQWDAFCSCLNNLKAVL 2288          
BLAST of Dystrophin vs. TrEMBL
Match: A0A419Q6S8 (Dystrophin OS=Clonorchis sinensis OX=79923 GN=Dys PE=4 SV=1)

HSP 1 Score: 436.802 bits (1122), Expect = 1.249e-120
Identity = 326/1131 (28.82%), Postives = 533/1131 (47.13%), Query Frame = 1
Query: 7870 TVDKVDRLWNNTXXXXXXXXXXXXSIHHLKTKLDDTEMSLRKWMEDSEEKLNRLLSEGFNLKNQ----------------KILDDLKIVIPSWQQTMNDYQSMSYELRNSFTGENCKDLEDNLEQMNKQWSTIMNKLAQCTRELNSMRSPQEQKSHGVELASEKPQSTAAEVNSGISIEKLSGWLSSLEGQLETMEMGIVRWRSGSGLIATGNADKLKSKLISQLNDLYNEIDLYKTQFQLCSESEKNDSEYQISKRWKIFNDKINETKQCLEGTMESGHNLLTKLRLLNDWLAHKEA----DMLELKGNVCNTFNTAQNQLLKFENFISDIEAHRNQIEEAIELAQNQIGEAIDSNKLMEQSHT-VNLESEGESDNSDTGSNGNVPXXXXXXXXXXXXXXX----------HYMKRKWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQI---PMFHESLES------------MSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNE-------RLLDVGQIIVFLASLYRAANQKITKRKESPNTIANDESDKLSHS---ILGCARGSSIRHSRSKDKS--HHTRSNSFGGFKG------------ENEKDDMGTKPSCIKSP-SKTIPSQAAIMKCSGMANIPSTRTLLST-------------------------GEYEINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSK 10974
            + + +  LW NT+D+++ R  EL  I     KL D E  L +W+  +E +L+ L S   +   Q                K L DL   +   ++ + +Y   +  L   F  E+   +  +LEQ+  +W     +L Q      ++ S  E+      L SEK      +  S      +S   SS E   E ++                + D+ K   I+Q+     EIDL K Q  +  ES  N +E    +R ++ N+ +    Q ++ +    H  L +L+ +N+W+AH++A     +  L GN+       +  L    N   +IEAHR QIE+ ++    Q G+        E+S T +  +SE ESD SD   +G+     S+      +             ++++++W+ LN  M +Y +     S  L +      +  + +         W  V  + +  I  E+ Q KS  ++  PL+  +  ++ Q  Q  + ++ ++  I  +   + +    ++ L E R++ L  Q  +S++      +PQ+   P     +E             ++ K+E P+ +      +   ++SVS PWERC+HPSG++VPYYKNH++QDTQWDHPI++DL++S  ++N+ RF+ YRTA+KLR LQK LCLD + ++++++  +  G H+  ++E       R ++V Q+I  L  L+  AN            +        + S       A+ S++  +RS D    H +R       KG               +D    +P  I SP    +   + +   +  A++P + T  +T                         G   + V VCVDL LNWLLNVYD  R G +R LS K A+  L+ A+LDEKY+YLFSL+ +  G +   RL A+L +C+LIP++L E    G ++   +V  CF+ V +  + +S +                                + R I + +FL WLR  P++++WLP+L+RI+ AE  VH  +CGVC+ QP+ GLRYRCLRCLNFDLCQ CFF   T++SHK+SHPMQEYC  ++S ++FRD++RI RNR RS+
Sbjct:    7 SAENLSELWANTEDQMQRRTLELEEIIADTQKLKDHERDLDRWLTKAEAELDLLTSSKGSGGGQAFDSPRRLPLSPDTSRKRLQDLGDSLALGREKLRNYTHEAESLMTRFQSEDTSKIRKDLEQITDRWDQFNKRLKQ------TVSSGIERICEDFMLESEKTFGPKGQQTSSFEPRLISA--SSREKLTEKLD----------------HIDR-KVNRIAQM-----EIDL-KRQHGMVDES-VNVTE----QRSQLINE-LQVLLQTVQTSSGQAHLFLARLKEMNNWVAHRDAAFRATICPLSGNLLFILKLRETML----NLFKEIEAHRPQIEDVLQQGLVQYGD--------ERSETGLGCDSELESDASDMAVHGSSQRQDSRDSTGDDQSKQRVIRRIRRYLYHLRKRWLALNSSMLEYKQKLDAVSDRLSNFQSMFNDVVEQVRSAHAVALRWMPVDCLPVDRIGTELEQAKSFYEACDPLVILLNNLDRQIVQFHDSQIALDPHIITQQAALRNDFDQVRFLTEARIRAL-SQTLVSIQAIDQRTQPQLTRSPSHRTPIEGGRYTGMDPTENFVNGKMESPVPMQAESVPL---SDSVSPPWERCVHPSGTQVPYYKNHASQDTQWDHPILSDLMQSMKQMNAFRFAEYRTALKLRKLQKTLCLDSLSISILAENLKHIG-HSQPIDEHNQDPFDRTINVPQMIDCLLDLFSCANGMFGLSDSQGTPVKQQAGGDWAASQQKTGASAKYSTLPSTRSSDTDALHQSRVTPTKCGKGFRRHSSTIRDQQRTSRDPASARP-LISSPVPGGVQPTSPLTPGTRCASLPESVTFTATASPVHRTGSDRTRRSTRKGKRHFLVGPTRLPVHVCVDLTLNWLLNVYDRMRKGNVRALSFKVALTTLSVANLDEKYRYLFSLIADPNGCVTEQRLYALLCECILIPRNLGEGGWIGKEDFASTVKHCFEQVAE--IARSSESG---------------------------PHFSPRNIPVRHFLTWLRFGPKTIIWLPLLHRIMLAEQVVHNVRCGVCQRQPLTGLRYRCLRCLNFDLCQQCFFCGWTARSHKLSHPMQEYCTNSTSGDSFRDFTRIVRNRLRSR 1053          
BLAST of Dystrophin vs. TrEMBL
Match: A0A5J4NUS3 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0007747 PE=4 SV=1)

HSP 1 Score: 436.032 bits (1120), Expect = 2.906e-119
Identity = 355/1311 (27.08%), Postives = 624/1311 (47.60%), Query Frame = 1
Query: 7561 VQSTIQDNKKEAILTNDEFHLSDSQITQMTQENINQIALLLKSINTFMVNSKVNLGQI---EEIENCLDHIRI-------------------------FHNRLEEHRNILQSI-LEKKSVY---SSQIPDSDFSETVDKVDRLWNNTXXXXXXXXXXXXSIHHLKTKLDDTEMSLRKWMEDSEEKLNRL-----LSEGFNLK-----------NQKILDDLKIVIPSWQQTMNDYQSMSYELRNSFTGENCKDLEDNLEQMNKQWSTIMNKLAQCTRELNSMRS-----------PQEQKSHGVELASEKPQSTAAEVNSGI-SIEKLSGWLSSLEGQLETMEMGIVRWRSGSGLIATGNADKL-----KSKLISQLNDLYNEIDLYKTQFQLCSESEKND----SEYQISKRWKIFNDKINETKQCLEGTMESGHNLLTKLRLLNDWLAHKE----ADMLELKGNVCNTFNTAQNQLLKFENFISDIEAHRNQIEEAIELAQNQIGEAIDSNKLMEQSHTVNLESEGESDNSDTG----------SNGNVPXXXXXXXXXXXXXXXHYMKRKWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDN-------WSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQ--QETLSLKQTSNNE--------EPQI-PMFHES--LESMSRKIEMPLGLSENRKFIELEN-----------------------ESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVN-------ERLLDVGQIIVFLASLYRAAN---------------------------QKITKRKESPNTIANDESDKLSHSILGCARGSSIRHSRSKDKSHHTRSNSFGGFK---GENEKDDMGTKPS-CIKSPSKTIPSQAAIMKCSGMANIPSTRTLLST---------GEYEINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSK 10974
            V S  ++   E +++ +    +   +T++  E I+Q+A  L ++  F V+S+V LG     + +   L H+++                         F   LE  +  L  I +EK  +    S ++ +++F++  +K+  LW   +  + +R  EL +I      L + +  + +WM  +E  L+ L      S    L+           N+K L +L+  +P  +  +  Y+  S  L + F  E+   L+ +L++M  +W+ +  +L Q ++ L++  S           P+  +SH      + P +T  ++   + ++EK    +  LE  L+   +               +A ++     +++++ +L  L +EI++  +   +  +    D     + +   RW+   D++   +Q ++ +       L +L+ LN+W++H++    A +  L GN+    N     L      + + +AHR QIE+A++  +   G+  D  +  + +  +  +SE +SD S+ G          S G   D++S+R+ RR+RR+ +++K++W  LN  M    EY +K    L+SV  ++     L ++    + N       W  V  + +  +  E+ Q +S  ++ +PL+  +  ++ Q +Q    +V I+  +  +   + +   +I+   EMR++ + Q    T  ++Q   ++         PQ  P+ H S  L S++ +   P  +  NR   +  +                       +SVS PWERC+HPSG++VPYYKNHSTQDT WDHPI+ +L++S  +LN +RF+ YRTA+KLR LQK LC+D + ++++++  +  G H+  +        +R+++V Q+I  L  L+  +N                           QK +        +  D+     +S + C +G   RHS +   SH    +     +       K  + + PS    + S ++P   AI   S +    ++R   S+         G  +  V VCVDL LNWLLNVYD  R G IR LS K A+ IL  A+LDEKY+YLFSL+ ++ G +   RL+A+L +C LIP++L E    G ++   +V  CF  V +     S   +  +  R+  S                        I + +FL WLR  P +L+WLP+L+R++ AE  VH  +CGVC+ QP+ GLRYRCLRCLNFDLCQ CFF  +T++SHK++HPMQEYC  ++S ++FRD++RI RNRFRS+
Sbjct:  431 VHSLPRNTTSEDVISVNVTQTTSPTVTRIRHE-IDQLARWLTAVTEFAVHSRVKLGDRFDQDTVNRQLLHVKLATSEGSRTDISQLYHPAALQLKIQQFLTELEARKPQLDRISIEKDRMTTWDSEEVLNAEFTKQAEKLPVLWETAEKHMTKRATELENIIAETQSLQELQREVDRWMTKAEGTLDGLGCFKHSSGDLTLESSRRLPISPEMNRKRLQELQQSLPEGRDKLAIYRRESELLMSRFHSEDTSKLQADLDRMTDRWNGLNVRLQQASKLLHTEASYDDLAGPETERPRLSQSHRTPSFEQSPSATKDKLPERLEAVEKKVNRIVQLESDLQRQCL-------------LNDAPRVTVSDQRAQMLLELQALQSEINILSSLISVSVKPSNPDLSTLPDNEFLSRWRQLRDRVAALRQSMQTSPSHSSLFLARLKQLNNWVSHQDAAFRATVCPLTGNLLFILNLRDMVL----TLLKENDAHRAQIEDALQQGRLHYGDGDDDEERPDAN--ITGDSEFDSDGSELGQRPVGTRTDSSPGR--DEQSRRVVRRIRRYLYHLKKRWFNLNASM---LEYRQK----LESVSERLSNFQSLFNDAVDQVRNAHAVTLRWMPVDCLPIERLESELEQAQSFYEASEPLVVLLNNLDRQIAQFHESRVTIDPTVLTQQAALRNSFEHIRLQTEMRIRTVDQALASTQLMEQAQPSQAQPLLATLPPQTAPIRHPSHRLSSVAVQFSRPELVETNRTGNQSTSHMQAQSPSTPQQRQQQQTPVPLIDSVSPPWERCVHPSGTQVPYYKNHSTQDTHWDHPILYELLQSMKQLNEVRFAEYRTALKLRKLQKTLCVDALSISILAENLKHIG-HSQPLEGPSMDPFDRMINVPQMIDCLIQLFNRSNAIYGRDSRSGQEDGRNNLDMIDSSKKSQKCSTLPPGTKPLNVDDFHHQRNSPIKCGKGFR-RHSSTTRVSHMLAESGDLNIRRRLPTPSKSGVTSSPSLSFGNRSSSLPESVAITATSPVHQSTNSRGRRSSTKVKRRFLIGPAKHPVNVCVDLTLNWLLNVYDRMRQGHIRALSFKVALTILAVANLDEKYRYLFSLIADSNGCVTEQRLSALLYECTLIPQNLGEGGWIGKEDFTTTVKLCFGQVQE-IARGSEAYEGGSPYRVGQS------------------------IPVRHFLTWLRFGPTALMWLPLLHRVMLAEQVVHNVRCGVCQRQPLSGLRYRCLRCLNFDLCQQCFFSGRTARSHKLTHPMQEYCTNSTSGDSFRDFTRIVRNRFRSR 1685          
BLAST of Dystrophin vs. Ensembl Cavefish
Match: dmd (dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1])

HSP 1 Score: 266.544 bits (680), Expect = 7.058e-76
Identity = 131/335 (39.10%), Postives = 196/335 (58.51%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKI----------PTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNIIVK 11181
            +NV +CVD+ LNWLLNVYD+ R GKIR LS KT I+ L  A L++KY++LF  V +  G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               + AS                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++ +          P AS  +P++  ++   HSR+E YAN L  V   +  +++++
Sbjct:   98 VNVPLCVDMCLNWLLNVYDTGRTGKIRTLSFKTGIISLCKAHLEDKYRFLFRQVASATGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PELEASV----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMQYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTILEGDNMETPVTLINFWPVDHPPAS--SPQL--SHDDTHSRIEHYANILGLVHGRDDEHLLIQ 387          

HSP 2 Score: 92.8189 bits (229), Expect = 3.046e-18
Identity = 45/94 (47.87%), Postives = 62/94 (65.96%), Query Frame = 1
Query: 9616 KNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQK 9897
            ++H TQ T WDHP MA+L +S  +LN++RFSAYRTAMKLR LQK LCLD + M+   + F    VH    NE+ +D+ Q+I  L ++Y    Q+
Sbjct:    3 RHHQTQTTCWDHPKMAELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLGMSAACEAFE---VHNLKQNEQFIDIMQMINCLTNIYDRLEQQ 93          

HSP 3 Score: 73.559 bits (179), Expect = 3.506e-12
Identity = 49/142 (34.51%), Postives = 73/142 (51.41%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +V+  LE + R+L AEY+RL+      + +  +SP+ S                           PP         ++P+SP +         P   +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct:  420 LERVLGDLEQENRKLQAEYDRLK----KAHEHKGLSPLPS---------------------------PP--------QMLPVSPQS---------PRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLKRLRQLLEQ 513          
BLAST of Dystrophin vs. Ensembl Cavefish
Match: dmd (dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1])

HSP 1 Score: 275.404 bits (703), Expect = 7.677e-76
Identity = 136/331 (41.09%), Postives = 199/331 (60.12%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNIIVKSGNVEP 11199
            +NV +CVD+ LNWLLNVYD+ R GKIR LS KT I+ L  A L++KY++LF  V +  G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               + AS                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++  P +S   P++  ++   HSR+E YA+RLAE+E  N S +   + N+ P
Sbjct:  434 VNVPLCVDMCLNWLLNVYDTGRTGKIRTLSFKTGIISLCKAHLEDKYRFLFRQVASATGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PELEASV----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMQYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTILEGDNMET--PASS---PQL--SHDDTHSRIEHYASRLAEMENRNGSYM---TENISP 713          

HSP 2 Score: 111.694 bits (278), Expect = 1.178e-23
Identity = 80/290 (27.59%), Postives = 135/290 (46.55%), Query Frame = 1
Query: 9028 KWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQK 9897
            +W EL +   D+ +  +     L  +     + +  L + E   D+W  V ++ +  + ++M   K+  + + P+ E +  + T  S  ++  + ++ +     + + +R   ++   E  L  L +                    H  L   S+             F++    SV  P+ER + P+   VPYY NH TQ T WDHP MA+L +S  +LN++RFSAYRTAMKLR LQK LCLD + M+   + F    VH    NE+ +D+ Q+I  L ++Y    Q+
Sbjct:  179 QWRELGIAAVDWQQQLELALERLMELQDAQDQLDFKLQQAEMIKDSWDPVGDILIDNLSKQMDTVKAFQEEIAPIQEYVNQVNTLASTFRSPGIQLSHDNLNRIDDLNTRWRLLQISIEGYLTHLTEA-------------------HRDLGPHSQN------------FLQ---ASVQSPFERSVSPNN--VPYYINHQTQTTCWDHPKMAELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLGMSAACEAFE---VHNLKQNEQFIDIMQMINCLTNIYDRLEQQ 429          

HSP 3 Score: 73.559 bits (179), Expect = 4.943e-12
Identity = 49/144 (34.03%), Postives = 73/144 (50.69%), Query Frame = 1
Query: 11566 SSLNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
              L +V+  LE + R+L AEY+RL+      + +  +SP+ S                           PP         ++P+SP +         P   +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct:  756 GELERVLGDLEQENRKLQAEYDRLK----KAHEHKGLSPLPS---------------------------PP--------QMLPVSPQS---------PRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLKRLRQLLEQ 851          
BLAST of Dystrophin vs. Ensembl Cavefish
Match: dmd (dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1])

HSP 1 Score: 275.789 bits (704), Expect = 1.157e-74
Identity = 136/331 (41.09%), Postives = 199/331 (60.12%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNIIVKSGNVEP 11199
            +NV +CVD+ LNWLLNVYD+ R GKIR LS KT I+ L  A L++KY++LF  V +  G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               + AS                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++  P +S   P++  ++   HSR+E YA+RLAE+E  N S +   + N+ P
Sbjct:  689 VNVPLCVDMCLNWLLNVYDTGRTGKIRTLSFKTGIISLCKAHLEDKYRFLFRQVASATGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PELEASV----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMQYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTILEGDNMET--PASS---PQL--SHDDTHSRIEHYASRLAEMENRNGSYM---TENISP 968          

HSP 2 Score: 110.538 bits (275), Expect = 3.135e-23
Identity = 80/290 (27.59%), Postives = 135/290 (46.55%), Query Frame = 1
Query: 9028 KWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQK 9897
            +W EL +   D+ +  +     L  +     + +  L + E   D+W  V ++ +  + ++M   K+  + + P+ E +  + T  S  ++  + ++ +     + + +R   ++   E  L  L +                    H  L   S+             F++    SV  P+ER + P+   VPYY NH TQ T WDHP MA+L +S  +LN++RFSAYRTAMKLR LQK LCLD + M+   + F    VH    NE+ +D+ Q+I  L ++Y    Q+
Sbjct:  434 QWRELGIAAVDWQQQLELALERLMELQDAQDQLDFKLQQAEMIKDSWDPVGDILIDNLSKQMDTVKAFQEEIAPIQEYVNQVNTLASTFRSPGIQLSHDNLNRIDDLNTRWRLLQISIEGYLTHLTEA-------------------HRDLGPHSQN------------FLQ---ASVQSPFERSVSPNN--VPYYINHQTQTTCWDHPKMAELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLGMSAACEAFE---VHNLKQNEQFIDIMQMINCLTNIYDRLEQQ 684          

HSP 3 Score: 73.9442 bits (180), Expect = 4.499e-12
Identity = 49/142 (34.51%), Postives = 73/142 (51.41%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +V+  LE + R+L AEY+RL+      + +  +SP+ S                           PP         ++P+SP +         P   +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct: 1013 LERVLGDLEQENRKLQAEYDRLK----KAHEHKGLSPLPS---------------------------PP--------QMLPVSPQS---------PRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLKRLRQLLEQ 1106          
BLAST of Dystrophin vs. Ensembl Cavefish
Match: utrn (utrophin [Source:ZFIN;Acc:ZDB-GENE-070228-6])

HSP 1 Score: 259.225 bits (661), Expect = 4.314e-73
Identity = 130/310 (41.94%), Postives = 190/310 (61.29%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANR 11136
            +NV +CVD+ LNWLLNVYD+ R+GKIRVLS+K  ++ L+   L+EKYK LF+ V +     D  +L  +L D + IP+ L E ++FG  N++PSV SCF++V +K VE                                        +    F+ W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PIVG RYR L+  N+D+CQ+CFF  +T+K HK+++PM EYC  T+S E+ RD++++ +N+FRSK +  +  +L YLPVQ     D ++    T S+ +P+    +   HSR+EQYA+R
Sbjct:  115 VNVPLCVDMCLNWLLNVYDTGRSGKIRVLSMKIGLLSLSKGHLEEKYKCLFNQVASVGETCDQRQLGLLLHDAIQIPRQLGEVAAFGGSNIEPSVRSCFQHVTNK-VE----------------------------------------LGPGQFVDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLNYPMVEYCTPTTSGEDMRDFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNME----TLSQ-SPQF--PHDDTHSRIEQYASR 376          

HSP 2 Score: 80.1073 bits (196), Expect = 3.305e-14
Identity = 42/91 (46.15%), Postives = 55/91 (60.44%), Query Frame = 1
Query: 9625 STQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQK 9897
             TQ T WDHP M +L +S  +LN +RFSAYRTAMK+R LQK LCLD +D+N+    F+    H    N   L V ++I  L S+Y    Q+
Sbjct:   23 GTQTTCWDHPKMTELYQSLADLNHVRFSAYRTAMKIRRLQKALCLDLLDLNVAQSMFQ---QHKLNNNSSPLSVPEVINCLTSVYDDLEQE 110          

HSP 3 Score: 68.9366 bits (167), Expect = 9.443e-11
Identity = 31/45 (68.89%), Postives = 38/45 (84.44%), Query Frame = 1
Query: 11857 PPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLI 11991
            P   DL+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+
Sbjct:  445 PDEADLLAEAKLLRQHKGRLEARMQILEDHNKQLESQLYRLRQLL 489          
BLAST of Dystrophin vs. Ensembl Cavefish
Match: dmd (dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1])

HSP 1 Score: 269.24 bits (687), Expect = 1.545e-72
Identity = 130/325 (40.00%), Postives = 194/325 (59.69%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNIIVK 11181
            +NV +CVD+ LNWLLNVYD+ R GKIR LS KT I+ L  A L++KY++LF  V +  G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K               + AS                             FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++  P +S   P++  ++   HSR+E YAN L  V   +  +++++
Sbjct:  689 VNVPLCVDMCLNWLLNVYDTGRTGKIRTLSFKTGIISLCKAHLEDKYRFLFRQVASATGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK-------------PELEASV----------------------------FLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMQYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTILEGDNMET--PASS---PQL--SHDDTHSRIEHYANILGLVHGRDDEHLLIQ 965          

HSP 2 Score: 110.538 bits (275), Expect = 3.079e-23
Identity = 80/290 (27.59%), Postives = 135/290 (46.55%), Query Frame = 1
Query: 9028 KWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQK 9897
            +W EL +   D+ +  +     L  +     + +  L + E   D+W  V ++ +  + ++M   K+  + + P+ E +  + T  S  ++  + ++ +     + + +R   ++   E  L  L +                    H  L   S+             F++    SV  P+ER + P+   VPYY NH TQ T WDHP MA+L +S  +LN++RFSAYRTAMKLR LQK LCLD + M+   + F    VH    NE+ +D+ Q+I  L ++Y    Q+
Sbjct:  434 QWRELGIAAVDWQQQLELALERLMELQDAQDQLDFKLQQAEMIKDSWDPVGDILIDNLSKQMDTVKAFQEEIAPIQEYVNQVNTLASTFRSPGIQLSHDNLNRIDDLNTRWRLLQISIEGYLTHLTEA-------------------HRDLGPHSQN------------FLQ---ASVQSPFERSVSPNN--VPYYINHQTQTTCWDHPKMAELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLGMSAACEAFE---VHNLKQNEQFIDIMQMINCLTNIYDRLEQQ 684          

HSP 3 Score: 73.9442 bits (180), Expect = 4.440e-12
Identity = 49/142 (34.51%), Postives = 73/142 (51.41%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +V+  LE + R+L AEY+RL+      + +  +SP+ S                           PP         ++P+SP +         P   +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct:  998 LERVLGDLEQENRKLQAEYDRLK----KAHEHKGLSPLPS---------------------------PP--------QMLPVSPQS---------PRDAELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLKRLRQLLEQ 1091          
BLAST of Dystrophin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002801.1 (pep scaffold:Pmarinus_7.0:GL476499:231780:258689:1 gene:ENSPMAG00000002555.1 transcript:ENSPMAT00000002801.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.853 bits (551), Expect = 1.045e-62
Identity = 106/238 (44.54%), Postives = 144/238 (60.50%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSS 10920
            +N+ +CVD+ LNWLLNVYD+ R GKIR LS KT +V L+NA L++KY++LF  V +  G  D  RL  +L D V IP+ L E +SFG  N++PSV SCF+  + +               I A+                             FL W+R+EPQS+VWLPVL+R+ ++E+A HQAKC +CK  PIVG RYR L+  N+D+CQ+CFF  +T+K HK+S+PM EYC   SS
Sbjct:  101 VNLPLCVDMCLNWLLNVYDTGRGGKIRELSFKTGLVSLSNAHLEDKYRFLFKQVASVSGLCDQRRLGLMLHDAVQIPRQLGEVASFGGSNIEPSVRSCFQFANGR-------------PEIEATM----------------------------FLEWMRMEPQSMVWLPVLHRVAASETAKHQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLSYPMVEYCTPVSS 297          

HSP 2 Score: 91.2781 bits (225), Expect = 1.919e-19
Identity = 43/92 (46.74%), Postives = 62/92 (67.39%), Query Frame = 1
Query: 9622 HSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQK 9897
            H TQ T WDHP M +L +S  +LN++RFSAYRTAMKLR LQK LCLD V ++ +++ F   G+     N+RL+DV + +  L ++Y+   +K
Sbjct:    8 HQTQTTFWDHPRMTELYQSLSDLNNVRFSAYRTAMKLRRLQKALCLDLVSLDALTNVFEQSGLKQ---NDRLMDVSEAVGCLTTIYQGLERK 96          
BLAST of Dystrophin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004878.1 (pep scaffold:Pmarinus_7.0:GL480232:9823:26212:1 gene:ENSPMAG00000004410.1 transcript:ENSPMAT00000004878.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.527 bits (519), Expect = 2.032e-58
Identity = 101/243 (41.56%), Postives = 139/243 (57.20%), Query Frame = 1
Query: 10195 GEYEINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYK-YLFSLVCN-NQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTS 10917
            G+  +   +C D+ALNWLLNVYD +R GKIR LSLK  ++ L+ A L+EKYK Y+F  V     G  D  +L  +L + + IP+ L E +SFG  N++PSV SCFK  + +                                           + +  FL W++LEPQSLVWLPVL+R+ ++E+A HQAKC +CK  PIVG RYR L+  N+D+CQ+CFF  +T+K HK+ +PM EYC   S
Sbjct:  101 GQRLVAAPLCTDMALNWLLNVYDPSRTGKIRSLSLKVGLICLSKAPLEEKYKLYIFRQVSGPGGGGCDQRQLGLLLQEAIQIPRQLGEVASFGGSNIEPSVRSCFKFANSR-----------------------------------------DMVEVGRFLEWMKLEPQSLVWLPVLHRVAASETAKHQAKCNICKECPIVGFRYRSLKHFNYDICQSCFFSGRTAKGHKLHYPMVEYCTPVS 302          

HSP 2 Score: 75.485 bits (184), Expect = 3.080e-14
Identity = 41/93 (44.09%), Postives = 55/93 (59.14%), Query Frame = 1
Query: 9607 PYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDF--VDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
            P+  +H TQ T WDHP MA L +S  +LNS+RFSAYRTAMKLR LQK LC      +M+ +          + + +ERL+   ++   LA LY
Sbjct:    1 PFPCSHQTQSTSWDHPKMAALYQSLADLNSVRFSAYRTAMKLRRLQKALCRTRHQPEMSTIPMGLDCHDEQSMSPHERLVGATEVGRLLAELY 93          
BLAST of Dystrophin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010595.1 (pep scaffold:Pmarinus_7.0:GL477281:35182:38646:-1 gene:ENSPMAG00000009594.1 transcript:ENSPMAT00000010595.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 3.846e-26
Identity = 73/232 (31.47%), Postives = 104/232 (44.83%), Query Frame = 1
Query: 10228 DLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDC-----VLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCN 10908
            +L LN LL + DS R+GK+   S+  A+++L+   L  KY+    +VC    ++  P   AI   C       +   L E  +FG   +  +V S F  V       S+     +                                  S FL W   EPQ  +WLP + R++ A  ++H+AKC +CK  PIVGLR+RCLRC N DLCQ CF   + +  H  SHP+ E C 
Sbjct:   91 ELTLNLLLAICDSERSGKVSPRSMWNALLLLSTGQLTHKYRG--GVVCLCFARI-LPHCNAIGIPCNNIYASQLLALLGEGCAFGTAEM--AVTSLFHAV-------SYHSDIPSITE-------------------------------SQFLGWCLSEPQLFLWLPAMYRMMKAAGSIHEAKCNICKTCPIVGLRFRCLRCWNLDLCQNCFLTGRDTGWHAPSHPVIESCT 279          
BLAST of Dystrophin vs. Ensembl Sea Lamprey
Match: dtnba (dystrobrevin, beta a [Source:ZFIN;Acc:ZDB-GENE-030131-3967])

HSP 1 Score: 102.449 bits (254), Expect = 7.718e-22
Identity = 60/241 (24.90%), Postives = 110/241 (45.64%), Query Frame = 1
Query: 10201 YEINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEP--QSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTS 10917
            ++I+V   ++L LN++L  Y+    GK+ V  +K A+  +    + +K +Y+FS + ++ G +   +    L + + +P  + E  SFG    + +  SCF +   K                                           + L+ FL  L  +P  Q L+WLP+++R+ + E+  H  +C  C  + ++G RYRC +C ++ LCQ CF+  + S +H   H M+EY +  S
Sbjct:  100 HQIHVEQSINLLLNFMLAAYNGEGCGKMTVFGVKVALATMCGGKVVDKLRYIFSQISDSNGVMVLNKFDQYLHEVLKLPTAVFEGPSFGY--TEQAARSCFPHQQKK-------------------------------------------VTLNVFLDALMSDPPPQILIWLPLMHRLANVENVFHPVECSFCHSESMLGFRYRCQQCHSYQLCQDCFWRGQASSTHSNQHQMKEYTSWKS 295          
BLAST of Dystrophin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001271.1 (pep scaffold:Pmarinus_7.0:GL501301:6854:105266:-1 gene:ENSPMAG00000001126.1 transcript:ENSPMAT00000001271.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 2.376e-19
Identity = 163/860 (18.95%), Postives = 358/860 (41.63%), Query Frame = 1
Query: 1039 FKSEDDLFVQLKIIKESVVEHEALMEKLTKHQDSIQSILMKGNAILEITSL--DNTPQLKTNINNKREIITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEE-TRK-NQKNFGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYXXXXXXXXXXXXXQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEERICTADQLLRKSNKNQFNDFVNYTE--------SKWGRMISSLDKCGQKIKDLCENESLVVSTVDNKIDEMIQNWNDASEKWRDSIDNWMGSDGKRRSNRASSFSDMS--------------SENCYMRRKMENVTRNTPSSQSDMNISDFPIQAGYKTKFENDAERMMSWLENSAEKLELITLESISPE-----ERPSITEQRKTIDLVTKEINLEKSKKNMETIKRMGLMYQEDLNKHGENTDEIEQLFEELDERWSYLENQLLKSRQKVLTVE-ISSQLDHETQELEKCIENANKFLQNIHYNKNLIEIDKLIKCATEFREKFIEKKIFLKQFTDKYQVVKSDFSRINEEIFSKQISD------------LNQKVXXXXXXXXXXXXKMRN-LKSIIEMNLVET----ENFINNLSNIINE-KLNINNFDDLEKN--SIKYMSL-----KNTLESHFELLEKIS--ITDSSSRKHKILVE-LKKNCHNTKQRVDNRVNFLKDLSEKTAQWKSQTMEFNHWLDEVSSYLDECEQQKYDEDDLINEAIKETEAGIQDMENLIPTLENIEKSTVNLEAYFENDLRVEIFNKKKNLQLKWENLHKRYLNFMEYLKKPLFKN 3438
             + + D+   ++ +KE    HE  M +LT HQ S+ ++L  GN +L    L  D   +++  +N    ++ ++W  L   S + Q +LH  L  +Q   L ++   + + EE  RK +    G  +D +K Q++++++++  +E  +  + +L   ++                  DE     S   + ++ E  + S+G +W  +  W   R+  LQ+ L+ W+ F EE      WL E+     ++   + K+Q     N  +        S     +S L   GQ +     NE+     ++ K+DE  Q W++  +K    ++          S   SS + ++               E   ++   E      P+ +  ++            +F+ + + + SW+  +   L        SPE     +   +++ ++ ++ V +E   E+ KK +  I        + +++ G  T+E++++  EL  RW  L  +LL  R+  L  + +    + + +  E+ +  A   LQ    +            A   R +  E    L+   +K + +K +  R+  +  S ++ D            LN++    +  +E ++ +++  L S+      ET    + F+ +    + +   ++ + + ++K    +K +S      +++L+S   + E++S      ++RKH+  +E + +       ++  R+   +DLS K  ++K++      W+DEV  +L E E+    + D + + + +  A + D+  L P+L +I+    +L+   E  L   I  +   +  +W+ + K+     + L + L + 
Sbjct:   32 LQGQPDISADVEEVKEQFHAHEGFMLELTSHQSSVGNVLHAGNQLLAEGKLGEDEESEVREQMN----LLNSRWESLRVASMDRQSRLHEVLMALQQRQLTELADWLSRTEERIRKLDTHPIGPELDSVKAQIEEHKSLQSDLEQEQVRVNSLTHMVVVV----------------DEN----SGENATAALEAQLQSLGERWAAVCRWTEDRWRLLQESLVRWQQFTEEQVLFDAWLTEKEDALSKVQTGNFKDQAEMVANVRKLAILKEDMSMKRPALSKLSILGQALVTAMGNET-TARDIEKKLDEFAQRWDNLVQK----LEGHSKLVSHTVSQTQSSVTQLTVLETVTVISSSSSSREQVLVKHGREEHVLAPPTKKPFLDPE-------LHKRFDTEVQELNSWISRAETTLN-------SPEFSTFKKSGDVSDLQEKVNGVERE-KAERQKK-LHDIPNTAQTLADQMSQDGVPTEEVQRVLNELSTRWEAL-LRLLGDRKAWLVYQGLVLDFERDARTAERGLAGAEALLQQGPGDTG---------DAAHLRHRIGE----LQSELEKVRGMKGEVERLGVQASSLKLRDGALAFLDAEFVQLNKRYAQVMSELEAKKGQLQTALDSLPPPQYAETLAALKAFLQDAGTRLGQIPASLGDLEVMDKRLKELKGLSAAQRERQSSLDSARVMAEELSRRSRPDAARKHRAELEPIVERWSKLSTQLPERMQRAEDLSAKLGKFKAECQALRKWMDEVDVFLRE-ERPALGDTDTLEKQLDQCGALVSDINTLQPSLRSIQDLGQSLKGQAEAPLATSIQAELSAISSRWDTVCKQARAQKQVLTEALART 831          
BLAST of Dystrophin vs. Ensembl Nematostella
Match: EDO41097 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5C8])

HSP 1 Score: 260.381 bits (664), Expect = 1.063e-71
Identity = 136/378 (35.98%), Postives = 206/378 (54.50%), Query Frame = 1
Query: 10186 LSTGEYEINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQ-QTKLSYLPVQN---GSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNIIVKSGNVEPKYEPLLLSQDFNGDYKERNKDDEEHKIIFQHTETLR 11307
            +  G   +N A+ +DL LNWLLNVYDS R GKIR+LS K  +V L  A LD+KY YLF LV +N G++D  +L  +L D + +P+ L E ++FG  N++PSV SCF+   +K      ++ D T                                    F+ WL  EPQS+VWLP L+R+ ++E+  H+AKC +CK  PIVG R+RCL+C N+DLCQ+CF+  + S  H+++HP+ +YC  T+S E+ +D+  + RN+F+++ + +    KL YLP+Q    G N +   S  P          + N+++H+R+  +ANRLAE E           G   PK  P+                DEEH++I Q+ ++L+
Sbjct:  417 IEVGFDNVNPAINIDLTLNWLLNVYDSGRVGKIRLLSFKIGLVCLCRAHLDDKYNYLFKLVADNDGKMDHKQLGLLLHDSLQVPRQLGEIAAFGGSNIEPSVRSCFEKAREK------ERIDPT-----------------------------------QFVYWLSAEPQSIVWLPTLHRLAASEAVKHKAKCSICKEYPIVGFRFRCLKCFNYDLCQSCFWSGRISHEHRLTHPVHQYCLSTTSGEDVKDFLSMVRNKFKARKYKKNPPKKLGYLPIQTVMEGGNLEAPPSMTPQQ--------NVNNEVHNRLGMFANRLAEAES--------DGGKYSPK--PM----------------DEEHQLIAQYCQSLK 719          

HSP 2 Score: 103.219 bits (256), Expect = 1.374e-21
Identity = 103/433 (23.79%), Postives = 192/433 (44.34%), Query Frame = 1
Query: 8581 ISKRWKIFNDKINETKQCLEGTMESGHNLLTKLRLLNDWLAHKEADMLELKGNVCNTFNTAQNQLLKFENFISDIEAHRNQIEEAIELAQNQIGEAIDSNKLMEQSHTVNLESEGESDNSDTGSNGNVPXXXXXXXXXXXXXXXHYMKRKWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY 9879
            ++ RW+  N +  + +  LE T      LL  L+ + +W++  + ++   +  +      AQNQ  + + F   +   R  ++ A++             + M+     +  +E  +D  DT   G V  +   +L          +  +W  L  +  ++ +   +     + +  Q++E +  L+E E     W+ V ++ +  + ++M + K L+Q      ++IAA++    Q+ N +  +       S  + +RI  +      R KQL     L + Q  N           +L+     ++           I+    SV  PWER +  + ++VPYY NH T+ TQWDHP M +L     ELN I++SAYRTAMKLR +QK   LD V +N +S  F    + + A N+ L+ V +++  L +++
Sbjct:   43 MNDRWQSLNVRTIDIRDRLEETATEWRQLLMDLQEILEWISRADEEITS-QQPIGGDLEAAQNQNEQHQAFKGKVNVRRLVVDRALD----------SGRRFMD-----DYRAERTADTEDTTPRGRVAGNLQHQL--------EVVSDRWSALCQRSEEWQKQVDEALRRFQLLQSQMEEIDARLTEAEVARAGWTPVQDLVIESLNEQMEELK-LLQ------DRIAALQHMFEQMSNTEGDLRRRGINISANLQNRIDQLYR----RWKQLQ----LQMIQRQN-----------ALQDAYADVDT--------GSIQALAASVDPPWERAV--AVNKVPYYINHKTETTQWDHPKMTELYHQIAELNDIKYSAYRTAMKLRCIQKATKLDLVTLNNLSSAFVQHNL-SKARNDALIGVAEMVDTLHTVF 414          

HSP 3 Score: 72.4034 bits (176), Expect = 3.860e-12
Identity = 33/43 (76.74%), Postives = 40/43 (93.02%), Query Frame = 1
Query: 11869 DLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            +L+TEA++LRQHKGRLEARM +LE HNRQLEAQL RLRQL+D+
Sbjct:  791 ELLTEAKLLRQHKGRLEARMQVLEDHNRQLEAQLQRLRQLLDQ 833          
BLAST of Dystrophin vs. Ensembl Nematostella
Match: EDO45067 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTQ0])

HSP 1 Score: 218.009 bits (554), Expect = 1.096e-62
Identity = 99/256 (38.67%), Postives = 149/256 (58.20%), Query Frame = 1
Query: 10207 INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSK 10974
            I++ +  DL LN +LN+YD  R G I+ LSLK  I +L  A L +KY+YLF  +CN++  LD  RLT  L +C+ IPK++ ES+ F   +V+P+V +CF+ V   +        +   Q+ ++                              F+ W+  EPQ++VWLP L+R+  +E+  H+AKC +CK+ PIVG RYRCL+C NFDLCQ CF+  + SK HK+ HP QEYC   S +E+ +D++++ RN+   K
Sbjct:   96 IDIPMASDLTLNLMLNIYDPGRTGYIQALSLKIGISLLCAAKLQDKYRYLFRQMCNSRAVLDRKRLTLFLQECLQIPKYIYESTIFSGTSVEPAVKNCFETVSFTYT------LEVELQKFKS------------------------------FMEWMVAEPQTIVWLPTLHRLAVSETVKHEAKCNICKMYPIVGFRYRCLKCFNFDLCQGCFWAGRVSKGHKIGHPTQEYCLAPSQKEDIKDFAKVMRNKVSKK 315          

HSP 2 Score: 64.3142 bits (155), Expect = 3.673e-10
Identity = 28/58 (48.28%), Postives = 41/58 (70.69%), Query Frame = 1
Query: 9622 HSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTF 9795
            H T+ TQWDHP M  L++   ELN+I+++AYRTAMKLRA+ K   L  V++ +++ T 
Sbjct:    1 HETEKTQWDHPAMIQLMQDLAELNNIKYAAYRTAMKLRAIHKKTQLYLVEIPILTATL 58          
BLAST of Dystrophin vs. Ensembl Nematostella
Match: EDO41099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5D1])

HSP 1 Score: 132.88 bits (333), Expect = 1.688e-31
Identity = 114/546 (20.88%), Postives = 235/546 (43.04%), Query Frame = 1
Query:  142 ENENTQQLVFAKWFNNKLKKLYQ-PSIESLINGFRSGRRFYSITNMICQNENLEIPEQLTDQQLIS-TGIENILAKFSTTLPQSLQDKIEELLNGDEKIILSLAWWMITEY---FAKQRSLSVNAIHSDTLF-WCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVMELRERLS----GTSQNDSQSCANEQMKITDSQIANPSFESLISNFNLDFSTIIQTLDTFFQHLEIAETRVKVHETFKDAKEVLEAFKSEDDLFVQLKIIKESVVEHEALMEKLTKHQDSIQSILMKGNAILEITSLDNTPQLKTNINNKREIITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEETRKNQKNFGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYXXXXXXXXXXXXXQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEER 1749
            E+E TQ+  F KW N +L +      +  L N  + G    ++  ++   +   I  +  + +L     + N +        + +     ++++G+ K+ L L W +I  +   FA Q  +       + L  WCQ   KGY+GVSVTNFT SWRDG A  A++H Y+  LF +++ +  +   N      +A    G   LL+ ++       D KSI ++V  L  +LS    G              ++T            + +    FS      D+     +  +   ++ E     +E      ++ D+   + ++K+   +HE  M +LT HQ S+  +L  GN ++    +  T + +  I ++   +  +W  L   S E Q  LH  L  +Q   + ++   +D+ E+     +  G+ ++ ++ Q++ ++  +  +E  ++ + +L   ++                 +D   + ++     +  E+ +  +G +W+ +  W   R++ LQ++L  W+ + +E + ++ WL E+
Sbjct:    3 EHEGTQKKTFTKWINIQLSRAGNNVRVGDLFNDLKDGTILIALLEVLTGKK---IKRERGNMRLHHLNNVNNAMMILEENDIRLINISNNDIVDGNHKMTLGLIWSVIAHFQLNFALQFLMDEEGTPEEVLLSWCQNTTKGYKGVSVTNFTTSWRDGLAFNAVIHRYRPDLFSYDALVGSSPMSNCEHAFKVARDSLGVDSLLDAEDVVRDRP-DKKSIIMYVTMLCHKLSPLKMGADNGGHGVTVTRNGRVTQQTTTMEMTTRHVRDSVGSFSE--SNRDSMADR-DWEDYNAQLQEVLTWLREAETKLSNQADISTDVDVVKDQFHDHEDFMMELTSHQASVGGVLEFGNQLISEGVV--TEKEENEIRDQMISLNERWESLRITSMERQTSLHEQLMSLQQRQIDQLAEWLDKAEKIIDGAEELGSDMEAVRQQVEQHKKFQENLEQQQQKVNSLTHMVVVV---------------EDNAAENVT-----ADLEEQLAVLGERWSGVCRWTEMRWSILQEVLSNWQEYRDEEKRLAAWLMEK 519          
BLAST of Dystrophin vs. Ensembl Nematostella
Match: EDO47831 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKW6])

HSP 1 Score: 124.405 bits (311), Expect = 1.435e-28
Identity = 81/273 (29.67%), Postives = 122/273 (44.69%), Query Frame = 1
Query: 10201 YEINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWL--RLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLP 11013
            + ++V   + L  NWLL  YDS   G+IRVLS+KTA+  +    L +K +Y FS + +N G L+ P+  A L + + +P  + E+ +FG      S+               F K      R R                           +L +FL  +  +  P    WL  L ++ +A    HQ  C VCK +P+VG RY+CL C N+ LCQ CF+  K S+ HK  H M+EY     S  N  +     R++F   S  +++  L   P
Sbjct:   76 HNVDVERSISLVTNWLLYAYDSDAIGRIRVLSVKTALSSMCYGRLVDKLRYHFSQIEDNNGMLNFPKFEAYLRELLQLPASVGEAPTFGFTEDVASI---------------FFKPQGPLDRQRT--------------------------QLVHFLECVMNKEPPPPYAWLSTLQKMNNAAKTEHQVACQVCKNKPVVGFRYKCLHCYNYVLCQDCFWRGKVSQHHKTDHDMREY-----STWNAGEKGSSLRSKFLCGSGKKKRPSLPDFP 302          
BLAST of Dystrophin vs. Ensembl Nematostella
Match: EDO42431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C0])

HSP 1 Score: 87.8113 bits (216), Expect = 1.051e-16
Identity = 60/225 (26.67%), Postives = 104/225 (46.22%), Query Frame = 1
Query:  142 ENENTQQLVFAKWFNNKLKKLYQPSIESLINGFRSGRRFYSITNMICQNENLEIPEQLTDQQLISTGIENILAKFSTTLPQSLQDK---IEELLNGDEKIILSLAWWMITEYFAKQRSLSVNAIHSDT-----LFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFV 792
            E E  Q+  F KW N+ L+++    +  L +  + GR+   +  ++   E L  P   +  ++    +EN+         Q +  +     ++++G++KI L L W +I  +  +  ++        +     L WCQ    GY  V++TNFT SWRDG A  AI+H ++  L EFE     ++ QNL     +A  + G   LL+ ++       D KSI  +V
Sbjct:   21 ERERVQKKTFTKWINSHLQRV-GARVNELYHDLQDGRKLILLLEVLS-GEKLPKP---SKGRMRIHNLENVEKSLVFLKKQRVHLENVGAHDIVDGNQKITLGLIWTIILRFQIQDITIEGETTEKRSAKDALLLWCQSKTVGYVHVTITNFTTSWRDGLAFNAIIHRHRPDLIEFEKLTKADAEQNLEQAFEVAETQLGITPLLDAEDVNVDFP-DEKSILTYV 239          
BLAST of Dystrophin vs. Ensembl Medaka
Match: dmd (dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1])

HSP 1 Score: 273.863 bits (699), Expect = 1.591e-78
Identity = 147/384 (38.28%), Postives = 220/384 (57.29%), Query Frame = 1
Query: 10129 QAAIMKCSGMANIPSTRTLLSTGEYE---------INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQ-----LNKSNIIVKSGNVEPKYEPLLLSQDFNG 11238
            Q A+ +   + ++P   + LS G Y+         +NV +CVD+ LNWLLNVYD+ R+GKIR LS KT IV L  A L++KY++LF  V +  G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K      D                                       + FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++  P +S   P++  ++   H+R+E YA+RLAE+E      LN S    +S  ++ +YE L  + D  G
Sbjct:   67 QQALKQNEQLLDVPQLLSCLS-GLYQRLEQSHAHLVNVPLCVDMCLNWLLNVYDTGRSGKIRTLSFKTGIVSLCKAHLEDKYRFLFRQVASATGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK---PELDA--------------------------------------AMFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMQYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTILEGDNMET--PGSS---PQL--SHDDTHTRIEHYASRLAEMENRNGSYLNDSVSPNESMKLQAEYERLKRAHDRKG 401          

HSP 2 Score: 93.5893 bits (231), Expect = 1.962e-18
Identity = 47/93 (50.54%), Postives = 61/93 (65.59%), Query Frame = 1
Query: 9616 KNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQ 9894
            +NH TQ T WDHP MA+L +S  +LN++RFSAYRTAMKLR LQK LCLD + M    + F    +     NE+LLDV Q++  L+ LY+   Q
Sbjct:    6 RNHQTQTTCWDHPRMAELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSMQAACELFEQQALKQ---NEQLLDVPQLLSCLSGLYQRLEQ 95          

HSP 3 Score: 71.633 bits (174), Expect = 1.164e-11
Identity = 34/64 (53.12%), Postives = 48/64 (75.00%), Query Frame = 1
Query: 11806 LVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            ++PMSP ++ D          +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct:  411 MLPMSPQSTRD---------AELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 465          
BLAST of Dystrophin vs. Ensembl Medaka
Match: dmd (dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1])

HSP 1 Score: 273.092 bits (697), Expect = 5.736e-78
Identity = 140/357 (39.22%), Postives = 209/357 (58.54%), Query Frame = 1
Query: 10129 QAAIMKCSGMANIPSTRTLLSTGEYE---------INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNI 11172
            Q A+ +   + ++P   + LS G Y+         +NV +CVD+ LNWLLNVYD+ R+GKIR LS KT IV L  A L++KY++LF  V +  G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K      D                                       + FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++  P +S   P++  ++   H+R+E YA+RLAE+E  N S +
Sbjct:   67 QQALKQNEQLLDVPQLLSCLS-GLYQRLEQSHAHLVNVPLCVDMCLNWLLNVYDTGRSGKIRTLSFKTGIVSLCKAHLEDKYRFLFRQVASATGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK---PELDA--------------------------------------AMFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMQYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTILEGDNMET--PGSS---PQL--SHDDTHTRIEHYASRLAEMENRNGSYL 374          

HSP 2 Score: 93.9745 bits (232), Expect = 1.495e-18
Identity = 47/93 (50.54%), Postives = 61/93 (65.59%), Query Frame = 1
Query: 9616 KNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQ 9894
            +NH TQ T WDHP MA+L +S  +LN++RFSAYRTAMKLR LQK LCLD + M    + F    +     NE+LLDV Q++  L+ LY+   Q
Sbjct:    6 RNHQTQTTCWDHPRMAELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSMQAACELFEQQALKQ---NEQLLDVPQLLSCLSGLYQRLEQ 95          

HSP 3 Score: 75.8702 bits (185), Expect = 7.018e-13
Identity = 51/142 (35.92%), Postives = 73/142 (51.41%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +V+  LE + R+L AEYERL+      +    +SP+ S                           PP         ++PMSP ++ D          +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct:  425 LERVLGDLEQENRKLQAEYERLK----RAHDRKGLSPLPS---------------------------PP--------EMLPMSPQSTRD---------AELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 518          
BLAST of Dystrophin vs. Ensembl Medaka
Match: dmd (dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1])

HSP 1 Score: 273.478 bits (698), Expect = 8.805e-78
Identity = 140/357 (39.22%), Postives = 209/357 (58.54%), Query Frame = 1
Query: 10129 QAAIMKCSGMANIPSTRTLLSTGEYE---------INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNI 11172
            Q A+ +   + ++P   + LS G Y+         +NV +CVD+ LNWLLNVYD+ R+GKIR LS KT IV L  A L++KY++LF  V +  G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K      D                                       + FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++  P +S   P++  ++   H+R+E YA+RLAE+E  N S +
Sbjct:   67 QQALKQNEQLLDVPQLLSCLS-GLYQRLEQSHAHLVNVPLCVDMCLNWLLNVYDTGRSGKIRTLSFKTGIVSLCKAHLEDKYRFLFRQVASATGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK---PELDA--------------------------------------AMFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMQYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTILEGDNMET--PGSS---PQL--SHDDTHTRIEHYASRLAEMENRNGSYL 374          

HSP 2 Score: 93.9745 bits (232), Expect = 1.681e-18
Identity = 47/93 (50.54%), Postives = 61/93 (65.59%), Query Frame = 1
Query: 9616 KNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQ 9894
            +NH TQ T WDHP MA+L +S  +LN++RFSAYRTAMKLR LQK LCLD + M    + F    +     NE+LLDV Q++  L+ LY+   Q
Sbjct:    6 RNHQTQTTCWDHPRMAELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSMQAACELFEQQALKQ---NEQLLDVPQLLSCLSGLYQRLEQ 95          

HSP 3 Score: 75.8702 bits (185), Expect = 7.134e-13
Identity = 51/142 (35.92%), Postives = 73/142 (51.41%), Query Frame = 1
Query: 11572 LNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            L +V+  LE + R+L AEYERL+      +    +SP+ S                           PP         ++PMSP ++ D          +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct:  425 LERVLGDLEQENRKLQAEYERLK----RAHDRKGLSPLPS---------------------------PP--------EMLPMSPQSTRD---------AELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 518          
BLAST of Dystrophin vs. Ensembl Medaka
Match: dmd (dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1])

HSP 1 Score: 272.322 bits (695), Expect = 1.245e-77
Identity = 140/357 (39.22%), Postives = 209/357 (58.54%), Query Frame = 1
Query: 10129 QAAIMKCSGMANIPSTRTLLSTGEYE---------INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNI 11172
            Q A+ +   + ++P   + LS G Y+         +NV +CVD+ LNWLLNVYD+ R+GKIR LS KT IV L  A L++KY++LF  V +  G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K      D                                       + FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++  P +S   P++  ++   H+R+E YA+RLAE+E  N S +
Sbjct:   67 QQALKQNEQLLDVPQLLSCLS-GLYQRLEQSHAHLVNVPLCVDMCLNWLLNVYDTGRSGKIRTLSFKTGIVSLCKAHLEDKYRFLFRQVASATGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK---PELDA--------------------------------------AMFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMQYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTILEGDNMET--PGSS---PQL--SHDDTHTRIEHYASRLAEMENRNGSYL 374          

HSP 2 Score: 93.9745 bits (232), Expect = 1.409e-18
Identity = 47/93 (50.54%), Postives = 61/93 (65.59%), Query Frame = 1
Query: 9616 KNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQ 9894
            +NH TQ T WDHP MA+L +S  +LN++RFSAYRTAMKLR LQK LCLD + M    + F    +     NE+LLDV Q++  L+ LY+   Q
Sbjct:    6 RNHQTQTTCWDHPRMAELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSMQAACELFEQQALKQ---NEQLLDVPQLLSCLSGLYQRLEQ 95          

HSP 3 Score: 75.8702 bits (185), Expect = 6.582e-13
Identity = 51/144 (35.42%), Postives = 73/144 (50.69%), Query Frame = 1
Query: 11566 SSLNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
              L +V+  LE + R+L AEYERL+      +    +SP+ S                           PP         ++PMSP ++ D          +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct:  423 GELERVLGDLEQENRKLQAEYERLK----RAHDRKGLSPLPS---------------------------PP--------EMLPMSPQSTRD---------AELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 518          
BLAST of Dystrophin vs. Ensembl Medaka
Match: dmd (dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1])

HSP 1 Score: 265.003 bits (676), Expect = 8.222e-76
Identity = 138/358 (38.55%), Postives = 209/358 (58.38%), Query Frame = 1
Query: 10129 QAAIMKCSGMANIPSTRTLLSTGEYE---------INVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANR--LAEVEQLNKSN 11169
            Q A+ +   + ++P   + LS G Y+         +NV +CVD+ LNWLLNVYD+ R+GKIR LS KT IV L  A L++KY++LF  V +  G  D  RL  +L D + IP+ L E +SFG  N++PSV SCF+  ++K      D                                       + FL W+RLEPQS+VWLPVL+R+ +AE+A HQAKC +CK  PI+G RYR L+  N+D+CQ+CFF  + +K HK+ +PM EYC  T+S E+ RD++++ +N+FR+K +  +  ++ YLPVQ     D +++  P +S   P++  ++   H+R+E YA+R   AE E+L +++
Sbjct:   67 QQALKQNEQLLDVPQLLSCLS-GLYQRLEQSHAHLVNVPLCVDMCLNWLLNVYDTGRSGKIRTLSFKTGIVSLCKAHLEDKYRFLFRQVASATGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNIEPSVRSCFQFANNK---PELDA--------------------------------------AMFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMQYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRMGYLPVQTILEGDNMET--PGSS---PQL--SHDDTHTRIEHYASRKLQAEYERLKRAH 375          

HSP 2 Score: 88.5817 bits (218), Expect = 6.009e-17
Identity = 47/94 (50.00%), Postives = 61/94 (64.89%), Query Frame = 1
Query: 9613 YKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQ 9894
            +K H TQ T WDHP MA+L +S  +LN++RFSAYRTAMKLR LQK LCLD + M    + F    +     NE+LLDV Q++  L+ LY+   Q
Sbjct:    6 HKGH-TQTTCWDHPRMAELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSMQAACELFEQQALKQ---NEQLLDVPQLLSCLSGLYQRLEQ 95          

HSP 3 Score: 71.633 bits (174), Expect = 1.068e-11
Identity = 34/64 (53.12%), Postives = 48/64 (75.00%), Query Frame = 1
Query: 11806 LVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDE 11997
            ++PMSP ++ D          +L+ EA++LRQHKGRLEARM +LE HN+QLE+QL RLRQL+++
Sbjct:  389 MLPMSPQSTRD---------AELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQ 443          
BLAST of Dystrophin vs. Planmine SMEST
Match: SMESG000020523.1 (SMESG000020523.1)

HSP 1 Score: 8166.22 bits (21188), Expect = 0.000e+0
Identity = 4187/4195 (99.81%), Postives = 4187/4195 (99.81%), Query Frame = 1
Query:  130 MDKLENENTQQLVFAKWFNNKLKKLYQPSIESLINGFRSGRRFYSITNMICQNENLEIPEQLTDQQLISTGIENILAKFSTTLPQSLQDKIEELLNGDEKIILSLAWWMITEYFAKQRSLSVNAIHSDTLFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVMELRERLSGTSQNDSQSCANEQMKITDSQIANPSFESLISNFNLDFSTIIQTLDTFFQHLEIAETRVKVHETFKDAKEVLEAFKSEDDLFVQLKIIKESVVEHEALMEKLTKHQDSIQSILMKGNAILEITSLDNTPQLKTNINNKREIITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEETRKNQKNFGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYXXXXXXXXXXXXXQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEERICTADQLLRKSNKNQFNDFVNYTESKWGRMISSLDKCGQKIKDLCENESLVVSTVDNKIDEMIQNWNDASEKWRDSIDNWMGSDGKRRSNRASSFSDMSSENCYMRRKMENVTRNTPSSQSDMNISDFPIQAGYKTKFENDAERMMSWLENSAEKLELITLESISPEERPSITEQRKTIDLVTKEINLEKSKKNMETIKRMGLMYQEDLNKHGENTDEIEQLFEELDERWSYLENQLLKSRQKVLTVEISSQLDHETQELEKCIENANKFLQNIHYNKNLIEIDKLIKCATEFREKFIEKKIFLKQFTDKYQVVKSDFSRINEEIFSKQISDLNQKVXXXXXXXXXXXXKMRNLKSIIEMNLVETENFINNLSNIINEKLNINNFDDLEKNSIKYMSLKNTLESHFELLEKISITDSSSRKHKILVELKKNCHNTKQRVDNRVNFLKDLSEKTAQWKSQTMEFNHWLDEVSSYLDECEQQKYDEDDLINEAIKETEAGIQDMENLIPTLENIEKSTVNLEAYFENDLRVEIFNKKKNLQLKWENLHKRYLNFMEYLKKPLFKNSSQSDPKYKTAPQKVAIIIESESRTEDSLIDIDMEHSNFSMESLDKSSESFNDLGGVDSSGNIDREFLADIESWIRTSTEKLGNYSNIHNTEDLNIFGQLVIEMQNQKLGYIEKLKQYISTDIFLEVNEKFENFCQFLENENQRFKDSDYHLKDVKNILSGEDKWMGKVDRVMQQSFSCDHLDVEELSENIDEIEKVVCDHSEEDFNRLEDLKYSLTNARILERSVSMEIEQIKEKSLVMKNKANKRLGSLTQLLEHIQSVERRVCQMTTWIYDTTNLLKARIVADLLGADLPDEFEILKQNFMEWEKFLLEIEDLEKGKMYQGKKETSEXXXXXXXXXXXSFRPLKELFSRYSRPADFEPRLDNLKREVNRVAEHIYXXXXXXXXXXXXXNCETHAKQFKETLIASESDLNYVYDLGKEIAERKEIEFPERFSLQLDSLKKRYYNLLDQISEAEEKLSLARPLVVEIYEKQQLIDEILEKSEQDEKDFINFNSNFVHDLLELAEKLKCYTDFENSELVRDMFDELKEKCDLFMKKIEEATNKHNFVTNLDQLQNDADKLLMEIDQMDFSDKNKLEGKLDSLYIKTNQIKQAATQIVSSDETFKSQGEMNKYSILENKIEKIFTAISEHKATNGHMAIEDQCTSDSIEVEETILSNSASSLQNEIDSNLLKSRENSFGDSLSSPYSVEDVSNAENIVSELAYSVQAAKIEKNILQQVSMEIKDHIHSFILFCQNNLGSGISLTGSASKSITTLNDLKFKINCIKETITEIFKEQRFYIDHRLRELSAYADTSEQLEELDKIQRYWLESIGKLNKRIGRLADINKRIEEVEATLKEYEVQPSEKLRTKALRFVTQLEEELSVNLQKDRLRLTSCGRLGTQDTNISKSNSNNSVTQLLNQDMLTTHDNYRESLKTVREQLKEIGRRLNSVRIYIDDSRRGCLSKLSERIQDIDDKLADCSHMLAEVQYIMASGIEHQNTDSINLNFLIEAQKKRLGKYQNEYQTHLNKWMENASRWQEFIEKLEKLQTDLQAIEQDLISFENGISFNDQEMTEIKKSLSFFEKKLVSLEQDGDNLSISCNDADADFLRNRLSDLRSRYTICLQSNRSPHMKKMTENITEKITCSNELYNGNNSDYTSDEKLCNNYNQLKQSHSSELDLNGNSIHSSQDSLPNDDYXXXXXXXXXXXXXMIDGAATVLAGNLNNWAKLTSNMLLEIAVNEFTSIEELEDKITEITKVKKESLERIAQISLGIDKQSNSENNSINAELSSQLTDESNSQLLMAYQDLKNLLYMKTNELSEIKVQYYHIKDNLKTLENLAEEIESKLIYPISEQMLENFKSQFMESDIRLLEKLINKLPDGLRQNLEIYFNNLQPTIRFVQSTIQDNKKEAILTNDEFHLSDSQITQMTQENINQIALLLKSINTFMVNSKVNLGQIEEIENCLDHIRIFHNRLEEHRNILQSILEKKSVYSSQIPDSDFSETVDKVDRLWNNTXXXXXXXXXXXXSIHHLKTKLDDTEMSLRKWMEDSEEKLNRLLSEGFNLKNQKILDDLKIVIPSWQQTMNDYQSMSYELRNSFTGENCKDLEDNLEQMNKQWSTIMNKLAQCTRELNSMRSPQEQKSHGVELASEKPQSTAAEVNSGISIEKLSGWLSSLEGQLETMEMGIVRWRSGSGLIATGNADKLKSKLISQLNDLYNEIDLYKTQFQLCSESEKNDSEYQISKRWKIFNDKINETKQCLEGTMESGHNLLTKLRLLNDWLAHKEADMLELKGNVCNTFNTAQNQLLKFENFISDIEAHRNQIEEAIELAQNQIGEAIDSNKLMEQSHTVNLESEGESDNSDTGSNGNVPXXXXXXXXXXXXXXXHYMKRKWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQKITKRKESPNTIANDESDKLSHSILGCARGSSIRHSRSKDKSHHTRSNSFGGFKGENEKDDMGTKPSCIKSPSKTIPSQAAIMKCSGMANIPSTRTLLSTGEYEINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNIIVKSGNVEPKYEPLLLSQDFNGDYKERNKDDEEHKIIFQHTETLRKHQRNQSLTMNNQPGVFQSQKSLDKTSPSVHTLPQVKPISSQYAIPQNQKITGFKKYSYEQDXXXXXXXXXXXXXXXXXXXXXXXNSSLNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDEXXXXXXXXXXXXXXXXXXXXXXXXVDQDPEMLTAAQYAASKRINEISSISPIYNNSLRFQSIPANDPMTRNYQNPSSIYSGTRSTPVQNFYGSLERGSYRGVNDSTPVGFNYRNPNERSGQSTLSPTNFVSNSHLKAXXXXXXXXXXXXFQLMCRSLADSCPAVTAAPTHGQSSNSIGSLFQMAGQVGKAVGQLVNVMTDDFNNNQDRDSPGSKTPTLNTNKPPFSSKPIFNEDFILPT 12714
            MDKLENENTQQLVFAKWFNNKLKKLYQPSIESLINGFRSGRRFYSITNMICQNENLEIPEQLTDQQLISTGIENILAKFSTTLPQSLQDKIEELLNGDEKIILSLAWWMITEYFAKQRSLSVNAIHSDTLFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVMELRERLSGTSQNDSQSCANEQMKITDSQIANPSFESLISNFNLDFSTIIQTLDTFFQHLEIAETRVKVHETFKDAKEVLEAFKSEDDLFVQLKIIKESVVEHEALMEKLTKHQDSIQSILMKGNAILEITSLDNTPQLKTNINNKREIITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEETRKNQKNFGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYSEDSDISDSDEDSQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEERICTADQLLRKSNKNQFNDFVNYTESKWGRMISSLDKCGQKIKDLCENESLVVSTVDNKIDEMIQNWNDASEKWRDSIDNWMGSDGKRRSNRASSFSDMSSENCYMRRKMENVTRNTPSSQSDMNISDFPIQAGYKTKFENDAERMMSWLENSAEKLELITLESISPEERPSITEQRKTIDLVTKEINLEKSKKNMETIKRMGLMYQEDLNKHGENTDEIEQLFEELDERWSYLENQLLKSRQKVLTVEISSQLDHETQELEKCIENANKFLQNIHYNKNLIEIDKLIKCATEFREKFIEKKIFLKQFTDKYQVVKSDFSRINEEIFSKQISDLNQKVINQLQIIENEEIKMRNLKSIIEMNLVETENFINNLSNIINEKLNINNFDDLEKNSIKYMSLKNTLESHFELLEKISITDSSSRKHKILVELKKNCHNTKQRVDNRVNFLKDLSEKTAQWKSQTMEFNHWLDEVSSYLDECEQQKYDEDDLINEAIKETEAGIQDMENLIPTLENIEKSTVNLEAYFENDLRVEIFNKKKNLQLKWENLHKRYLNFMEYLKKPLFKNSSQSDPKYKTAPQKVAIIIESESRTEDSLIDIDMEHSNFSMESLDKSSESFNDLGGVDSSGNIDREFLADIESWIRTSTEKLGNYSNIHNTEDLNIFGQLVIEMQNQKLGYIEKLKQYISTDIFLEVNEKFENFCQFLENENQRFKDSDYHLKDVKNILSGEDKWMGKVDRVMQQSFSCDHLDVEELSENIDEIEKVVCDHSEEDFNRLEDLKYSLTNARILERSVSMEIEQIKEKSLVMKNKANKRLGSLTQLLEHIQSVERRVCQMTTWIYDTTNLLKARIVADLLGADLPDEFEILKQNFMEWEKFLLEIEDLEKGKMYQGKKETSERLRLQRLKLQKSFRPLKELFSRYSRPADFEPRLDNLKREVNRVAEHIYLLDIISISIEDLENCETHAKQFKETLIASESDLNYVYDLGKEIAERKEIEFPERFSLQLDSLKKRYYNLLDQISEAEEKLSLARPLVVEIYEKQQLIDEILEKSEQDEKDFINFNSNFVHDLLELAEKLKCYTDFENSELVRDMFDELKEKCDLFMKKIEEATNKHNFVTNLDQLQNDADKLLMEIDQMDFSDKNKLEGKLDSLYIKTNQIKQAATQIVSSDETFKSQGEMNKYSILENKIEKIFTAISEHKATNGHMAIEDQCTSDSIEVEETILSNSASSLQNEIDSNLLKSRENSFGDSLSSPYSVEDVSNAENIVSELAYSVQAAKIEKNILQQVSMEIKDHIHSFILFCQNNLGSGISLTGSASKSITTLNDLKFKIN        IFKEQRFYIDHRLRELSAYADTSEQLEELDKIQRYWLESIGKLNKRIGRLADINKRIEEVEATLKEYEVQPSEKLRTKALRFVTQLEEELSVNLQKDRLRLTSCGRLGTQDTNISKSNSNNSVTQLLNQDMLTTHDNYRESLKTVREQLKEIGRRLNSVRIYIDDSRRGCLSKLSERIQDIDDKLADCSHMLAEVQYIMASGIEHQNTDSINLNFLIEAQKKRLGKYQNEYQTHLNKWMENASRWQEFIEKLEKLQTDLQAIEQDLISFENGISFNDQEMTEIKKSLSFFEKKLVSLEQDGDNLSISCNDADADFLRNRLSDLRSRYTICLQSNRSPHMKKMTENITEKITCSNELYNGNNSDYTSDEKLCNNYNQLKQSHSSELDLNGNSIHSSQDSLPNDDYETSSGESSEELSTMIDGAATVLAGNLNNWAKLTSNMLLEIAVNEFTSIEELEDKITEITKVKKESLERIAQISLGIDKQSNSENNSINAELSSQLTDESNSQLLMAYQDLKNLLYMKTNELSEIKVQYYHIKDNLKTLENLAEEIESKLIYPISEQMLENFKSQFMESDIRLLEKLINKLPDGLRQNLEIYFNNLQPTIRFVQSTIQDNKKEAILTNDEFHLSDSQITQMTQENINQIALLLKSINTFMVNSKVNLGQIEEIENCLDHIRIFHNRLEEHRNILQSILEKKSVYSSQIPDSDFSETVDKVDRLWNNTKDKLKEREEELLSIHHLKTKLDDTEMSLRKWMEDSEEKLNRLLSEGFNLKNQKILDDLKIVIPSWQQTMNDYQSMSYELRNSFTGENCKDLEDNLEQMNKQWSTIMNKLAQCTRELNSMRSPQEQKSHGVELASEKPQSTAAEVNSGISIEKLSGWLSSLEGQLETMEMGIVRWRSGSGLIATGNADKLKSKLISQLNDLYNEIDLYKTQFQLCSESEKNDSEYQISKRWKIFNDKINETKQCLEGTMESGHNLLTKLRLLNDWLAHKEADMLELKGNVCNTFNTAQNQLLKFENFISDIEAHRNQIEEAIELAQNQIGEAIDSNKLMEQSHTVNLESEGESDNSDTGSNGNVPDDKSKRLHRRLRRHSHYMKRKWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQKITKRKESPNTIANDESDKLSHSILGCARGSSIRHSRSKDKSHHTRSNSFGGFKGENEKDDMGTKPSCIKSPSKTIPSQAAIMKCSGMANIPSTRTLLSTGEYEINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRKKNSNSENSNEKSPESGNHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNIIVKSGNVEPKYEPLLLSQDFNGDYKERNKDDEEHKIIFQHTETLRKHQRNQSLTMNNQPGVFQSQKSLDKTSPSVHTLPQVKPISSQYAIPQNQKITGFKKYSYEQDSLNPNSFSNSVVSSADDVRVRNSNSSLNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDESPNNPNNFMPSSNIINSFGNNSLNVDQDPEMLTAAQYAASKRINEISSISPIYNNSLRFQSIPANDPMTRNYQNPSSIYSGTRSTPVQNFYGSLERGSYRGVNDSTPVGFNYRNPNERSGQSTLSPTNFVSNSHLKASSETGGSLSESEFQLMCRSLADSCPAVTAAPTHGQSSNSIGSLFQMAGQVGKAVGQLVNVMTDDFNNNQDRDSPGSKTPTLNTNKPPFSSKPIFNEDFILPT
Sbjct:    1 MDKLENENTQQLVFAKWFNNKLKKLYQPSIESLINGFRSGRRFYSITNMICQNENLEIPEQLTDQQLISTGIENILAKFSTTLPQSLQDKIEELLNGDEKIILSLAWWMITEYFAKQRSLSVNAIHSDTLFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVMELRERLSGTSQNDSQSCANEQMKITDSQIANPSFESLISNFNLDFSTIIQTLDTFFQHLEIAETRVKVHETFKDAKEVLEAFKSEDDLFVQLKIIKESVVEHEALMEKLTKHQDSIQSILMKGNAILEITSLDNTPQLKTNINNKREIITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEETRKNQKNFGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYSEDSDISDSDEDSQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEERICTADQLLRKSNKNQFNDFVNYTESKWGRMISSLDKCGQKIKDLCENESLVVSTVDNKIDEMIQNWNDASEKWRDSIDNWMGSDGKRRSNRASSFSDMSSENCYMRRKMENVTRNTPSSQSDMNISDFPIQAGYKTKFENDAERMMSWLENSAEKLELITLESISPEERPSITEQRKTIDLVTKEINLEKSKKNMETIKRMGLMYQEDLNKHGENTDEIEQLFEELDERWSYLENQLLKSRQKVLTVEISSQLDHETQELEKCIENANKFLQNIHYNKNLIEIDKLIKCATEFREKFIEKKIFLKQFTDKYQVVKSDFSRINEEIFSKQISDLNQKVINQLQIIENEEIKMRNLKSIIEMNLVETENFINNLSNIINEKLNINNFDDLEKNSIKYMSLKNTLESHFELLEKISITDSSSRKHKILVELKKNCHNTKQRVDNRVNFLKDLSEKTAQWKSQTMEFNHWLDEVSSYLDECEQQKYDEDDLINEAIKETEAGIQDMENLIPTLENIEKSTVNLEAYFENDLRVEIFNKKKNLQLKWENLHKRYLNFMEYLKKPLFKNSSQSDPKYKTAPQKVAIIIESESRTEDSLIDIDMEHSNFSMESLDKSSESFNDLGGVDSSGNIDREFLADIESWIRTSTEKLGNYSNIHNTEDLNIFGQLVIEMQNQKLGYIEKLKQYISTDIFLEVNEKFENFCQFLENENQRFKDSDYHLKDVKNILSGEDKWMGKVDRVMQQSFSCDHLDVEELSENIDEIEKVVCDHSEEDFNRLEDLKYSLTNARILERSVSMEIEQIKEKSLVMKNKANKRLGSLTQLLEHIQSVERRVCQMTTWIYDTTNLLKARIVADLLGADLPDEFEILKQNFMEWEKFLLEIEDLEKGKMYQGKKETSERLRLQRLKLQKSFRPLKELFSRYSRPADFEPRLDNLKREVNRVAEHIYLLDIISISIEDLENCETHAKQFKETLIASESDLNYVYDLGKEIAERKEIEFPERFSLQLDSLKKRYYNLLDQISEAEEKLSLARPLVVEIYEKQQLIDEILEKSEQDEKDFINFNSNFVHDLLELAEKLKCYTDFENSELVRDMFDELKEKCDLFMKKIEEATNKHNFVTNLDQLQNDADKLLMEIDQMDFSDKNKLEGKLDSLYIKTNQIKQAATQIVSSDETFKSQGEMNKYSILENKIEKIFTAISEHKATNGHMAIEDQCTSDSIEVEETILSNSASSLQNEIDSNLLKSRENSFGDSLSSPYSVEDVSNAENIVSELAYSVQAAKIEKNILQQVSMEIKDHIHSFILFCQNNLGSGISLTGSASKSITTLNDLKFKIN--------IFKEQRFYIDHRLRELSAYADTSEQLEELDKIQRYWLESIGKLNKRIGRLADINKRIEEVEATLKEYEVQPSEKLRTKALRFVTQLEEELSVNLQKDRLRLTSCGRLGTQDTNISKSNSNNSVTQLLNQDMLTTHDNYRESLKTVREQLKEIGRRLNSVRIYIDDSRRGCLSKLSERIQDIDDKLADCSHMLAEVQYIMASGIEHQNTDSINLNFLIEAQKKRLGKYQNEYQTHLNKWMENASRWQEFIEKLEKLQTDLQAIEQDLISFENGISFNDQEMTEIKKSLSFFEKKLVSLEQDGDNLSISCNDADADFLRNRLSDLRSRYTICLQSNRSPHMKKMTENITEKITCSNELYNGNNSDYTSDEKLCNNYNQLKQSHSSELDLNGNSIHSSQDSLPNDDYETSSGESSEELSTMIDGAATVLAGNLNNWAKLTSNMLLEIAVNEFTSIEELEDKITEITKVKKESLERIAQISLGIDKQSNSENNSINAELSSQLTDESNSQLLMAYQDLKNLLYMKTNELSEIKVQYYHIKDNLKTLENLAEEIESKLIYPISEQMLENFKSQFMESDIRLLEKLINKLPDGLRQNLEIYFNNLQPTIRFVQSTIQDNKKEAILTNDEFHLSDSQITQMTQENINQIALLLKSINTFMVNSKVNLGQIEEIENCLDHIRIFHNRLEEHRNILQSILEKKSVYSSQIPDSDFSETVDKVDRLWNNTKDKLKEREEELLSIHHLKTKLDDTEMSLRKWMEDSEEKLNRLLSEGFNLKNQKILDDLKIVIPSWQQTMNDYQSMSYELRNSFTGENCKDLEDNLEQMNKQWSTIMNKLAQCTRELNSMRSPQEQKSHGVELASEKPQSTAAEVNSGISIEKLSGWLSSLEGQLETMEMGIVRWRSGSGLIATGNADKLKSKLISQLNDLYNEIDLYKTQFQLCSESEKNDSEYQISKRWKIFNDKINETKQCLEGTMESGHNLLTKLRLLNDWLAHKEADMLELKGNVCNTFNTAQNQLLKFENFISDIEAHRNQIEEAIELAQNQIGEAIDSNKLMEQSHTVNLESEGESDNSDTGSNGNVPDDKSKRLHRRLRRHSHYMKRKWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQKITKRKESPNTIANDESDKLSHSILGCARGSSIRHSRSKDKSHHTRSNSFGGFKGENEKDDMGTKPSCIKSPSKTIPSQAAIMKCSGMANIPSTRTLLSTGEYEINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRKKNSNSENSNEKSPESGNHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNIIVKSGNVEPKYEPLLLSQDFNGDYKERNKDDEEHKIIFQHTETLRKHQRNQSLTMNNQPGVFQSQKSLDKTSPSVHTLPQVKPISSQYAIPQNQKITGFKKYSYEQDSLNPNSFSNSVVSSADDVRVRNSNSSLNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDESPNNPNNFMPSSNIINSFGNNSLNVDQDPEMLTAAQYAASKRINEISSISPIYNNSLRFQSIPANDPMTRNYQNPSSIYSGTRSTPVQNFYGSLERGSYRGVNDSTPVGFNYRNPNERSGQSTLSPTNFVSNSHLKASSETGGSLSESEFQLMCRSLADSCPAVTAAPTHGQSSNSIGSLFQMAGQVGKAVGQLVNVMTDDFNNNQDRDSPGSKTPTLNTNKPPFSSKPIFNEDFILPT 4187          
BLAST of Dystrophin vs. Planmine SMEST
Match: SMESG000020523.1 (SMESG000020523.1)

HSP 1 Score: 8152.73 bits (21153), Expect = 0.000e+0
Identity = 4154/4195 (99.02%), Postives = 4155/4195 (99.05%), Query Frame = 1
Query:  130 MDKLENENTQQLVFAKWFNNKLKKLYQPSIESLINGFRSGRRFYSITNMICQNENLEIPEQLTDQQLISTGIENILAKFSTTLPQSLQDKIEELLNGDEKIILSLAWWMITEYFAKQRSLSVNAIHSDTLFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVMELRERLSGTSQNDSQSCANEQMKITDSQIANPSFESLISNFNLDFSTIIQTLDTFFQHLEIAETRVKVHETFKDAKEVLEAFKSEDDLFVQLKIIKESVVEHEALMEKLTKHQDSIQSILMKGNAILEITSLDNTPQLKTNINNKREIITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEETRKNQKNFGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYXXXXXXXXXXXXXQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEERICTADQLLRKSNKNQFNDFVNYTESKWGRMISSLDKCGQKIKDLCENESLVVSTVDNKIDEMIQNWNDASEKWRDSIDNWMGSDGKRRSNRASSFSDMSSENCYMRRKMENVTRNTPSSQSDMNISDFPIQAGYKTKFENDAERMMSWLENSAEKLELITLESISPEERPSITEQRKTIDLVTKEINLEKSKKNMETIKRMGLMYQEDLNKHGENTDEIEQLFEELDERWSYLENQLLKSRQKVLTVEISSQLDHETQELEKCIENANKFLQNIHYNKNLIEIDKLIKCATEFREKFIEKKIFLKQFTDKYQVVKSDFSRINEEIFSKQISDLNQKVXXXXXXXXXXXXKMRNLKSIIEMNLVETENFINNLSNIINEKLNINNFDDLEKNSIKYMSLKNTLESHFELLEKISITDSSSRKHKILVELKKNCHNTKQRVDNRVNFLKDLSEKTAQWKSQTMEFNHWLDEVSSYLDECEQQKYDEDDLINEAIKETEAGIQDMENLIPTLENIEKSTVNLEAYFENDLRVEIFNKKKNLQLKWENLHKRYLNFMEYLKKPLFKNSSQSDPKYKTAPQKVAIIIESESRTEDSLIDIDMEHSNFSMESLDKSSESFNDLGGVDSSGNIDREFLADIESWIRTSTEKLGNYSNIHNTEDLNIFGQLVIEMQNQKLGYIEKLKQYISTDIFLEVNEKFENFCQFLENENQRFKDSDYHLKDVKNILSGEDKWMGKVDRVMQQSFSCDHLDVEELSENIDEIEKVVCDHSEEDFNRLEDLKYSLTNARILERSVSMEIEQIKEKSLVMKNKANKRLGSLTQLLEHIQSVERRVCQMTTWIYDTTNLLKARIVADLLGADLPDEFEILKQNFMEWEKFLLEIEDLEKGKMYQGKKETSEXXXXXXXXXXXSFRPLKELFSRYSRPADFEPRLDNLKREVNRVAEHIYXXXXXXXXXXXXXNCETHAKQFKETLIASESDLNYVYDLGKEIAERKEIEFPERFSLQLDSLKKRYYNLLDQISEAEEKLSLARPLVVEIYEKQQLIDEILEKSEQDEKDFINFNSNFVHDLLELAEKLKCYTDFENSELVRDMFDELKEKCDLFMKKIEEATNKHNFVTNLDQLQNDADKLLMEIDQMDFSDKNKLEGKLDSLYIKTNQIKQAATQIVSSDETFKSQGEMNKYSILENKIEKIFTAISEHKATNGHMAIEDQCTSDSIEVEETILSNSASSLQNEIDSNLLKSRENSFGDSLSSPYSVEDVSNAENIVSELAYSVQAAKIEKNILQQVSMEIKDHIHSFILFCQNNLGSGISLTGSASKSITTLNDLKFKINCIKETITEIFKEQRFYIDHRLRELSAYADTSEQLEELDKIQRYWLESIGKLNKRIGRLADINKRIEEVEATLKEYEVQPSEKLRTKALRFVTQLEEELSVNLQKDRLRLTSCGRLGTQDTNISKSNSNNSVTQLLNQDMLTTHDNYRESLKTVREQLKEIGRRLNSVRIYIDDSRRGCLSKLSERIQDIDDKLADCSHMLAEVQYIMASGIEHQNTDSINLNFLIEAQKKRLGKYQNEYQTHLNKWMENASRWQEFIEKLEKLQTDLQAIEQDLISFENGISFNDQEMTEIKKSLSFFEKKLVSLEQDGDNLSISCNDADADFLRNRLSDLRSRYTICLQSNRSPHMKKMTENITEKITCSNELYNGNNSDYTSDEKLCNNYNQLKQSHSSELDLNGNSIHSSQDSLPNDDYXXXXXXXXXXXXXMIDGAATVLAGNLNNWAKLTSNMLLEIAVNEFTSIEELEDKITEITKVKKESLERIAQISLGIDKQSNSENNSINAELSSQLTDESNSQLLMAYQDLKNLLYMKTNELSEIKVQYYHIKDNLKTLENLAEEIESKLIYPISEQMLENFKSQFMESDIRLLEKLINKLPDGLRQNLEIYFNNLQPTIRFVQSTIQDNKKEAILTNDEFHLSDSQITQMTQENINQIALLLKSINTFMVNSKVNLGQIEEIENCLDHIRIFHNRLEEHRNILQSILEKKSVYSSQIPDSDFSETVDKVDRLWNNTXXXXXXXXXXXXSIHHLKTKLDDTEMSLRKWMEDSEEKLNRLLSEGFNLKNQKILDDLKIVIPSWQQTMNDYQSMSYELRNSFTGENCKDLEDNLEQMNKQWSTIMNKLAQCTRELNSMRSPQEQKSHGVELASEKPQSTAAEVNSGISIEKLSGWLSSLEGQLETMEMGIVRWRSGSGLIATGNADKLKSKLISQLNDLYNEIDLYKTQFQLCSESEKNDSEYQISKRWKIFNDKINETKQCLEGTMESGHNLLTKLRLLNDWLAHKEADMLELKGNVCNTFNTAQNQLLKFENFISDIEAHRNQIEEAIELAQNQIGEAIDSNKLMEQSHTVNLESEGESDNSDTGSNGNVPXXXXXXXXXXXXXXXHYMKRKWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQKITKRKESPNTIANDESDKLSHSILGCARGSSIRHSRSKDKSHHTRSNSFGGFKGENEKDDMGTKPSCIKSPSKTIPSQAAIMKCSGMANIPSTRTLLSTGEYEINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNIIVKSGNVEPKYEPLLLSQDFNGDYKERNKDDEEHKIIFQHTETLRKHQRNQSLTMNNQPGVFQSQKSLDKTSPSVHTLPQVKPISSQYAIPQNQKITGFKKYSYEQDXXXXXXXXXXXXXXXXXXXXXXXNSSLNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDEXXXXXXXXXXXXXXXXXXXXXXXXVDQDPEMLTAAQYAASKRINEISSISPIYNNSLRFQSIPANDPMTRNYQNPSSIYSGTRSTPVQNFYGSLERGSYRGVNDSTPVGFNYRNPNERSGQSTLSPTNFVSNSHLKAXXXXXXXXXXXXFQLMCRSLADSCPAVTAAPTHGQSSNSIGSLFQMAGQVGKAVGQLVNVMTDDFNNNQDRDSPGSKTPTLNTNKPPFSSKPIFNEDFILPT 12714
            MDKLENENTQQLVFAKWFNNKLKKLYQPSIESLINGFRSGRRFYSITNMICQNENLEIPEQLTDQQLISTGIENILAKFSTTLPQSLQDKIEELLNGDEKIILSLAWWMITEYFAKQRSLSVNAIHSDTLFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVMELRERLSGTSQNDSQSCANEQMKITDSQIANPSFESLISNFNLDFSTIIQTLDTFFQHLEIAETRVKVHETFKDAKEVLEAFKSEDDLFVQLKIIKESVVEHEALMEKLTKHQDSIQSILMKGNAILEITSLDNTPQLKTNINNKREIITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEETRKNQKNFGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYSEDSDISDSDEDSQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEERICTADQLLRKSNKNQFNDFVNYTESKWGRMISSLDKCGQKIKDLCENESLVVSTVDNKIDEMIQNWNDASEKWRDSIDNWMGSDGKRRSNRASSFSDMSSENCYMRRKMENVTRNTPSSQSDMNISDFPIQAGYKTKFENDAERMMSWLENSAEKLELITLESISPEERPSITEQRKTIDLVTKEINLEKSKKNMETIKRMGLMYQEDLNKHGENTDEIEQLFEELDERWSYLENQLLKSRQKVLTVEISSQLDHETQELEKCIENANKFLQNIHYNKNLIEIDKLIKCATEFREKFIEKKIFLKQFTDKYQVVKSDFSRINEEIFSKQISDLNQKVINQLQIIENEEIKMRNLKSIIEMNLVETENFINNLSNIINEKLNINNFDDLEKNSIKYMSLKNTLESHFELLEKISITDSSSRKHKILVELKKNCHNTKQRVDNRVNFLKDLSEKTAQWKSQTMEFNHWLDEVSSYLDECEQQKYDEDDLINEAIKETEAGIQDMENLIPTLENIEKSTVNLEAYFENDLRVEIFNKKKNLQLKWENLHKRYLNFMEYLKKPLFKNSSQSDPKYKTAPQKVAIIIESESRTEDSLIDIDMEHSNFSMESLDKSSESFNDLGGVDSSGNIDREFLADIESWIRTSTEKLGNYSNIHNTEDLNIFGQLVIEMQNQKLGYIEKLKQYISTDIFLEVNEKFENFCQFLENENQRFKDSDYHLKDVKNILSGEDKWMGKVDRVMQQSFSCDHLDVEELSENIDEIEKVVCDHSEEDFNRLEDLKYSLTNARILERSVSMEIEQIKEKSLVMKNKANKRLGSLTQLLEHIQSVERRVCQMTTWIYDTTNLLKARIVADLLGADLPDEFEILKQNFMEWEKFLLEIEDLEKGKMYQGKKETSERLRLQRLKLQKSFRPLKELFSRYSRPADFEPRLDNLKREVNRVAEHIYLLDIISISIEDLENCETHAKQFKETLIASESDLNYVYDLGKEIAERKEIEFPERFSLQLDSLKKRYYNLLDQISEAEEKLSLARPLVVEIYEKQQLIDEILEKSEQDEKDFINFNSNFVHDLLELAEKLKCYTDFENSELVRDMFDELKEKCDLFMKKIEEATNKHNFVTNLDQLQNDADKLLMEIDQMDFSDKNKLEGKLDSLYIKTNQIKQAATQIVSSDETFKSQGEMNKYSILENKIEKIFTAISEHKATNGHMAIEDQCTSDSIEVEETILSNSASSLQNEIDSNLLKSRENSFGDSLSSPYSVEDVSNAENIVSELAYSVQAAKIEKNILQQVSMEIKDHIHSFILFCQNNLGSGISLTGSASKSITTLNDLKFKINCIKETITEIFKEQRFYIDHRLRELSAYADTSEQLEELDKIQRYWLESIGKLNKRIGRLADINKRIEEVEATLKEYEVQPSEKLRTKALRFVTQLEEELSVNLQKDRLRLTSCGRLGTQDTNISKSNSNNSVTQLLNQDMLTTHDNYRESLKTVREQLKEIGRRLNSVRIYIDDSRRGCLSKLSERIQDIDDKLADCSHMLAEVQYIMASGIEHQNTDSINLNFLIEAQKKRLGKYQNEYQTHLNKWMENASRWQEFIEKLEKLQTDLQAIEQDLISFENGISFNDQEMTEIKKSLSFFEKKLVSLEQDGDNLSISCNDADADFLRNRLSDLRSRYTICLQSNRSPHMKKMTENITEKITCSNELYNGNNSDYTSDEKLCNNYNQLKQSHSSELDLNGNSIHSSQDSLPNDDYETSSGESSEELSTMIDGAATVLAGNLNNWAKLTSNMLLEIAVNEFTSIEELEDKITEITKVKKESLERIAQISLGIDKQSNSENNSINAELSSQLTDESNSQLLMAYQDLKNLLYMKTNELSEIKVQYYHIKDNLKTLENLAEEIESKLIYPISEQMLENFKSQFMESDIRLLEKLINKLPDGLRQNLEIYFNNLQPTIRFVQSTIQDNKKEAILTNDEFHLSDSQITQMTQENINQIALLLKSINTFMVNSKVNLGQIEEIENCLDHIRIFHNRLEEHRNILQSILEKKSVYSSQIPDSDFSETVDKVDRLWNNTKDKLKEREEELLSIHHLKTKLDDTEMSLRKWMEDSEEKLNRLLSEGFNLKNQKILDDLKIVIPSWQQTMNDYQSMSYELRNSFTGENCKDLEDNLEQMNKQWSTIMNKLAQCTRELNSMRSPQEQKSHGVELASEKPQSTAAEVNSGISIEKLSGWLSSLEGQLETMEMGIVRWRSGSGLIATGNADKLKSKLISQLNDLYNEIDLYKTQFQLCSESEKNDSEYQISKRWKIFNDKINETKQCLEGTMESGHNLLTKLRLLNDWLAHKEADMLELKGNVCNTFNTAQNQLLKFENFISDIEAHRNQIEEAIELAQNQIGEAIDSNKLMEQSHTVNLESEGESDNSDTGSNGNVPDDKSKRLHRRLRRHSHYMKRKWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQKITKRKESPNTIANDESDKLSHSILGCARGSSIRHSRSKDKSHHTRSNSFGGFKGENEKDDMGTKPSCIKSPSKTIPSQAAIMKCSGMANIPSTRTLLSTGEYEINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKN  +                                      SGNHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNIIVKSGNVEPKYEPLLLSQDFNGDYKERNKDDEEHKIIFQHTETLRKHQRNQSLTMNNQPGVFQSQKSLDKTSPSVHTLPQVKPISSQYAIPQNQKITGFKKYSYEQDSLNPNSFSNSVVSSADDVRVRNSNSSLNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDESPNNPNNFMPSSNIINSFGNNSLNVDQDPEMLTAAQYAASKRINEISSISPIYNNSLRFQSIPANDPMTRNYQNPSSIYSGTRSTPVQNFYGSLERGSYRGVNDSTPVGFNYRNPNERSGQSTLSPTNFVSNSHLKASSETGGSLSESEFQLMCRSLADSCPAVTAAPTHGQSSNSIGSLFQMAGQVGKAVGQLVNVMTDDFNNNQDRDSPGSKTPTLNTNKPPFSSKPIFNEDFILPT
Sbjct:    1 MDKLENENTQQLVFAKWFNNKLKKLYQPSIESLINGFRSGRRFYSITNMICQNENLEIPEQLTDQQLISTGIENILAKFSTTLPQSLQDKIEELLNGDEKIILSLAWWMITEYFAKQRSLSVNAIHSDTLFWCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVMELRERLSGTSQNDSQSCANEQMKITDSQIANPSFESLISNFNLDFSTIIQTLDTFFQHLEIAETRVKVHETFKDAKEVLEAFKSEDDLFVQLKIIKESVVEHEALMEKLTKHQDSIQSILMKGNAILEITSLDNTPQLKTNINNKREIITNKWNELYNNSTEFQRKLHRSLYQMQMSFLIKIETSIDQLEETRKNQKNFGNSIDLLKHQLKDNRTMEMKIESTEKYMTALKTFLIYSEDSDISDSDEDSQNKDDEQLKRISKSISDSSFEQHINSIGNKWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEERICTADQLLRKSNKNQFNDFVNYTESKWGRMISSLDKCGQKIKDLCENESLVVSTVDNKIDEMIQNWNDASEKWRDSIDNWMGSDGKRRSNRASSFSDMSSENCYMRRKMENVTRNTPSSQSDMNISDFPIQAGYKTKFENDAERMMSWLENSAEKLELITLESISPEERPSITEQRKTIDLVTKEINLEKSKKNMETIKRMGLMYQEDLNKHGENTDEIEQLFEELDERWSYLENQLLKSRQKVLTVEISSQLDHETQELEKCIENANKFLQNIHYNKNLIEIDKLIKCATEFREKFIEKKIFLKQFTDKYQVVKSDFSRINEEIFSKQISDLNQKVINQLQIIENEEIKMRNLKSIIEMNLVETENFINNLSNIINEKLNINNFDDLEKNSIKYMSLKNTLESHFELLEKISITDSSSRKHKILVELKKNCHNTKQRVDNRVNFLKDLSEKTAQWKSQTMEFNHWLDEVSSYLDECEQQKYDEDDLINEAIKETEAGIQDMENLIPTLENIEKSTVNLEAYFENDLRVEIFNKKKNLQLKWENLHKRYLNFMEYLKKPLFKNSSQSDPKYKTAPQKVAIIIESESRTEDSLIDIDMEHSNFSMESLDKSSESFNDLGGVDSSGNIDREFLADIESWIRTSTEKLGNYSNIHNTEDLNIFGQLVIEMQNQKLGYIEKLKQYISTDIFLEVNEKFENFCQFLENENQRFKDSDYHLKDVKNILSGEDKWMGKVDRVMQQSFSCDHLDVEELSENIDEIEKVVCDHSEEDFNRLEDLKYSLTNARILERSVSMEIEQIKEKSLVMKNKANKRLGSLTQLLEHIQSVERRVCQMTTWIYDTTNLLKARIVADLLGADLPDEFEILKQNFMEWEKFLLEIEDLEKGKMYQGKKETSERLRLQRLKLQKSFRPLKELFSRYSRPADFEPRLDNLKREVNRVAEHIYLLDIISISIEDLENCETHAKQFKETLIASESDLNYVYDLGKEIAERKEIEFPERFSLQLDSLKKRYYNLLDQISEAEEKLSLARPLVVEIYEKQQLIDEILEKSEQDEKDFINFNSNFVHDLLELAEKLKCYTDFENSELVRDMFDELKEKCDLFMKKIEEATNKHNFVTNLDQLQNDADKLLMEIDQMDFSDKNKLEGKLDSLYIKTNQIKQAATQIVSSDETFKSQGEMNKYSILENKIEKIFTAISEHKATNGHMAIEDQCTSDSIEVEETILSNSASSLQNEIDSNLLKSRENSFGDSLSSPYSVEDVSNAENIVSELAYSVQAAKIEKNILQQVSMEIKDHIHSFILFCQNNLGSGISLTGSASKSITTLNDLKFKINCIKETITEIFKEQRFYIDHRLRELSAYADTSEQLEELDKIQRYWLESIGKLNKRIGRLADINKRIEEVEATLKEYEVQPSEKLRTKALRFVTQLEEELSVNLQKDRLRLTSCGRLGTQDTNISKSNSNNSVTQLLNQDMLTTHDNYRESLKTVREQLKEIGRRLNSVRIYIDDSRRGCLSKLSERIQDIDDKLADCSHMLAEVQYIMASGIEHQNTDSINLNFLIEAQKKRLGKYQNEYQTHLNKWMENASRWQEFIEKLEKLQTDLQAIEQDLISFENGISFNDQEMTEIKKSLSFFEKKLVSLEQDGDNLSISCNDADADFLRNRLSDLRSRYTICLQSNRSPHMKKMTENITEKITCSNELYNGNNSDYTSDEKLCNNYNQLKQSHSSELDLNGNSIHSSQDSLPNDDYETSSGESSEELSTMIDGAATVLAGNLNNWAKLTSNMLLEIAVNEFTSIEELEDKITEITKVKKESLERIAQISLGIDKQSNSENNSINAELSSQLTDESNSQLLMAYQDLKNLLYMKTNELSEIKVQYYHIKDNLKTLENLAEEIESKLIYPISEQMLENFKSQFMESDIRLLEKLINKLPDGLRQNLEIYFNNLQPTIRFVQSTIQDNKKEAILTNDEFHLSDSQITQMTQENINQIALLLKSINTFMVNSKVNLGQIEEIENCLDHIRIFHNRLEEHRNILQSILEKKSVYSSQIPDSDFSETVDKVDRLWNNTKDKLKEREEELLSIHHLKTKLDDTEMSLRKWMEDSEEKLNRLLSEGFNLKNQKILDDLKIVIPSWQQTMNDYQSMSYELRNSFTGENCKDLEDNLEQMNKQWSTIMNKLAQCTRELNSMRSPQEQKSHGVELASEKPQSTAAEVNSGISIEKLSGWLSSLEGQLETMEMGIVRWRSGSGLIATGNADKLKSKLISQLNDLYNEIDLYKTQFQLCSESEKNDSEYQISKRWKIFNDKINETKQCLEGTMESGHNLLTKLRLLNDWLAHKEADMLELKGNVCNTFNTAQNQLLKFENFISDIEAHRNQIEEAIELAQNQIGEAIDSNKLMEQSHTVNLESEGESDNSDTGSNGNVPDDKSKRLHRRLRRHSHYMKRKWIELNLKMRDYYEYFKKKSVILKSVDIQIKECNQLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIETQKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLKQTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWERCLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMKLRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLYRAANQKITKRKESPNTIANDESDKLSHSILGCARGSSIRHSRSKDKSHHTRSNSFGGFKGENEKDDMGTKPSCIKSPSKTIPSQAAIMKCSGMANIPSTRTLLSTGEYEINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKNSPE--------------------------------------SGNHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNPEMISTNHQIHSRVEQYANRLAEVEQLNKSNIIVKSGNVEPKYEPLLLSQDFNGDYKERNKDDEEHKIIFQHTETLRKHQRNQSLTMNNQPGVFQSQKSLDKTSPSVHTLPQVKPISSQYAIPQNQKITGFKKYSYEQDSLNPNSFSNSVVSSADDVRVRNSNSSLNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMSPILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNTSLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRLRQLIDESPNNPNNFMPSSNIINSFGNNSLNVDQDPEMLTAAQYAASKRINEISSISPIYNNSLRFQSIPANDPMTRNYQNPSSIYSGTRSTPVQNFYGSLERGSYRGVNDSTPVGFNYRNPNERSGQSTLSPTNFVSNSHLKASSETGGSLSESEFQLMCRSLADSCPAVTAAPTHGQSSNSIGSLFQMAGQVGKAVGQLVNVMTDDFNNNQDRDSPGSKTPTLNTNKPPFSSKPIFNEDFILPT 4157          
BLAST of Dystrophin vs. Planmine SMEST
Match: SMESG000078318.1 (SMESG000078318.1)

HSP 1 Score: 103.605 bits (257), Expect = 2.370e-21
Identity = 59/247 (23.89%), Postives = 111/247 (44.94%), Query Frame = 1
Query: 10225 VDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKN---VDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFR 10956
            +++ + WLL  YD++  G++ V++LK A+  L +    +K+KY F+L+ +  G L   R    L D +++   + E  +F  ++     I   ++   V ++F+EK                                                    PQ L+WL + +R+ + E+  H  +C  C  + I+G RY+C RC +++LCQ CF+   T+ +H  +H ++EY   +SS+ + R +    R
Sbjct:  116 IEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPG----------------------------------------------PQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEY--TSSSKSHSRQFGHALR 314          
BLAST of Dystrophin vs. Planmine SMEST
Match: SMESG000078318.1 (SMESG000078318.1)

HSP 1 Score: 103.605 bits (257), Expect = 2.615e-21
Identity = 59/247 (23.89%), Postives = 111/247 (44.94%), Query Frame = 1
Query: 10225 VDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNASLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNVKPSVISCFKN---VDDKFVEKSFDKKDTTFQRIRASFRRXXXXXXXXXXXXXXXXXXHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKIQPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSRENFRDYSRIFR 10956
            +++ + WLL  YD++  G++ V++LK A+  L +    +K+KY F+L+ +  G L   R    L D +++   + E  +F  ++     I   ++   V ++F+EK                                                    PQ L+WL + +R+ + E+  H  +C  C  + I+G RY+C RC +++LCQ CF+   T+ +H  +H ++EY   +SS+ + R +    R
Sbjct:  116 IEMLMGWLLYSYDTSGTGRLSVMALKVALSTLASGKPMDKFKYHFTLLTDPSGALIPTRFEQYLHDLLVLAVGVFEGPNFAYNSQASKFILVGRSKAIVIEEFLEKMLADPG----------------------------------------------PQCLLWLTIFHRLANIENVRHNVRCEGCHREVIIGFRYKCQRCHHYNLCQDCFWTGVTTGNHSNTHDVKEY--TSSSKSHSRQFGHALR 314          
BLAST of Dystrophin vs. Planmine SMEST
Match: SMESG000066485.1 (SMESG000066485.1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.646e-17
Identity = 64/227 (28.19%), Postives = 107/227 (47.14%), Query Frame = 1
Query:  142 ENENTQQLVFAKWFNNKLKKLYQPSIESLINGFRSGRRFYSITNMICQNENLEIPEQLTDQQLISTGIENILAKFSTTLPQSLQDK---IEELLNGDEKIILSLAWWMITEY-----FAKQRSLSVNAIHSDTLF-WCQQIAKGYRGVSVTNFTNSWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRLLEVDNFTSSLILDWKSICLFVM 795
            E EN Q+  F KW N+ L KL Q SI+ L N  + G+    +   I   E L  P   T  ++    +EN+    +  + Q +  +     ++++G+ ++ L L W +I  +       ++   S      D L  WCQ    GY   +V NF+  WRDG A  AI+H ++  L E+ +    N  +NL   + +A ++ G  RLL+ ++ +     D KSI  +V+
Sbjct:   48 ERENVQKKTFTKWINSHLNKLKQ-SIDDLYNDLKDGK-MLLLLLEILSGEQLPYP---TKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVE-NPDEKSIMTYVV 268          
The following BLAST results are available for this feature:
BLAST of Dystrophin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DMD3.699e-7942.19dystrophin [Source:HGNC Symbol;Acc:HGNC:2928][more]
DMD6.913e-7940.85dystrophin [Source:HGNC Symbol;Acc:HGNC:2928][more]
DMD1.022e-7840.85dystrophin [Source:HGNC Symbol;Acc:HGNC:2928][more]
DMD2.438e-7640.61dystrophin [Source:HGNC Symbol;Acc:HGNC:2928][more]
DMD1.472e-7542.19dystrophin [Source:HGNC Symbol;Acc:HGNC:2928][more]
back to top
BLAST of Dystrophin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dys-11.277e-5839.41Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9T... [more]
dys-11.286e-5839.41Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9T... [more]
dys-12.009e-5839.41Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9T... [more]
dys-12.116e-5839.41Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9T... [more]
dys-12.193e-5839.41Dystrophin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9T... [more]
back to top
BLAST of Dystrophin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dys6.204e-7941.19gene:FBgn0260003 transcript:FBtr0110916[more]
Dys8.940e-7941.19gene:FBgn0260003 transcript:FBtr0334563[more]
Dys1.729e-7840.77gene:FBgn0260003 transcript:FBtr0334565[more]
Dys1.008e-7740.77gene:FBgn0260003 transcript:FBtr0334562[more]
Dys1.090e-7740.77gene:FBgn0260003 transcript:FBtr0083766[more]
back to top
BLAST of Dystrophin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
utrn4.414e-8038.98utrophin [Source:ZFIN;Acc:ZDB-GENE-070228-6][more]
utrn5.670e-8039.34utrophin [Source:ZFIN;Acc:ZDB-GENE-070228-6][more]
dmd1.048e-7841.39dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1][more]
dmd2.960e-7440.47dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1][more]
dmd3.232e-7440.47dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1][more]
back to top
BLAST of Dystrophin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tg2.697e-7741.88thyroglobulin [Source:Xenbase;Acc:XB-GENE-6073495][more]
tg3.321e-7741.88thyroglobulin [Source:Xenbase;Acc:XB-GENE-6073495][more]
tg5.272e-7741.88thyroglobulin [Source:Xenbase;Acc:XB-GENE-6073495][more]
tg5.385e-7741.88thyroglobulin [Source:Xenbase;Acc:XB-GENE-6073495][more]
tg5.648e-7741.88thyroglobulin [Source:Xenbase;Acc:XB-GENE-6073495][more]
back to top
BLAST of Dystrophin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dmd1.705e-7942.19dystrophin, muscular dystrophy [Source:MGI Symbol;... [more]
Dmd5.023e-7940.85dystrophin, muscular dystrophy [Source:MGI Symbol;... [more]
Dmd1.445e-7440.85dystrophin, muscular dystrophy [Source:MGI Symbol;... [more]
Dmd1.518e-7440.85dystrophin, muscular dystrophy [Source:MGI Symbol;... [more]
Dmd4.837e-7442.05dystrophin, muscular dystrophy [Source:MGI Symbol;... [more]
back to top
BLAST of Dystrophin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7YU29|DMDE_DROME6.219e-7841.19Dystrophin, isoform E OS=Drosophila melanogaster O... [more]
sp|Q9VDW3|DMDB_DROME1.092e-7640.77Dystrophin, isoform B OS=Drosophila melanogaster O... [more]
sp|Q0KI50|DMDD_DROME1.798e-7642.81Dystrophin, isoform D OS=Drosophila melanogaster O... [more]
sp|Q9VDW6|DMDA_DROME4.163e-7640.77Dystrophin, isoforms A/C/F/G/H OS=Drosophila melan... [more]
sp|Q5GN48|DMD_PIG1.035e-7341.16Dystrophin OS=Sus scrofa OX=9823 GN=DMD PE=1 SV=1[more]
back to top
BLAST of Dystrophin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S8XBH61.431e-12830.29Zinc finger, ZZ type (Fragment) OS=Opisthorchis vi... [more]
G7YU458.035e-12828.88Dystrophin isoforms A/C/F/G/H OS=Clonorchis sinens... [more]
A0A4S2M0K01.218e-12429.30Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A419Q6S81.249e-12028.82Dystrophin OS=Clonorchis sinensis OX=79923 GN=Dys ... [more]
A0A5J4NUS32.906e-11927.08Uncharacterized protein OS=Paragonimus westermani ... [more]
back to top
BLAST of Dystrophin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dmd7.058e-7639.10dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1][more]
dmd7.677e-7641.09dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1][more]
dmd1.157e-7441.09dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1][more]
utrn4.314e-7341.94utrophin [Source:ZFIN;Acc:ZDB-GENE-070228-6][more]
dmd1.545e-7240.00dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1][more]
back to top
BLAST of Dystrophin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002801.11.045e-6244.54pep scaffold:Pmarinus_7.0:GL476499:231780:258689:1... [more]
ENSPMAT00000004878.12.032e-5841.56pep scaffold:Pmarinus_7.0:GL480232:9823:26212:1 ge... [more]
ENSPMAT00000010595.13.846e-2631.47pep scaffold:Pmarinus_7.0:GL477281:35182:38646:-1 ... [more]
dtnba7.718e-2224.90dystrobrevin, beta a [Source:ZFIN;Acc:ZDB-GENE-030... [more]
ENSPMAT00000001271.12.376e-1918.95pep scaffold:Pmarinus_7.0:GL501301:6854:105266:-1 ... [more]
back to top
BLAST of Dystrophin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dystrophin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO410971.063e-7135.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450671.096e-6238.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410991.688e-3120.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478311.435e-2829.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424311.051e-1626.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dystrophin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dmd1.591e-7838.28dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1][more]
dmd5.736e-7839.22dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1][more]
dmd8.805e-7839.22dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1][more]
dmd1.245e-7739.22dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1][more]
dmd8.222e-7638.55dystrophin [Source:ZFIN;Acc:ZDB-GENE-010426-1][more]
back to top
BLAST of Dystrophin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020523.10.000e+099.81SMESG000020523.1[more]
SMESG000020523.10.000e+099.02SMESG000020523.1[more]
SMESG000078318.12.370e-2123.89SMESG000078318.1[more]
SMESG000078318.12.615e-2123.89SMESG000078318.1[more]
SMESG000066485.12.646e-1728.19SMESG000066485.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016950 ID=SMED30016950|Name=Dystrophin|organism=Schmidtea mediterranea sexual|type=transcript|length=13071bp
CTACTATTAATTTTCGATTTGGATTTTCGACCTAAGATCATTTATTTTTG
GACGCTCAATAATTAACTTTGAAAGAAACATCTGATTTTTTACTTCTAAA
CATTCTTTGGATATAAATTTTAGTTTGATATGGATAAATTAGAAAATGAA
AATACTCAACAGCTGGTCTTTGCAAAGTGGTTCAATAACAAATTGAAAAA
ATTATACCAACCGTCAATTGAATCCCTGATTAATGGGTTTAGATCTGGAA
GGAGATTCTATTCTATAACAAATATGATATGTCAAAATGAAAATCTGGAA
ATTCCTGAACAATTAACAGATCAACAGCTTATTTCTACTGGAATCGAAAA
TATTCTTGCCAAATTTTCTACAACTCTACCCCAATCATTGCAGGATAAAA
TTGAGGAATTGCTAAATGGGGATGAAAAAATAATTCTTTCATTGGCATGG
TGGATGATAACTGAATACTTTGCTAAACAGAGGTCACTTAGTGTTAATGC
AATTCATTCTGACACTCTATTTTGGTGTCAACAAATTGCCAAAGGATATC
GTGGCGTTAGTGTGACGAACTTCACAAATTCCTGGCGAGATGGATGTGCT
CTTTTGGCAATTCTTCATTATTACAAATCTTCATTGTTTGAATTTGAAAG
CCGTTTGTCGAAAAATTCTGGTCAAAATTTGACACTCGGATTGCATTTAG
CAAATCAAGAATTTGGATGTATGAGATTGCTTGAAGTTGACAATTTCACT
TCATCATTAATTTTGGATTGGAAATCTATTTGTTTGTTTGTCATGGAACT
GCGAGAACGATTAAGTGGAACTTCGCAAAACGATTCTCAGTCTTGTGCAA
ATGAACAAATGAAAATAACAGACTCTCAGATTGCTAATCCGTCATTTGAA
TCATTAATCAGTAATTTCAACTTAGATTTTTCAACTATTATTCAGACATT
GGACACATTTTTTCAACATCTGGAAATTGCCGAAACCCGTGTAAAAGTTC
ACGAAACCTTCAAAGACGCAAAAGAGGTGCTTGAAGCATTTAAAAGCGAA
GATGATTTATTTGTTCAACTAAAAATAATTAAGGAATCGGTTGTTGAACA
CGAAGCTCTCATGGAAAAGCTCACTAAACATCAAGATTCTATACAATCAA
TTCTAATGAAAGGAAATGCAATTTTGGAAATCACTTCATTGGACAATACT
CCACAGCTTAAAACAAATATAAATAATAAACGCGAAATAATTACCAACAA
ATGGAATGAATTGTACAACAATTCTACGGAATTTCAAAGAAAACTTCACA
GATCACTTTATCAAATGCAAATGTCATTTTTGATAAAAATTGAAACCAGT
ATCGACCAACTTGAAGAAACAAGAAAAAATCAAAAAAATTTTGGAAATAG
CATTGATCTATTAAAACATCAACTGAAAGACAATAGGACAATGGAAATGA
AAATAGAGTCCACTGAAAAATATATGACGGCATTGAAGACATTTTTGATT
TATTCAGAAGATTCTGACATTTCTGACTCTGATGAAGATTCACAAAATAA
AGATGATGAACAACTGAAAAGGATTTCCAAATCAATTTCAGATTCTTCAT
TTGAACAGCATATCAATTCAATTGGAAACAAATGGAATGAATTAGTTAGT
TGGGTCAATTCTCGATATAATAGTTTGCAAAAAATACTTTTGGCCTGGAG
ACACTTTGAAGAAGAAATTCAAGGGATTTCTGATTGGTTAGAAGAGCGAA
TTTGCACGGCTGATCAACTTTTACGGAAAAGCAACAAAAATCAATTCAAT
GATTTTGTCAATTACACCGAATCGAAATGGGGAAGAATGATTTCAAGCCT
GGATAAATGTGGCCAGAAAATAAAGGATTTATGTGAAAATGAGTCTTTAG
TCGTTTCTACAGTTGACAACAAAATCGACGAAATGATCCAAAATTGGAAT
GATGCCTCGGAAAAATGGAGAGATTCAATTGATAATTGGATGGGATCGGA
TGGTAAACGAAGATCTAATCGTGCTTCTTCCTTTTCAGACATGTCTTCAG
AAAATTGTTATATGCGCAGAAAAATGGAGAATGTGACAAGAAATACCCCT
TCTTCACAATCAGACATGAACATTAGTGATTTTCCAATTCAAGCGGGATA
CAAAACTAAGTTTGAAAATGATGCTGAACGAATGATGTCATGGTTGGAAA
ATTCGGCGGAAAAGTTAGAACTAATAACCTTGGAATCAATCAGTCCCGAA
GAAAGGCCCTCGATAACTGAACAAAGAAAAACAATTGACTTGGTAACAAA
AGAAATCAACTTGGAAAAATCAAAGAAAAACATGGAAACTATTAAAAGAA
TGGGCCTTATGTATCAAGAAGATTTAAATAAACATGGAGAAAACACCGAT
GAAATTGAACAACTGTTTGAAGAGCTCGATGAAAGATGGTCATATCTGGA
AAATCAGTTGTTGAAGAGCCGACAAAAAGTTTTGACTGTGGAAATATCTT
CCCAGTTAGATCATGAAACTCAAGAATTAGAAAAATGCATTGAAAATGCA
AATAAATTTTTACAAAATATTCACTATAATAAAAACTTGATTGAAATCGA
CAAACTAATCAAATGTGCCACAGAATTCAGGGAAAAATTTATTGAAAAAA
AGATTTTCCTCAAACAGTTTACTGACAAATATCAAGTAGTCAAATCCGAT
TTTTCAAGAATAAACGAAGAAATATTTTCCAAACAAATCAGTGATTTGAA
TCAAAAAGTGATAAATCAATTGCAAATAATTGAAAACGAAGAAATAAAAA
TGAGGAACCTAAAATCAATAATAGAGATGAATTTGGTTGAAACTGAAAAT
TTTATCAATAACCTATCAAATATAATCAATGAAAAATTGAATATTAATAA
CTTTGATGACTTAGAAAAAAATTCTATAAAATATATGTCATTAAAAAATA
CACTAGAATCGCATTTTGAATTGTTAGAAAAGATTTCAATCACAGATTCC
TCATCAAGAAAACACAAGATTCTCGTCGAACTTAAAAAGAATTGTCACAA
TACCAAGCAACGTGTTGATAACCGTGTCAATTTTCTTAAAGATTTGTCGG
AAAAAACAGCCCAATGGAAAAGTCAAACAATGGAATTTAATCACTGGCTG
GATGAGGTCAGCAGTTATTTGGATGAATGTGAACAACAGAAATATGACGA
AGACGACTTGATTAATGAAGCAATTAAAGAAACTGAAGCCGGTATTCAAG
ACATGGAAAATCTAATTCCGACTCTTGAAAATATCGAAAAATCTACAGTC
AACTTAGAAGCTTATTTTGAGAACGATTTGCGAGTGGAAATCTTTAACAA
AAAGAAAAATCTCCAACTCAAATGGGAAAACCTTCACAAAAGATATTTGA
ATTTCATGGAATATTTAAAGAAACCATTATTTAAAAATAGCAGTCAATCA
GATCCTAAATATAAAACTGCTCCACAAAAAGTGGCAATTATCATCGAATC
AGAATCCAGAACAGAAGACAGTTTGATCGATATTGATATGGAGCACTCGA
ATTTTTCTATGGAATCCCTAGATAAGTCCTCGGAATCATTCAATGACTTG
GGAGGTGTTGATTCTTCTGGAAATATTGATAGGGAATTTTTAGCAGACAT
TGAAAGCTGGATAAGAACAAGCACAGAAAAGTTGGGCAACTATTCCAATA
TACACAATACCGAGGACCTCAACATATTTGGTCAATTAGTGATTGAAATG
CAAAATCAAAAACTTGGTTACATTGAAAAATTGAAACAATACATTTCAAC
AGATATTTTTCTTGAGGTTAATGAGAAATTTGAAAATTTTTGTCAGTTTC
TTGAAAACGAAAATCAGCGATTTAAAGATTCGGATTATCATTTGAAGGAC
GTCAAAAACATATTATCAGGTGAAGATAAATGGATGGGAAAAGTCGACCG
AGTGATGCAGCAGTCCTTTTCATGTGACCATCTTGATGTTGAAGAACTTT
CTGAAAATATTGATGAAATCGAAAAAGTAGTTTGTGATCATTCCGAAGAA
GACTTCAACAGATTAGAAGATTTGAAATATTCCTTAACGAATGCTCGTAT
TTTAGAACGCAGCGTCAGCATGGAGATAGAACAGATAAAAGAAAAGTCAT
TAGTGATGAAAAACAAAGCTAATAAAAGACTTGGAAGTCTTACACAATTG
CTTGAGCACATCCAATCTGTTGAAAGGCGTGTTTGTCAAATGACTACATG
GATTTATGATACAACAAATCTGTTGAAAGCGAGAATAGTCGCAGATTTAC
TTGGTGCCGATTTACCTGACGAATTTGAAATTTTAAAACAAAATTTTATG
GAATGGGAAAAGTTCTTATTGGAAATAGAAGATTTGGAGAAAGGAAAGAT
GTATCAAGGGAAGAAAGAAACGAGCGAAAGACTGCGTTTGCAAAGACTTA
AATTACAAAAATCTTTCCGGCCATTAAAAGAATTATTTTCTCGATATTCT
CGACCTGCCGACTTTGAGCCTCGTTTGGATAATTTGAAGAGAGAAGTGAA
TCGTGTCGCAGAACATATTTATTTATTGGACATCATTTCTATATCAATAG
AAGATTTAGAGAACTGTGAAACTCACGCTAAACAATTTAAAGAAACTTTG
ATTGCGTCAGAAAGCGATCTTAATTATGTTTACGATCTTGGTAAAGAAAT
TGCCGAACGAAAAGAAATTGAATTTCCTGAAAGATTCTCATTGCAGTTGG
ATAGTTTAAAGAAAAGATATTATAATCTATTAGATCAGATTTCGGAGGCA
GAAGAAAAATTGTCATTAGCAAGGCCCCTAGTCGTTGAAATATATGAGAA
ACAGCAGTTGATTGATGAAATTCTAGAGAAATCTGAACAAGATGAAAAGG
ATTTCATAAATTTCAATTCAAATTTCGTTCATGATTTATTGGAATTAGCA
GAAAAGTTAAAGTGCTACACAGACTTTGAGAACAGTGAATTAGTTAGAGA
CATGTTCGATGAATTAAAAGAAAAATGTGATTTATTTATGAAAAAGATTG
AAGAGGCGACAAATAAACACAATTTTGTTACAAATTTGGATCAATTACAG
AATGATGCTGACAAATTGTTGATGGAAATCGATCAGATGGATTTTTCAGA
CAAAAACAAACTAGAAGGAAAGCTTGATAGTTTATATATCAAGACAAATC
AAATAAAACAAGCTGCAACACAAATAGTCAGTTCTGATGAAACTTTCAAA
AGTCAAGGAGAAATGAATAAATATTCTATTCTTGAAAATAAAATTGAAAA
GATATTTACTGCGATTTCAGAACACAAAGCTACTAACGGTCATATGGCAA
TTGAGGATCAATGTACAAGTGACAGCATAGAAGTTGAAGAAACAATTTTG
TCTAATAGTGCTTCCTCGTTACAAAACGAAATAGATAGTAATTTGTTAAA
AAGTCGTGAAAATAGTTTTGGAGATTCTCTTTCCTCACCATATAGCGTTG
AAGATGTTTCCAATGCAGAAAACATTGTGTCCGAGTTAGCATATTCCGTG
CAGGCAGCAAAAATTGAGAAAAACATTCTTCAACAAGTTTCAATGGAAAT
CAAAGATCACATTCATTCATTCATTCTCTTTTGTCAAAATAATTTAGGAT
CCGGAATTTCATTGACAGGATCTGCATCAAAATCAATAACGACACTAAAT
GATTTAAAATTTAAGATCAACTGTATAAAAGAAACGATAACGGAAATTTT
CAAAGAACAAAGATTTTATATTGACCATAGATTGCGGGAATTAAGTGCCT
ATGCTGACACGTCAGAGCAATTAGAGGAATTGGACAAAATACAAAGATAT
TGGTTGGAATCTATCGGAAAGTTGAATAAACGGATTGGACGTTTGGCAGA
TATCAATAAAAGAATCGAAGAGGTTGAAGCTACATTAAAAGAATATGAGG
TCCAGCCTTCAGAAAAGTTGCGAACGAAAGCGTTGAGATTCGTTACTCAA
CTCGAAGAGGAACTCAGTGTGAACCTACAAAAGGATAGACTGAGATTGAC
ATCTTGTGGACGTCTTGGAACTCAGGATACAAATATTTCTAAGAGTAATT
CTAACAATTCAGTGACCCAGTTATTAAACCAAGATATGCTCACTACACAT
GATAACTATCGAGAAAGTTTAAAGACAGTTCGTGAACAACTGAAAGAAAT
CGGACGTAGATTAAACTCTGTGAGAATTTACATTGATGACAGTCGTCGAG
GCTGTTTGTCAAAACTGTCAGAAAGAATTCAAGATATTGATGACAAGTTA
GCTGATTGTTCCCATATGCTCGCCGAGGTTCAATATATAATGGCGTCTGG
AATAGAGCATCAGAATACTGATTCAATTAATCTAAATTTTCTCATTGAAG
CTCAGAAAAAACGATTGGGAAAATATCAAAATGAATATCAAACTCATTTG
AACAAATGGATGGAAAACGCATCACGATGGCAAGAATTCATTGAGAAATT
GGAAAAATTACAAACCGATCTTCAAGCAATTGAACAAGATTTAATATCCT
TTGAAAATGGAATAAGCTTTAATGATCAGGAAATGACAGAGATTAAGAAA
AGCCTCAGTTTCTTTGAAAAGAAATTGGTTTCTCTTGAACAAGACGGTGA
TAATCTCTCTATTTCTTGCAACGATGCTGATGCGGACTTCCTCAGAAATC
GTTTATCTGATCTTCGGTCACGTTATACAATTTGTCTTCAGTCAAATCGT
TCTCCTCACATGAAGAAAATGACAGAAAATATTACCGAGAAAATCACCTG
CTCAAATGAACTCTACAATGGAAACAATTCAGATTATACATCAGATGAAA
AACTTTGCAATAATTACAATCAATTGAAACAGTCACATTCATCTGAGCTT
GATTTGAATGGAAACTCCATTCATAGTTCACAGGACAGTTTGCCGAATGA
CGATTATGAGACCTCATCAGGAGAGAGCAGTGAAGAATTGTCAACAATGA
TTGATGGAGCGGCCACAGTTTTGGCAGGAAATCTAAACAATTGGGCAAAA
TTAACCAGCAACATGCTTTTGGAGATTGCAGTTAATGAATTCACATCAAT
TGAAGAATTGGAAGACAAAATAACTGAAATCACTAAAGTTAAAAAGGAAT
CATTGGAAAGAATAGCTCAAATTTCACTGGGTATAGATAAACAATCCAAC
AGTGAAAATAACTCAATTAATGCTGAACTCTCTTCCCAATTGACCGATGA
GTCGAATTCGCAGCTATTAATGGCATATCAAGACTTGAAGAATCTTTTAT
ACATGAAAACTAACGAACTCAGTGAAATAAAAGTGCAATATTATCACATC
AAAGATAATTTGAAAACTCTAGAAAATCTTGCCGAAGAAATCGAATCAAA
ATTAATTTATCCGATTTCTGAACAGATGTTGGAAAATTTCAAATCTCAAT
TTATGGAATCAGACATTAGACTTTTGGAAAAGTTGATCAACAAATTACCA
GATGGGCTACGTCAAAATCTTGAGATATATTTCAACAATTTACAACCGAC
AATTAGATTTGTCCAATCAACAATTCAAGATAATAAAAAAGAAGCCATTC
TAACTAATGATGAATTTCATCTATCAGACTCCCAGATTACCCAAATGACC
CAGGAAAATATAAATCAAATAGCCTTACTATTGAAATCTATAAACACTTT
TATGGTCAATTCCAAAGTCAACTTGGGTCAAATTGAGGAAATAGAAAACT
GTTTGGATCATATTAGGATATTCCATAACCGGTTGGAAGAACACAGAAAT
ATTCTACAATCGATTTTGGAGAAAAAGTCAGTTTATTCCAGTCAAATTCC
AGATTCGGATTTCTCTGAAACAGTTGATAAAGTTGATCGATTATGGAACA
ATACGAAAGACAAATTGAAAGAACGAGAAGAAGAGTTGTTGAGCATTCAT
CATTTGAAAACAAAATTAGATGACACGGAAATGTCACTACGAAAATGGAT
GGAAGATTCAGAAGAGAAACTCAATCGACTTCTCTCGGAAGGTTTCAATC
TTAAGAATCAAAAGATTCTAGATGATTTAAAAATTGTAATTCCAAGTTGG
CAACAGACAATGAATGATTATCAATCCATGTCATATGAATTAAGGAATTC
TTTTACAGGAGAAAACTGCAAAGACTTAGAAGATAATTTAGAACAAATGA
ACAAACAATGGTCAACGATAATGAACAAATTAGCCCAATGCACCCGAGAG
TTGAATTCAATGCGCAGTCCTCAAGAACAGAAAAGTCATGGAGTTGAATT
AGCATCTGAAAAACCCCAGTCAACAGCTGCCGAAGTAAACAGCGGTATAA
GTATTGAAAAATTGTCTGGCTGGCTTTCCAGCCTTGAAGGTCAGTTAGAA
ACAATGGAAATGGGAATAGTCAGGTGGCGCAGCGGTAGCGGCTTAATTGC
GACCGGGAATGCTGATAAATTGAAATCGAAACTCATCAGTCAACTCAATG
ATTTGTATAATGAAATTGATCTATACAAGACTCAATTTCAATTATGCTCT
GAATCAGAGAAAAACGACTCAGAATATCAAATATCAAAAAGATGGAAAAT
ATTCAACGATAAAATCAATGAAACTAAACAATGTCTGGAAGGAACAATGG
AGAGTGGACATAATTTATTGACAAAGTTGCGACTGCTCAATGATTGGTTG
GCGCATAAAGAAGCGGACATGCTGGAACTGAAAGGAAACGTTTGCAACAC
ATTCAACACGGCACAAAATCAGCTTTTGAAATTCGAAAATTTCATTTCTG
ACATTGAAGCCCATCGAAATCAGATAGAAGAAGCCATTGAATTAGCACAA
AATCAAATAGGTGAAGCGATTGATTCAAACAAACTCATGGAGCAATCTCA
TACCGTCAATTTAGAATCCGAAGGTGAATCTGATAATTCGGACACCGGTT
CAAACGGAAACGTTCCTGATGACAAAAGTAAAAGACTTCACCGCAGACTC
CGACGTCATTCTCATTATATGAAAAGGAAATGGATTGAATTAAATTTAAA
AATGCGTGATTATTATGAATATTTCAAGAAAAAGTCTGTGATATTGAAAT
CCGTTGACATTCAAATAAAAGAGTGCAATCAGTTGTTATCGGAATTGGAA
TTCCATATTGATAATTGGTCGAATGTTGCCAATGTTAAACTTTCTGTGAT
TCCACAAGAAATGTCACAGACAAAGAGTCTTATTCAATCACTTCAACCAT
TATTGGAGAAAATAGCCGCAATTGAAACACAGAAAAGCCAATTGCAAAAC
ATGAAAGTCCCAATCAACGATGAAATATCCAAGGAATCCGAAAAGATAAC
ATCTCGAATATCATATATCAAGTCTCTTTGTGAGATGAGATTAAAACAAT
TACATCAGCAAGAAACATTGTCATTAAAACAAACCTCAAACAATGAAGAA
CCTCAAATTCCAATGTTTCACGAGTCATTAGAGTCAATGTCGAGAAAGAT
TGAAATGCCTTTAGGTTTGTCGGAAAATCGGAAATTTATTGAATTAGAAA
ACGAATCGGTCTCATATCCTTGGGAACGATGTCTTCATCCTTCAGGATCA
GAAGTGCCTTATTATAAAAATCATTCAACTCAAGATACTCAATGGGATCA
TCCGATCATGGCAGACTTGATCAAGTCATTTGATGAACTAAATTCCATCC
GATTTTCCGCCTATCGTACAGCTATGAAATTAAGAGCCCTTCAAAAATTG
CTATGTTTGGATTTTGTCGACATGAATCTCGTCTCCGATACTTTCAGATT
ATGCGGAGTCCATACATCAGCTGTCAATGAAAGATTATTGGATGTTGGTC
AAATAATTGTTTTCCTTGCATCTCTGTATCGGGCAGCAAACCAGAAAATT
ACCAAACGTAAAGAATCCCCAAACACAATTGCCAATGATGAATCGGATAA
ATTATCTCATTCGATTCTTGGTTGTGCTAGAGGCAGCAGTATTAGACATT
CACGATCAAAAGATAAATCTCATCATACTAGAAGTAATAGTTTTGGGGGA
TTTAAAGGCGAAAACGAAAAAGATGATATGGGCACTAAACCGAGCTGTAT
TAAAAGCCCATCAAAAACAATTCCTTCACAGGCGGCTATAATGAAATGCT
CAGGTATGGCAAATATTCCGAGTACTCGAACACTACTCTCAACTGGTGAG
TATGAAATTAATGTCGCAGTGTGTGTGGATCTTGCTCTCAATTGGTTGCT
TAATGTTTATGATAGTGCAAGAAATGGGAAAATACGCGTGTTATCATTGA
AAACTGCTATTGTTATTTTAACAAATGCTAGTTTAGATGAAAAATACAAA
TATCTATTTAGTTTAGTTTGCAACAATCAAGGACAATTGGACTCCCCTCG
ATTGACGGCAATTCTTACCGATTGCGTTTTGATTCCGAAACATTTGAATG
AATCTTCAAGTTTTGGAGCAGATAATGTTAAGCCAAGTGTCATTAGTTGT
TTTAAAAATGTTGATGATAAATTTGTCGAAAAATCTTTCGATAAAAAAGA
CACAACGTTTCAAAGAATTCGAGCATCTTTTAGAAGAAAGAAAAATAGTA
ACTCTGAAAACTCTAACGAAAAGAGCCCCGAATCGGGAAATCATCGGTTT
ATCCGACTGAGCAATTTTTTAGCTTGGTTAAGATTGGAACCACAATCTCT
AGTTTGGCTTCCGGTTCTCAATCGAATAATATCAGCTGAAAGTGCAGTTC
ATCAAGCTAAATGTGGAGTATGCAAGATCCAGCCAATTGTGGGATTACGA
TATCGATGCTTAAGATGTTTAAATTTTGATTTATGTCAGGCTTGTTTTTT
CTACAGCAAAACATCAAAGAGTCACAAAGTTTCACATCCCATGCAAGAAT
ATTGTAATGTGACATCATCAAGAGAAAATTTTCGGGATTATTCGAGAATA
TTTCGAAATAGGTTTCGGTCAAAAAGCCATATCAGACAACAAACTAAACT
TAGCTATCTTCCTGTGCAAAACGGTTCAAACCAAGATCGAATTGACTCAA
AAATCCCAACGGCTTCAGAAGTAAATCCAGAAATGATCTCAACTAACCAC
CAGATTCACTCGCGCGTTGAGCAATATGCTAACAGACTCGCTGAAGTGGA
ACAACTGAATAAATCCAACATCATAGTCAAATCGGGAAATGTTGAACCGA
AATATGAACCGCTATTATTATCCCAAGATTTCAATGGAGATTATAAGGAG
CGAAATAAAGACGATGAAGAACACAAGATTATATTCCAGCATACAGAAAC
TTTACGAAAGCATCAGCGAAATCAATCATTAACAATGAACAATCAACCTG
GCGTTTTTCAATCACAAAAAAGTCTCGATAAAACAAGTCCCAGTGTCCAT
ACCTTACCCCAAGTGAAACCAATAAGTTCTCAATACGCCATACCTCAAAA
TCAAAAGATCACTGGATTTAAAAAGTATTCTTATGAACAGGATTCATTAA
ATCCCAACAGTTTTTCTAATTCTGTTGTCAGTAGTGCAGATGATGTCAGA
GTTAGAAATAGTAACAGTAGCCTTAATCAAGTCATTCATGGACTGGAAAA
TCAAAAACGTCAATTAATGGCTGAATATGAACGGCTACAGTTACAAACTC
CAACGAACAATATCAATTCTACAATGAGTCCTATTTTATCTACTGATAAC
TCCTCACGTTACGCTGGGGCCGATTACAGTTTCGTTCAAGGCAATCGAAC
GATGCCTTATAATCAAAGTATACCTCCAATTGCCAATCGTAAAACAAATA
GAAGCCTTGTTCCAATGTCTCCTAATACTAGTCTTGATAGAACGAACTCA
TATTTACCACCGTCTGAAGATTTAGTAACGGAAGCAAGAATGCTTCGACA
GCACAAAGGGAGATTAGAAGCACGAATGGGAATGTTAGAGCAACACAATC
GCCAGCTAGAGGCTCAGCTTTCTCGTCTTAGACAATTAATTGACGAATCT
CCTAATAATCCAAATAATTTCATGCCATCATCAAATATAATTAATTCATT
TGGAAATAACTCATTAAATGTTGATCAAGATCCGGAAATGCTTACTGCGG
CGCAGTACGCAGCTTCCAAAAGGATAAATGAAATCAGTTCAATATCTCCT
ATCTATAATAATAGTCTTCGTTTTCAAAGTATTCCTGCAAATGATCCAAT
GACAAGAAATTACCAAAATCCATCAAGCATTTATTCTGGAACAAGAAGCA
CTCCAGTACAGAATTTTTATGGTAGTTTAGAAAGAGGTTCTTATAGAGGG
GTTAATGATTCGACTCCGGTTGGATTTAACTACCGAAATCCAAATGAACG
CTCTGGTCAATCAACTTTATCTCCAACTAATTTTGTTTCTAATTCCCATC
TAAAAGCTTCTTCGGAAACAGGTGGAAGTCTTTCAGAATCTGAATTTCAG
TTAATGTGTCGCAGTTTGGCTGATTCGTGTCCAGCAGTCACAGCAGCTCC
GACGCACGGGCAATCATCCAATAGTATTGGATCGTTGTTTCAAATGGCTG
GACAAGTTGGCAAAGCGGTTGGTCAACTTGTCAATGTCATGACGGATGAT
TTCAACAACAACCAAGACCGAGATTCACCAGGTTCAAAGACACCGACTTT
AAATACTAACAAACCTCCATTTTCATCGAAACCTATTTTCAATGAGGATT
TTATATTGCCGACATCAAACTCAATAATAAATCACTCTTCATCTAATTCG
AATTCAAATTACAACTGATGATTTTTACTAATCCTAAAGTGCTAAATAAT
TATTTCTTCATTATGTATATTTGGTGAAATTCCATTAGTTAATAATTATC
TATTACATTTAAACAAGATCATTATAAGGTCTTCCGAAAAGAAATTCAAC
AAAAACAATTTATTTGTATTGAAATTAATGTGATCATGATTTATTTTTAA
TGAGAATATCTTTATGTCAAAGTCTGGCTTAGATCATATCAGAAAATGTC
AGATTTATTAATGAATCGTATAAATTTATTACCTCTGGCTATAGTTTATC
GATTTAAACAATAAAACTATT
back to top

protein sequence of SMED30016950-orf-1

>SMED30016950-orf-1 ID=SMED30016950-orf-1|Name=SMED30016950-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=4213bp
MDKLENENTQQLVFAKWFNNKLKKLYQPSIESLINGFRSGRRFYSITNMI
CQNENLEIPEQLTDQQLISTGIENILAKFSTTLPQSLQDKIEELLNGDEK
IILSLAWWMITEYFAKQRSLSVNAIHSDTLFWCQQIAKGYRGVSVTNFTN
SWRDGCALLAILHYYKSSLFEFESRLSKNSGQNLTLGLHLANQEFGCMRL
LEVDNFTSSLILDWKSICLFVMELRERLSGTSQNDSQSCANEQMKITDSQ
IANPSFESLISNFNLDFSTIIQTLDTFFQHLEIAETRVKVHETFKDAKEV
LEAFKSEDDLFVQLKIIKESVVEHEALMEKLTKHQDSIQSILMKGNAILE
ITSLDNTPQLKTNINNKREIITNKWNELYNNSTEFQRKLHRSLYQMQMSF
LIKIETSIDQLEETRKNQKNFGNSIDLLKHQLKDNRTMEMKIESTEKYMT
ALKTFLIYSEDSDISDSDEDSQNKDDEQLKRISKSISDSSFEQHINSIGN
KWNELVSWVNSRYNSLQKILLAWRHFEEEIQGISDWLEERICTADQLLRK
SNKNQFNDFVNYTESKWGRMISSLDKCGQKIKDLCENESLVVSTVDNKID
EMIQNWNDASEKWRDSIDNWMGSDGKRRSNRASSFSDMSSENCYMRRKME
NVTRNTPSSQSDMNISDFPIQAGYKTKFENDAERMMSWLENSAEKLELIT
LESISPEERPSITEQRKTIDLVTKEINLEKSKKNMETIKRMGLMYQEDLN
KHGENTDEIEQLFEELDERWSYLENQLLKSRQKVLTVEISSQLDHETQEL
EKCIENANKFLQNIHYNKNLIEIDKLIKCATEFREKFIEKKIFLKQFTDK
YQVVKSDFSRINEEIFSKQISDLNQKVINQLQIIENEEIKMRNLKSIIEM
NLVETENFINNLSNIINEKLNINNFDDLEKNSIKYMSLKNTLESHFELLE
KISITDSSSRKHKILVELKKNCHNTKQRVDNRVNFLKDLSEKTAQWKSQT
MEFNHWLDEVSSYLDECEQQKYDEDDLINEAIKETEAGIQDMENLIPTLE
NIEKSTVNLEAYFENDLRVEIFNKKKNLQLKWENLHKRYLNFMEYLKKPL
FKNSSQSDPKYKTAPQKVAIIIESESRTEDSLIDIDMEHSNFSMESLDKS
SESFNDLGGVDSSGNIDREFLADIESWIRTSTEKLGNYSNIHNTEDLNIF
GQLVIEMQNQKLGYIEKLKQYISTDIFLEVNEKFENFCQFLENENQRFKD
SDYHLKDVKNILSGEDKWMGKVDRVMQQSFSCDHLDVEELSENIDEIEKV
VCDHSEEDFNRLEDLKYSLTNARILERSVSMEIEQIKEKSLVMKNKANKR
LGSLTQLLEHIQSVERRVCQMTTWIYDTTNLLKARIVADLLGADLPDEFE
ILKQNFMEWEKFLLEIEDLEKGKMYQGKKETSERLRLQRLKLQKSFRPLK
ELFSRYSRPADFEPRLDNLKREVNRVAEHIYLLDIISISIEDLENCETHA
KQFKETLIASESDLNYVYDLGKEIAERKEIEFPERFSLQLDSLKKRYYNL
LDQISEAEEKLSLARPLVVEIYEKQQLIDEILEKSEQDEKDFINFNSNFV
HDLLELAEKLKCYTDFENSELVRDMFDELKEKCDLFMKKIEEATNKHNFV
TNLDQLQNDADKLLMEIDQMDFSDKNKLEGKLDSLYIKTNQIKQAATQIV
SSDETFKSQGEMNKYSILENKIEKIFTAISEHKATNGHMAIEDQCTSDSI
EVEETILSNSASSLQNEIDSNLLKSRENSFGDSLSSPYSVEDVSNAENIV
SELAYSVQAAKIEKNILQQVSMEIKDHIHSFILFCQNNLGSGISLTGSAS
KSITTLNDLKFKINCIKETITEIFKEQRFYIDHRLRELSAYADTSEQLEE
LDKIQRYWLESIGKLNKRIGRLADINKRIEEVEATLKEYEVQPSEKLRTK
ALRFVTQLEEELSVNLQKDRLRLTSCGRLGTQDTNISKSNSNNSVTQLLN
QDMLTTHDNYRESLKTVREQLKEIGRRLNSVRIYIDDSRRGCLSKLSERI
QDIDDKLADCSHMLAEVQYIMASGIEHQNTDSINLNFLIEAQKKRLGKYQ
NEYQTHLNKWMENASRWQEFIEKLEKLQTDLQAIEQDLISFENGISFNDQ
EMTEIKKSLSFFEKKLVSLEQDGDNLSISCNDADADFLRNRLSDLRSRYT
ICLQSNRSPHMKKMTENITEKITCSNELYNGNNSDYTSDEKLCNNYNQLK
QSHSSELDLNGNSIHSSQDSLPNDDYETSSGESSEELSTMIDGAATVLAG
NLNNWAKLTSNMLLEIAVNEFTSIEELEDKITEITKVKKESLERIAQISL
GIDKQSNSENNSINAELSSQLTDESNSQLLMAYQDLKNLLYMKTNELSEI
KVQYYHIKDNLKTLENLAEEIESKLIYPISEQMLENFKSQFMESDIRLLE
KLINKLPDGLRQNLEIYFNNLQPTIRFVQSTIQDNKKEAILTNDEFHLSD
SQITQMTQENINQIALLLKSINTFMVNSKVNLGQIEEIENCLDHIRIFHN
RLEEHRNILQSILEKKSVYSSQIPDSDFSETVDKVDRLWNNTKDKLKERE
EELLSIHHLKTKLDDTEMSLRKWMEDSEEKLNRLLSEGFNLKNQKILDDL
KIVIPSWQQTMNDYQSMSYELRNSFTGENCKDLEDNLEQMNKQWSTIMNK
LAQCTRELNSMRSPQEQKSHGVELASEKPQSTAAEVNSGISIEKLSGWLS
SLEGQLETMEMGIVRWRSGSGLIATGNADKLKSKLISQLNDLYNEIDLYK
TQFQLCSESEKNDSEYQISKRWKIFNDKINETKQCLEGTMESGHNLLTKL
RLLNDWLAHKEADMLELKGNVCNTFNTAQNQLLKFENFISDIEAHRNQIE
EAIELAQNQIGEAIDSNKLMEQSHTVNLESEGESDNSDTGSNGNVPDDKS
KRLHRRLRRHSHYMKRKWIELNLKMRDYYEYFKKKSVILKSVDIQIKECN
QLLSELEFHIDNWSNVANVKLSVIPQEMSQTKSLIQSLQPLLEKIAAIET
QKSQLQNMKVPINDEISKESEKITSRISYIKSLCEMRLKQLHQQETLSLK
QTSNNEEPQIPMFHESLESMSRKIEMPLGLSENRKFIELENESVSYPWER
CLHPSGSEVPYYKNHSTQDTQWDHPIMADLIKSFDELNSIRFSAYRTAMK
LRALQKLLCLDFVDMNLVSDTFRLCGVHTSAVNERLLDVGQIIVFLASLY
RAANQKITKRKESPNTIANDESDKLSHSILGCARGSSIRHSRSKDKSHHT
RSNSFGGFKGENEKDDMGTKPSCIKSPSKTIPSQAAIMKCSGMANIPSTR
TLLSTGEYEINVAVCVDLALNWLLNVYDSARNGKIRVLSLKTAIVILTNA
SLDEKYKYLFSLVCNNQGQLDSPRLTAILTDCVLIPKHLNESSSFGADNV
KPSVISCFKNVDDKFVEKSFDKKDTTFQRIRASFRRKKNSNSENSNEKSP
ESGNHRFIRLSNFLAWLRLEPQSLVWLPVLNRIISAESAVHQAKCGVCKI
QPIVGLRYRCLRCLNFDLCQACFFYSKTSKSHKVSHPMQEYCNVTSSREN
FRDYSRIFRNRFRSKSHIRQQTKLSYLPVQNGSNQDRIDSKIPTASEVNP
EMISTNHQIHSRVEQYANRLAEVEQLNKSNIIVKSGNVEPKYEPLLLSQD
FNGDYKERNKDDEEHKIIFQHTETLRKHQRNQSLTMNNQPGVFQSQKSLD
KTSPSVHTLPQVKPISSQYAIPQNQKITGFKKYSYEQDSLNPNSFSNSVV
SSADDVRVRNSNSSLNQVIHGLENQKRQLMAEYERLQLQTPTNNINSTMS
PILSTDNSSRYAGADYSFVQGNRTMPYNQSIPPIANRKTNRSLVPMSPNT
SLDRTNSYLPPSEDLVTEARMLRQHKGRLEARMGMLEQHNRQLEAQLSRL
RQLIDESPNNPNNFMPSSNIINSFGNNSLNVDQDPEMLTAAQYAASKRIN
EISSISPIYNNSLRFQSIPANDPMTRNYQNPSSIYSGTRSTPVQNFYGSL
ERGSYRGVNDSTPVGFNYRNPNERSGQSTLSPTNFVSNSHLKASSETGGS
LSESEFQLMCRSLADSCPAVTAAPTHGQSSNSIGSLFQMAGQVGKAVGQL
VNVMTDDFNNNQDRDSPGSKTPTLNTNKPPFSSKPIFNEDFILPTSNSII
NHSSSNSNSNYN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR043145Znf_ZZ_sf
IPR036872CH_dom_sf
IPR036020WW_dom_sf
IPR000433Znf_ZZ
IPR001202WW_dom
IPR018159Spectrin/alpha-actinin
IPR011992EF-hand-dom_pair
IPR001715CH-domain
IPR015154EF-hand_dom_typ2
IPR015153EF-hand_dom_typ1
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0003779actin binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 749..769
NoneNo IPR availableCOILSCoilCoilcoord: 1540..1560
NoneNo IPR availableCOILSCoilCoilcoord: 2152..2172
NoneNo IPR availableCOILSCoilCoilcoord: 2889..2916
NoneNo IPR availableCOILSCoilCoilcoord: 2117..2144
NoneNo IPR availableCOILSCoilCoilcoord: 3926..3956
NoneNo IPR availableCOILSCoilCoilcoord: 2089..2109
NoneNo IPR availableCOILSCoilCoilcoord: 2782..2802
NoneNo IPR availableCOILSCoilCoilcoord: 1922..1942
NoneNo IPR availableCOILSCoilCoilcoord: 3812..3839
NoneNo IPR availableCOILSCoilCoilcoord: 1626..1673
NoneNo IPR availableCOILSCoilCoilcoord: 2404..2424
NoneNo IPR availableCOILSCoilCoilcoord: 2673..2700
NoneNo IPR availableCOILSCoilCoilcoord: 2324..2344
NoneNo IPR availableCOILSCoilCoilcoord: 2624..2644
NoneNo IPR availableCOILSCoilCoilcoord: 2007..2027
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 3337..3401
e-value: 5.4E-15
score: 57.1
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 287..399
e-value: 4.5E-12
score: 48.2
NoneNo IPR availableGENE3DG3DSA:2.20.70.10coord: 3135..3173
e-value: 2.7E-8
score: 35.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2926..2944
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 3285..3329
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2926..2956
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 3298..3320
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2711..2730
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2266..2286
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 4160..4181
NoneNo IPR availablePANTHERPTHR12268:SF15DYSTROPHINcoord: 3142..3255
coord: 3360..3464
NoneNo IPR availablePANTHERPTHR12268E3 UBIQUITIN-PROTEIN LIGASE KCMF1coord: 94..228
coord: 1232..2226
NoneNo IPR availablePANTHERPTHR12268E3 UBIQUITIN-PROTEIN LIGASE KCMF1coord: 3142..3255
coord: 3360..3464
NoneNo IPR availablePANTHERPTHR12268:SF15DYSTROPHINcoord: 302..1099
NoneNo IPR availablePANTHERPTHR12268E3 UBIQUITIN-PROTEIN LIGASE KCMF1coord: 302..1099
coord: 3506..3679
NoneNo IPR availablePANTHERPTHR12268:SF15DYSTROPHINcoord: 3506..3679
coord: 94..228
coord: 1232..2226
NoneNo IPR availablePANTHERPTHR12268:SF15DYSTROPHINcoord: 3890..3960
NoneNo IPR availablePANTHERPTHR12268E3 UBIQUITIN-PROTEIN LIGASE KCMF1coord: 3890..3960
NoneNo IPR availableCDDcd02334ZZ_dystrophincoord: 3543..3591
e-value: 7.26012E-26
score: 100.508
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 2817..2914
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 490..615
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 746..876
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 2579..2708
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 3518..3603
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 299..391
IPR001202WW domainSMARTSM00456ww_5coord: 3143..3177
e-value: 0.0012
score: 28.1
IPR001202WW domainPROSITEPS50020WW_DOMAIN_2coord: 3142..3177
score: 12.945
IPR001202WW domainCDDcd00201WWcoord: 3146..3175
e-value: 3.85734E-6
score: 44.0558
IPR000433Zinc finger, ZZ-typeSMARTSM00291zz_5coord: 3539..3584
e-value: 1.8E-10
score: 50.8
IPR000433Zinc finger, ZZ-typePFAMPF00569ZZcoord: 3541..3583
e-value: 8.9E-13
score: 47.8
IPR000433Zinc finger, ZZ-typePROSITEPS01357ZF_ZZ_1coord: 3545..3572
IPR000433Zinc finger, ZZ-typePROSITEPS50135ZF_ZZ_2coord: 3539..3586
score: 13.929
IPR018159Spectrin/alpha-actininSMARTSM00150SPEC_4coord: 2990..3092
e-value: 4.1
score: 3.6
coord: 676..785
e-value: 1.3
score: 9.0
coord: 2844..2972
e-value: 0.2
score: 18.1
coord: 291..390
e-value: 0.48
score: 13.9
coord: 2108..2223
e-value: 3.8
score: 3.9
IPR043145Zinc finger, ZZ-type superfamilyGENE3DG3DSA:3.30.60.90coord: 3534..3594
e-value: 7.5E-21
score: 75.4
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 1..114
e-value: 4.3E-6
score: 28.6
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 125..238
e-value: 1.6E-23
score: 84.7
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 4..224
IPR015153EF-hand domain, type 1PFAMPF09068EF-hand_2coord: 3179..3397
e-value: 1.3E-34
score: 119.0
IPR001715Calponin homology domainPFAMPF00307CHcoord: 130..225
e-value: 9.8E-8
score: 32.2
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 123..233
score: 15.417
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 8..114
score: 8.703
IPR015154EF-hand domain, type 2PFAMPF09069EF-hand_3coord: 3402..3533
e-value: 2.0E-25
score: 89.0
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 3402..3462
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 3174..3257
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 3359..3399
IPR036020WW domain superfamilySUPERFAMILYSSF51045WW domaincoord: 3145..3178