Scratch family zinc finger 2

Overview
NameScratch family zinc finger 2
Smed IDSMED30016942
Length (bp)1395
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Scratch family zinc finger 2 (SMED30016942) t-SNE clustered cells

Violin plots show distribution of expression levels for Scratch family zinc finger 2 (SMED30016942) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Scratch family zinc finger 2 (SMED30016942) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Scratch family zinc finger 2 (SMED30016942) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016942

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30016942SMESG000041786.1 SmedASXL_005968SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30016942SMESG000041786.1 SmedASXL_005968SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30016942SMESG000041786.1 SmedASXL_005968SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neuronSMED30016942SMESG000041786.1 dd_Smed_v4_18952_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30016942SMESG000041786.1 dd_Smed_v4_18952_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30016942SMESG000041786.1 dd_Smed_v6_18952_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
midlineSMED30016942SMESG000041786.1 KJ934813smed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30016942SMESG000041786.1 KJ934813smed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
head marginSMED30016942SMESG000041786.1 KJ934813smed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Scratch family zinc finger 2 vs. Ensembl Human
Match: SCRT1 (scratch family transcriptional repressor 1 [Source:HGNC Symbol;Acc:HGNC:15950])

HSP 1 Score: 243.432 bits (620), Expect = 3.564e-76
Identity = 105/133 (78.95%), Postives = 122/133 (91.73%), Query Frame = 1
Query:  871 ECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            ECGK YATSSNLSRHKQTHR+LDSQ AR+CP C K+YVSMPA++MH+LTHDLRH+C +CGKAFSRPWLLQGH R+HTGEKP+GCAHCG+AFADRSNLRAHMQTHS+ K ++C  CK++FALKSYLNKH ES+C
Sbjct:  195 ECGKTYATSSNLSRHKQTHRSLDSQLARRCPTCGKVYVSMPAMAMHLLTHDLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHFQCKRCKKSFALKSYLNKHYESAC 327          
BLAST of Scratch family zinc finger 2 vs. Ensembl Human
Match: SCRT1 (scratch family transcriptional repressor 1 [Source:HGNC Symbol;Acc:HGNC:15950])

HSP 1 Score: 243.432 bits (620), Expect = 3.564e-76
Identity = 105/133 (78.95%), Postives = 122/133 (91.73%), Query Frame = 1
Query:  871 ECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            ECGK YATSSNLSRHKQTHR+LDSQ AR+CP C K+YVSMPA++MH+LTHDLRH+C +CGKAFSRPWLLQGH R+HTGEKP+GCAHCG+AFADRSNLRAHMQTHS+ K ++C  CK++FALKSYLNKH ES+C
Sbjct:  195 ECGKTYATSSNLSRHKQTHRSLDSQLARRCPTCGKVYVSMPAMAMHLLTHDLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHFQCKRCKKSFALKSYLNKHYESAC 327          
BLAST of Scratch family zinc finger 2 vs. Ensembl Human
Match: SCRT2 (scratch family transcriptional repressor 2 [Source:HGNC Symbol;Acc:HGNC:15952])

HSP 1 Score: 234.187 bits (596), Expect = 3.851e-73
Identity = 105/136 (77.21%), Postives = 118/136 (86.76%), Query Frame = 1
Query:  853 QRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLE 1260
             R  C ECGK YATSSNLSRHKQTHR+LDSQ ARKCP C K YVSMPAL+MH+LTH+LRH+C +CGKAFSRPWLLQGH R+HTGEKP+GCAHCG+AFADRSNLRAHMQTHS+ K Y C  C ++FALKSYL+KH E
Sbjct:  153 HRHACAECGKTYATSSNLSRHKQTHRSLDSQLARKCPTCGKAYVSMPALAMHLLTHNLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHYRCRQCDKSFALKSYLHKHCE 288          
BLAST of Scratch family zinc finger 2 vs. Ensembl Human
Match: SNAI2 (snail family transcriptional repressor 2 [Source:HGNC Symbol;Acc:HGNC:11094])

HSP 1 Score: 178.333 bits (451), Expect = 3.947e-52
Identity = 97/217 (44.70%), Postives = 127/217 (58.53%), Query Frame = 1
Query:  655 SGFQTGVTVGYTYEAFF--ISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKI--------QRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCL 1275
            SG  + +TV  T   F   + +G S    +S+S+  +S            S     + +E     +K+        ++F C  C K Y+T S L++HKQ H    S+++  C +CDK YVS+ AL MHI TH L   C ICGKAFSRPWLLQGH R HTGEKP+ C HC RAFADRSNLRAH+QTHS +K Y+C  C + F+  S L+KH ES CC+
Sbjct:   50 SGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCV 266          
BLAST of Scratch family zinc finger 2 vs. Ensembl Human
Match: SNAI3 (snail family transcriptional repressor 3 [Source:HGNC Symbol;Acc:HGNC:18411])

HSP 1 Score: 171.014 bits (432), Expect = 5.577e-49
Identity = 82/141 (58.16%), Postives = 93/141 (65.96%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCLNP 1281
            F C  C K Y T + L+RH+Q H  L   +   C +CDK Y S+ AL MHI TH L   C ICGKAFSRPWLLQGH R HTGEKPY C+HC RAFADRSNLRAH+QTHS  K Y C  C + F+  S L +H ES CC  P
Sbjct:  152 FECFHCHKPYHTLAGLARHRQLHCHLQVGRVFTCKYCDKEYTSLGALKMHIRTHTLPCTCKICGKAFSRPWLLQGHVRTHTGEKPYACSHCSRAFADRSNLRAHLQTHSDAKKYRCRRCTKTFSRMSLLARHEESGCCPGP 292          
BLAST of Scratch family zinc finger 2 vs. Ensembl Celegans
Match: ces-1 (CES-1; CEll death Specification [Source:UniProtKB/TrEMBL;Acc:G5ECN8])

HSP 1 Score: 218.009 bits (554), Expect = 9.110e-68
Identity = 94/136 (69.12%), Postives = 117/136 (86.03%), Query Frame = 1
Query:  856 RFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLES 1263
            R VC +CGK+YAT+SNLSRHKQTHR LDS  A++CPHCD++YVSMPALSMHILTH+  H+C++CGK FSR WLLQGH R+HTG +P+ CAHCG++FADRSNLRAHM TH+  K +EC+ C R FAL++YLN+HLE+
Sbjct:  133 RCVCDKCGKSYATTSNLSRHKQTHRALDSPHAKQCPHCDRVYVSMPALSMHILTHNASHECNVCGKRFSRLWLLQGHLRSHTGLRPFSCAHCGKSFADRSNLRAHMLTHTGDKRFECDKCGRRFALRAYLNRHLET 268          

HSP 2 Score: 48.9062 bits (115), Expect = 2.933e-6
Identity = 28/85 (32.94%), Postives = 43/85 (50.59%), Query Frame = 1
Query: 1036 CDICGKAFSRPWLLQGHRRAHTG-EKPYG--CAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCLNP 1281
            CD CGK+++    L  H++ H   + P+   C HC R +     L  H+ TH++  ++ECN C + F+    L  HL S   L P
Sbjct:  136 CDKCGKSYATTSNLSRHKQTHRALDSPHAKQCPHCDRVYVSMPALSMHILTHNA--SHECNVCGKRFSRLWLLQGHLRSHTGLRP 218          
BLAST of Scratch family zinc finger 2 vs. Ensembl Celegans
Match: snai-1 (SNAIl family zinc finger 2 transcription factor homolog [Source:UniProtKB/TrEMBL;Acc:O45103])

HSP 1 Score: 148.673 bits (374), Expect = 3.436e-42
Identity = 75/140 (53.57%), Postives = 90/140 (64.29%), Query Frame = 1
Query:  853 QRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCC 1272
            Q+ VC  C K Y T   L RH Q H+    QQ+  CPHC K+Y S  AL MH+ TH L   C+ CGK+FSRPWLL+GH R HTGEKP+GC  CGR FADRSNLRAH+QTHS  K + C+ C ++FA      +H    CC
Sbjct:   39 QKLVCQFCKKTYLTYFGLRRHLQFHKEGKLQQS--CPHCKKVYRSPGALKMHLKTHSLPCVCNDCGKSFSRPWLLKGHLRTHTGEKPFGCEFCGRCFADRSNLRAHLQTHSGEKKHRCSRCGQSFARVQVRQRH--EQCC 174          
BLAST of Scratch family zinc finger 2 vs. Ensembl Celegans
Match: scrt-1 (SCRaTch (Zinc finger transcriptional repressor) homolog [Source:UniProtKB/TrEMBL;Acc:O01830])

HSP 1 Score: 117.087 bits (292), Expect = 1.134e-30
Identity = 51/79 (64.56%), Postives = 61/79 (77.22%), Query Frame = 1
Query: 1033 QCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            QC +CGK FSR WLLQGH R HTGEKP+ C  C + FAD+SNLRAH+QTHS  K ++C  C ++FALKSYL+KH ES C
Sbjct:   95 QCKVCGKRFSRQWLLQGHLRTHTGEKPFQCEICSKRFADKSNLRAHIQTHSGTKPHKCPRCGKSFALKSYLSKHEESKC 173          
BLAST of Scratch family zinc finger 2 vs. Ensembl Celegans
Match: pag-3 (Zinc finger protein PAG-3 [Source:UniProtKB/TrEMBL;Acc:G5EDE1])

HSP 1 Score: 99.7525 bits (247), Expect = 6.522e-23
Identity = 57/161 (35.40%), Postives = 86/161 (53.42%), Query Frame = 1
Query:  787 KDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTH-DLR-HQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLES 1263
            ++PES P+ +V         +I+ F C +C K ++T + L +H+Q H    S +  +C  C K +     LS H+L H D R + C+ CGK F +   ++ H   HTGEKP+ C  CG+AF+  SNL  H + H+  K + C+ C R F  K    +H ES
Sbjct:  103 QNPES-PSASVWNRTPTPPVEIKPFHCQKCTKLFSTIAALEQHQQVHV---SDKQFECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGFKPFACDVCGRTFQRKVDRRRHRES 259          
BLAST of Scratch family zinc finger 2 vs. Ensembl Celegans
Match: Y55F3AM.14 (pep chromosome:WBcel235:IV:1058845:1063187:-1 gene:WBGene00021931.1 transcript:Y55F3AM.14.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AM.14)

HSP 1 Score: 90.5077 bits (223), Expect = 4.655e-19
Identity = 53/151 (35.10%), Postives = 79/151 (52.32%), Query Frame = 1
Query:  814 TVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILT----HDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            TV E++A     I+ + C +C K  ++ S L  HK+TH      +  +C  C K +     L +H+      ++ +H C  C K F+    LQ H R HTGE+PY C  C +AFA + NL++H +TH+  + Y C  C+R F  KS L  H
Sbjct:  176 TVHEKSAH--LGIRNYKCPKCDKLLSSPSALYTHKKTH----GDKTFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAH 320          

HSP 2 Score: 78.9518 bits (193), Expect = 2.528e-15
Identity = 31/68 (45.59%), Postives = 46/68 (67.65%), Query Frame = 1
Query: 1027 RHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFA 1230
            RH C +CGK FS   +L+ H+R+HTGEKPY C  C + FA ++ L+ H +TH+  + Y+C  C++ FA
Sbjct:  103 RHICTVCGKGFSYFSILESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFA 170          

HSP 3 Score: 74.3294 bits (181), Expect = 7.131e-14
Identity = 53/164 (32.32%), Postives = 70/164 (42.68%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRH-KQTHRTLDSQQARK--CPHCDKIYVSMPALSMHILTH--DLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMK--------------------------TYECNACKRNFALKSYLNKHL 1257
            F C  C K +A  + L  H KQ H     Q  RK  C +C+K +    +L +H+ TH  +  + C  C KAF+    LQ H R HTGE+PY C  C R F  +S L AH  TH + K                           YEC  C + +   S L  H+
Sbjct:  216 FRCDFCPKTFALKNYLKLHVKQVHE----QNERKHVCVYCNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHESTHLTQKHSVNPDSTTADILPVAGSVTDHQMVGNYECTFCNKKYPYASSLYIHM 375          

HSP 4 Score: 52.7582 bits (125), Expect = 4.716e-7
Identity = 39/162 (24.07%), Postives = 62/162 (38.27%), Query Frame = 1
Query:  853 QRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTH--DLRHQCDICGKAFSRPWLLQGHRRAHTGEK--------------------------PYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            ++ VC  C K +A + +L  H +TH     ++   C  C K + S   L  H  TH  +  + C  C + F +   L  H   H  +K                           Y C  C + +   S+L  HM+ H+    Y C+ C + ++ K  LN H
Sbjct:  244 RKHVCVYCNKGFAYAGSLQVHVRTH---TGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHESTHLTQKHSVNPDSTTADILPVAGSVTDHQMVGNYECTFCNKKYPYASSLYIHMRKHTEKSAYSCDGCGKPYSQKISLNIH 402          
BLAST of Scratch family zinc finger 2 vs. Ensembl Fly
Match: scrt (gene:FBgn0004880 transcript:FBtr0333136)

HSP 1 Score: 262.307 bits (669), Expect = 3.250e-80
Identity = 127/214 (59.35%), Postives = 149/214 (69.63%), Query Frame = 1
Query:  628 IQSGRKRRKSGFQTGVTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            +Q G     SG  +  TV YTYEAFF+SDGRSK++  ++  +  S      G   P+                +  ++ C ECGK YATSSNLSRHKQTHR+LDSQ A+KC  C K YVSMPAL+MH+LTH L H C +CGK FSRPWLLQGH R+HTGEKPYGCAHCG+AFADRSNLRAHMQTHS  K +EC  C + FALKSYLNKHLES+C
Sbjct:  412 LQDGEHSGASG-ASAKTVAYTYEAFFVSDGRSKRKHVADPAAAAS------GVPTPDQ---------------QKTKYTCSECGKQYATSSNLSRHKQTHRSLDSQSAKKCHTCGKAYVSMPALAMHLLTHKLSHSCGVCGKLFSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSVDKNFECKRCHKTFALKSYLNKHLESAC 603          
BLAST of Scratch family zinc finger 2 vs. Ensembl Fly
Match: scrt (gene:FBgn0004880 transcript:FBtr0073165)

HSP 1 Score: 262.307 bits (669), Expect = 3.250e-80
Identity = 127/214 (59.35%), Postives = 149/214 (69.63%), Query Frame = 1
Query:  628 IQSGRKRRKSGFQTGVTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            +Q G     SG  +  TV YTYEAFF+SDGRSK++  ++  +  S      G   P+                +  ++ C ECGK YATSSNLSRHKQTHR+LDSQ A+KC  C K YVSMPAL+MH+LTH L H C +CGK FSRPWLLQGH R+HTGEKPYGCAHCG+AFADRSNLRAHMQTHS  K +EC  C + FALKSYLNKHLES+C
Sbjct:  412 LQDGEHSGASG-ASAKTVAYTYEAFFVSDGRSKRKHVADPAAAAS------GVPTPDQ---------------QKTKYTCSECGKQYATSSNLSRHKQTHRSLDSQSAKKCHTCGKAYVSMPALAMHLLTHKLSHSCGVCGKLFSRPWLLQGHLRSHTGEKPYGCAHCGKAFADRSNLRAHMQTHSVDKNFECKRCHKTFALKSYLNKHLESAC 603          
BLAST of Scratch family zinc finger 2 vs. Ensembl Fly
Match: CG12605 (gene:FBgn0035481 transcript:FBtr0073168)

HSP 1 Score: 239.965 bits (611), Expect = 1.494e-73
Identity = 105/137 (76.64%), Postives = 117/137 (85.40%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            + CCECGK YATSSNLSRHKQTHR+LDSQ A+KC  C K YVSMPAL+MH+LTH L H CDICGK FSRPWLLQGH R+HTGEKPY C HCG+AFADRSNLRAHMQTHS  K ++C+ C + FALKSYLNKHLES+C
Sbjct:  294 YKCCECGKQYATSSNLSRHKQTHRSLDSQSAKKCNTCGKAYVSMPALAMHLLTHKLSHSCDICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFALKSYLNKHLESAC 430          
BLAST of Scratch family zinc finger 2 vs. Ensembl Fly
Match: CG12605 (gene:FBgn0035481 transcript:FBtr0073166)

HSP 1 Score: 241.121 bits (614), Expect = 1.350e-72
Identity = 105/137 (76.64%), Postives = 117/137 (85.40%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            + CCECGK YATSSNLSRHKQTHR+LDSQ A+KC  C K YVSMPAL+MH+LTH L H CDICGK FSRPWLLQGH R+HTGEKPY C HCG+AFADRSNLRAHMQTHS  K ++C+ C + FALKSYLNKHLES+C
Sbjct:  439 YKCCECGKQYATSSNLSRHKQTHRSLDSQSAKKCNTCGKAYVSMPALAMHLLTHKLSHSCDICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFALKSYLNKHLESAC 575          
BLAST of Scratch family zinc finger 2 vs. Ensembl Fly
Match: CG12605 (gene:FBgn0035481 transcript:FBtr0333137)

HSP 1 Score: 241.121 bits (614), Expect = 1.350e-72
Identity = 105/137 (76.64%), Postives = 117/137 (85.40%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            + CCECGK YATSSNLSRHKQTHR+LDSQ A+KC  C K YVSMPAL+MH+LTH L H CDICGK FSRPWLLQGH R+HTGEKPY C HCG+AFADRSNLRAHMQTHS  K ++C+ C + FALKSYLNKHLES+C
Sbjct:  439 YKCCECGKQYATSSNLSRHKQTHRSLDSQSAKKCNTCGKAYVSMPALAMHLLTHKLSHSCDICGKLFSRPWLLQGHLRSHTGEKPYACVHCGKAFADRSNLRAHMQTHSGDKNFKCHRCNKTFALKSYLNKHLESAC 575          
BLAST of Scratch family zinc finger 2 vs. Ensembl Zebrafish
Match: scrt1a (scratch family zinc finger 1a [Source:ZFIN;Acc:ZDB-GENE-080219-30])

HSP 1 Score: 263.848 bits (673), Expect = 4.233e-85
Identity = 135/245 (55.10%), Postives = 164/245 (66.94%), Query Frame = 1
Query:  538 PVANS-SSNYQSPVYSDQDEKMSKSSKPEKLIQSGRKRRKSGFQTGVTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            P+ +S  S+Y +P   D D+  S    P+  I SG         T V+ GYT +AFFI+DGRS+++  S                                S   +QR  C ECGK YATSSNLSRHKQTHR+LDS+ A+KCP C K+YVSMPA++MH+LTHDL+H+CDICGKAFSRPWLLQGH R+HTGEKP+GCAHCG+AFADRSNLRAHMQTHS+ K Y+C  C + FALKSYLNKH ES+C
Sbjct:   65 PIYDSIHSDYGAP---DSDQPDS----PQSEISSGYING----DTAVSEGYTVDAFFITDGRSRRKAIS--------------------------------SPRTLQRHTCNECGKTYATSSNLSRHKQTHRSLDSKMAKKCPTCGKVYVSMPAMAMHLLTHDLKHKCDICGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHYKCKRCNKTFALKSYLNKHYESAC 266          
BLAST of Scratch family zinc finger 2 vs. Ensembl Zebrafish
Match: scrt1b (scratch family zinc finger 1b [Source:ZFIN;Acc:ZDB-GENE-050327-72])

HSP 1 Score: 261.151 bits (666), Expect = 3.784e-84
Identity = 124/208 (59.62%), Postives = 150/208 (72.12%), Query Frame = 1
Query:  655 SGFQTG---VTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            SG+  G   V+ GYT +AFFI+DGRS+++  S S +                                +QR  C ECGK YATSSNLSRHKQTHR+LDS+ A+KCP C K+YVSMPA++MH+LTHDL+H+CDICGKAFSRPWLLQGH R+HTGEKP+GCAHCG+AFADRSNLRAHMQTHS+ K ++C  C + FALKSYLNKH ES+C
Sbjct:   91 SGYINGDNAVSEGYTVDAFFITDGRSRRKVISGSRT--------------------------------LQRHTCNECGKTYATSSNLSRHKQTHRSLDSKMAKKCPTCGKVYVSMPAMAMHLLTHDLKHKCDICGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHFKCKRCNKTFALKSYLNKHYESAC 266          
BLAST of Scratch family zinc finger 2 vs. Ensembl Zebrafish
Match: scrt1b (scratch family zinc finger 1b [Source:ZFIN;Acc:ZDB-GENE-050327-72])

HSP 1 Score: 261.151 bits (666), Expect = 3.784e-84
Identity = 124/208 (59.62%), Postives = 150/208 (72.12%), Query Frame = 1
Query:  655 SGFQTG---VTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            SG+  G   V+ GYT +AFFI+DGRS+++  S S +                                +QR  C ECGK YATSSNLSRHKQTHR+LDS+ A+KCP C K+YVSMPA++MH+LTHDL+H+CDICGKAFSRPWLLQGH R+HTGEKP+GCAHCG+AFADRSNLRAHMQTHS+ K ++C  C + FALKSYLNKH ES+C
Sbjct:   91 SGYINGDNAVSEGYTVDAFFITDGRSRRKVISGSRT--------------------------------LQRHTCNECGKTYATSSNLSRHKQTHRSLDSKMAKKCPTCGKVYVSMPAMAMHLLTHDLKHKCDICGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHFKCKRCNKTFALKSYLNKHYESAC 266          
BLAST of Scratch family zinc finger 2 vs. Ensembl Zebrafish
Match: scrt2 (scratch family zinc finger 2 [Source:ZFIN;Acc:ZDB-GENE-030131-4097])

HSP 1 Score: 259.996 bits (663), Expect = 2.961e-83
Identity = 136/254 (53.54%), Postives = 163/254 (64.17%), Query Frame = 1
Query:  514 INLKILTLPVANSSSNYQSPVYSDQDEKMSKSSKPEKLIQSGRKRRK--SGFQTGVTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            +N ++L  PV++    Y  P     D             QSG   R   S     ++ GYT +AFFISDGRS+++     +S              E+  A  V +E         R  C ECGK YATSSNLSRHKQTHR+LDS+ ARKCP CDK+YVSMPAL+MHILTHDL+H+C +C KAFSRPWLLQGH R+HTGEKP+ CAHCG+AFADRSNLRAHMQTHS+ K Y C  C + FALKSYLNKH ES+C
Sbjct:   73 LNSELLYSPVSSGGGEYCQPDLEHPDSP-----------QSGLTARGYFSSESESLSEGYTMDAFFISDGRSRRK---GEVS--------------EAAKADEVEKEVVGVNNGGARHTCNECGKTYATSSNLSRHKQTHRSLDSKMARKCPTCDKVYVSMPALAMHILTHDLKHKCHVCSKAFSRPWLLQGHMRSHTGEKPFACAHCGKAFADRSNLRAHMQTHSAFKHYSCKRCNKTFALKSYLNKHYESAC 298          
BLAST of Scratch family zinc finger 2 vs. Ensembl Zebrafish
Match: snai2 (snail family zinc finger 2 [Source:ZFIN;Acc:ZDB-GENE-030326-6])

HSP 1 Score: 175.637 bits (444), Expect = 1.848e-51
Identity = 84/153 (54.90%), Postives = 107/153 (69.93%), Query Frame = 1
Query:  823 EEAAEST--TKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCL 1275
            +E  +ST  +  ++F C  C K+Y+T S L +HKQ H    S+++  C +C+K YVS+ AL MHI TH L   C +CGKAFSRPWLLQGH R HTGEKP+ C HC RAFADRSNLRAH+QTHS +K Y+C  C + F+  S L+KH ES CC+
Sbjct:  103 DERIQSTKLSDAEKFQCGLCNKSYSTYSGLMKHKQLHCDAQSRKSFSCKYCEKEYVSLGALKMHIRTHTLPCVCKMCGKAFSRPWLLQGHIRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCI 255          
BLAST of Scratch family zinc finger 2 vs. Ensembl Xenopus
Match: SCRT1 (scratch family transcriptional repressor 1 [Source:HGNC Symbol;Acc:HGNC:15950])

HSP 1 Score: 252.677 bits (644), Expect = 3.700e-81
Identity = 124/214 (57.94%), Postives = 149/214 (69.63%), Query Frame = 1
Query:  634 SGRKRRKSGFQTG---VTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESS 1266
            S R     G+  G   V+ GY+ +AFFI+DGRS+++  S   S                                IQR  C ECGK+YATSSNLSRHKQTHR+LDS+ A+KCP C K+YVSMPA++MH+LTHDL+H+C+ CGKAFSRPWLLQGH R+HTGEKP+GCAHCG+AFADRSNLRAHMQTHS+ K Y+C  C + FALKSYLNKH ESS
Sbjct:   61 SPRSEITGGYINGDAAVSEGYSVDAFFITDGRSRRKVLSGGRS--------------------------------IQRHSCSECGKSYATSSNLSRHKQTHRSLDSKLAKKCPTCGKVYVSMPAMAMHLLTHDLKHKCETCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHYKCKRCSKTFALKSYLNKHYESS 242          
BLAST of Scratch family zinc finger 2 vs. Ensembl Xenopus
Match: srpk2 (SRSF protein kinase 2 [Source:Xenbase;Acc:XB-GENE-990797])

HSP 1 Score: 176.792 bits (447), Expect = 1.333e-51
Identity = 82/141 (58.16%), Postives = 101/141 (71.63%), Query Frame = 1
Query:  853 QRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCL 1275
            ++F C  C K Y+T S L++HKQ H    S+++  C +C+K YVS+ AL MHI TH L   C ICGKAFSRPWLLQGH R HTGEKP+ C HC RAFADRSNLRAH+QTHS +K Y+C  C + F+  S L+KH ES CC+
Sbjct:  124 EKFQCSLCSKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCEKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCV 264          
BLAST of Scratch family zinc finger 2 vs. Ensembl Xenopus
Match: snai1 (snail family zinc finger 1 [Source:NCBI gene;Acc:394880])

HSP 1 Score: 178.333 bits (451), Expect = 2.631e-51
Identity = 82/146 (56.16%), Postives = 105/146 (71.92%), Query Frame = 1
Query:  832 AESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            A S T+ ++F C +C K+Y+T + LS+HKQ H    ++++  C +C+K YVS+ AL MHI +H L   C ICGKAFSRPWLLQGH R HTGEKP+ C HC RAFADRSNLRAH+QTHS +K Y+C  C R F+  S L+KH E+ C
Sbjct:  187 ASSATEAEKFQCNQCSKSYSTFAGLSKHKQLHCDSQARKSFSCKYCEKEYVSLGALKMHIRSHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCTHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSRTFSRMSLLHKHEETGC 332          
BLAST of Scratch family zinc finger 2 vs. Ensembl Xenopus
Match: SNAI3 (snail family zinc finger 3 [Source:NCBI gene;Acc:100488776])

HSP 1 Score: 151.369 bits (381), Expect = 7.337e-42
Identity = 73/134 (54.48%), Postives = 86/134 (64.18%), Query Frame = 1
Query:  871 ECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCC 1272
            EC   + T   L+ +K       + +   C HC K Y S+ AL MHI TH L   C ICGKAFSRPWLLQGH R HTGEKP+ C HCGR FADRSNLRAH+QTHS +K Y+C  C + F+  S L KH + SCC
Sbjct:  142 ECSDFHITYGMLANNKTQQCHGPAHRLFTCQHCAKAYSSLGALKMHIRTHTLPCTCRICGKAFSRPWLLQGHIRTHTGEKPFSCFHCGRGFADRSNLRAHLQTHSEIKRYQCPGCGKTFSRISLLAKHRDGSCC 275          
BLAST of Scratch family zinc finger 2 vs. Ensembl Xenopus
Match: ddx58 (DEXD/H-box helicase 58 [Source:Xenbase;Acc:XB-GENE-980097])

HSP 1 Score: 104.76 bits (260), Expect = 1.868e-23
Identity = 53/134 (39.55%), Postives = 75/134 (55.97%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHD--LRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            + C  CGK +A+  NL RH   HRT   ++   CP C + + S   L +H  TH       C  CGK+F+    L+ H R HTGEKPY C  CG+ F++R NL +H +TH+  K Y C  C + F  +S+L++H
Sbjct:  390 YPCSYCGKFFASQPNLDRH---HRTHTGEKPFPCPECGRCFASSSELIVHQRTHTGVKPFPCPECGKSFTNSTRLRDHHRTHTGEKPYPCPECGKCFSNRINLASHKKTHTGEKPYFCTECGKCFGKQSHLSRH 520          

HSP 2 Score: 102.064 bits (253), Expect = 1.472e-22
Identity = 54/139 (38.85%), Postives = 75/139 (53.96%), Query Frame = 1
Query:  844 TKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTH--DLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            T ++ F C ECGK++  S+ L  H   HRT   ++   CP C K + +   L+ H  TH  +  + C  CGK F +   L  H+R HTGEKPY C  CG+ F+DRS L  H  TH+  K + C  C + F+ K+ L  H
Sbjct:  441 TGVKPFPCPECGKSFTNSTRLRDH---HRTHTGEKPYPCPECGKCFSNRINLASHKKTHTGEKPYFCTECGKCFGKQSHLSRHKRTHTGEKPYPCLECGKRFSDRSVLNKHQITHTGEKPFPCTICGKCFSYKNNLKTH 576          

HSP 3 Score: 101.293 bits (251), Expect = 3.051e-22
Identity = 54/134 (40.30%), Postives = 75/134 (55.97%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTH--DLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            F C ECG+ +A+SS L  H++TH  +   +   CP C K + +   L  H  TH  +  + C  CGK FS    L  H++ HTGEKPY C  CG+ F  +S+L  H +TH+  K Y C  C + F+ +S LNKH
Sbjct:  418 FPCPECGRCFASSSELIVHQRTHTGV---KPFPCPECGKSFTNSTRLRDHHRTHTGEKPYPCPECGKCFSNRINLASHKKTHTGEKPYFCTECGKCFGKQSHLSRHKRTHTGEKPYPCLECGKRFSDRSVLNKH 548          

HSP 4 Score: 79.337 bits (194), Expect = 4.028e-15
Identity = 39/101 (38.61%), Postives = 52/101 (51.49%), Query Frame = 1
Query:  958 CPHCDKIYVSMPALSMH--ILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            CP C + +   P L  H  I T +  + C  CGK F+    L  H R HTGEKP+ C  CGR FA  S L  H +TH+ +K + C  C ++F   + L  H
Sbjct:  364 CPDCGRCFSHRPNLERHQRIHTGEKPYPCSYCGKFFASQPNLDRHHRTHTGEKPFPCPECGRCFASSSELIVHQRTHTGVKPFPCPECGKSFTNSTRLRDH 464          

HSP 5 Score: 73.1738 bits (178), Expect = 3.435e-13
Identity = 41/111 (36.94%), Postives = 60/111 (54.05%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTH--DLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHS 1185
            + C ECGK ++   NL+ HK+TH     ++   C  C K +     LS H  TH  +  + C  CGK FS   +L  H+  HTGEKP+ C  CG+ F+ ++NL+ H   H+
Sbjct:  474 YPCPECGKCFSNRINLASHKKTH---TGEKPYFCTECGKCFGKQSHLSRHKRTHTGEKPYPCLECGKRFSDRSVLNKHQITHTGEKPFPCTICGKCFSYKNNLKTHSYLHN 581          

HSP 6 Score: 72.4034 bits (176), Expect = 5.938e-13
Identity = 35/76 (46.05%), Postives = 45/76 (59.21%), Query Frame = 1
Query: 1027 RHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            R  C  CG+ FS    L+ H+R HTGEKPY C++CG+ FA + NL  H +TH+  K + C  C R FA  S L  H
Sbjct:  361 RFPCPDCGRCFSHRPNLERHQRIHTGEKPYPCSYCGKFFASQPNLDRHHRTHTGEKPFPCPECGRCFASSSELIVH 436          
BLAST of Scratch family zinc finger 2 vs. Ensembl Mouse
Match: Scrt1 (scratch family zinc finger 1 [Source:MGI Symbol;Acc:MGI:2176606])

HSP 1 Score: 250.751 bits (639), Expect = 4.090e-79
Identity = 122/220 (55.45%), Postives = 151/220 (68.64%), Query Frame = 1
Query:  673 VTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPES---------------------VPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            V+ GY  +AFFI+DGRS+++  + + +     +                               V A T     + +T    R  C ECGK YATSSNLSRHKQTHR+LDSQ AR+CP C K+YVSMPA++MH+LTHDLRH+C +CGKAFSRPWLLQGH R+HTGEKP+GCAHCG+AFADRSNLRAHMQTHS+ K ++C  CK++FALKSYLNKH ES+C
Sbjct:  108 VSEGYAADAFFITDGRSRRKAANANAAAAPSTASVAAPDSDAGGGGGPGTRGSGSGSASRGGTRVGAGTEARAGSGATGAGGRHACGECGKTYATSSNLSRHKQTHRSLDSQLARRCPTCGKVYVSMPAMAMHLLTHDLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHFQCKRCKKSFALKSYLNKHYESAC 327          
BLAST of Scratch family zinc finger 2 vs. Ensembl Mouse
Match: Scrt1 (scratch family zinc finger 1 [Source:MGI Symbol;Acc:MGI:2176606])

HSP 1 Score: 250.751 bits (639), Expect = 4.090e-79
Identity = 122/220 (55.45%), Postives = 151/220 (68.64%), Query Frame = 1
Query:  673 VTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPES---------------------VPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            V+ GY  +AFFI+DGRS+++  + + +     +                               V A T     + +T    R  C ECGK YATSSNLSRHKQTHR+LDSQ AR+CP C K+YVSMPA++MH+LTHDLRH+C +CGKAFSRPWLLQGH R+HTGEKP+GCAHCG+AFADRSNLRAHMQTHS+ K ++C  CK++FALKSYLNKH ES+C
Sbjct:  108 VSEGYAADAFFITDGRSRRKAANANAAAAPSTASVAAPDSDAGGGGGPGTRGSGSGSASRGGTRVGAGTEARAGSGATGAGGRHACGECGKTYATSSNLSRHKQTHRSLDSQLARRCPTCGKVYVSMPAMAMHLLTHDLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHFQCKRCKKSFALKSYLNKHYESAC 327          
BLAST of Scratch family zinc finger 2 vs. Ensembl Mouse
Match: Scrt2 (scratch family zinc finger 2 [Source:MGI Symbol;Acc:MGI:2139287])

HSP 1 Score: 240.35 bits (612), Expect = 1.541e-75
Identity = 106/139 (76.26%), Postives = 121/139 (87.05%), Query Frame = 1
Query:  853 QRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
             R  C ECGK YATSSNLSRHKQTHR+LDSQ ARKCP C K YVSMPAL+MH+LTH+LRH+C +CGKAFSRPWLLQGH R+HTGEKP+GCAHCG+AFADRSNLRAHMQTHS+ K Y C  C ++FALKSYL+KH E++C
Sbjct:  159 HRHACAECGKTYATSSNLSRHKQTHRSLDSQLARKCPTCGKAYVSMPALAMHVLTHNLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAAC 297          
BLAST of Scratch family zinc finger 2 vs. Ensembl Mouse
Match: Snai2 (snail family zinc finger 2 [Source:MGI Symbol;Acc:MGI:1096393])

HSP 1 Score: 177.948 bits (450), Expect = 4.078e-52
Identity = 83/141 (58.87%), Postives = 101/141 (71.63%), Query Frame = 1
Query:  853 QRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCL 1275
            ++F C  C K Y+T S L++HKQ H    S+++  C +CDK YVS+ AL MHI TH L   C ICGKAFSRPWLLQGH R HTGEKP+ C HC RAFADRSNLRAH+QTHS +K Y+C  C + F+  S L+KH ES CC+
Sbjct:  127 EKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCV 267          
BLAST of Scratch family zinc finger 2 vs. Ensembl Mouse
Match: Snai3 (snail family zinc finger 3 [Source:MGI Symbol;Acc:MGI:1353563])

HSP 1 Score: 169.859 bits (429), Expect = 8.781e-49
Identity = 82/151 (54.30%), Postives = 100/151 (66.23%), Query Frame = 1
Query:  832 AESTTKIQ-RFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCLNP 1281
            AE T+++   F C  C + Y T + L+RH+Q H  L + +A  C +CDK Y S+ AL MHI TH L   C +CGKAFSRPWLLQGH R HTGEKPY C+HC RAFADRSNLRAH+QTH   K Y C  C + F+  S L +H E+ CC  P
Sbjct:  137 AEGTSRVPGSFECIHCHRPYHTLAGLARHQQLHCHLPTGRAFTCRYCDKEYASLGALKMHIRTHTLPCICKVCGKAFSRPWLLQGHIRTHTGEKPYTCSHCSRAFADRSNLRAHLQTHVGTKKYRCAVCPKAFSRMSLLARHEEAGCCPGP 287          
BLAST of Scratch family zinc finger 2 vs. UniProt/SwissProt
Match: sp|Q99M85|SCRT1_MOUSE (Transcriptional repressor scratch 1 OS=Mus musculus OX=10090 GN=Scrt1 PE=1 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 2.861e-78
Identity = 122/220 (55.45%), Postives = 151/220 (68.64%), Query Frame = 1
Query:  673 VTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPES---------------------VPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            V+ GY  +AFFI+DGRS+++  + + +     +                               V A T     + +T    R  C ECGK YATSSNLSRHKQTHR+LDSQ AR+CP C K+YVSMPA++MH+LTHDLRH+C +CGKAFSRPWLLQGH R+HTGEKP+GCAHCG+AFADRSNLRAHMQTHS+ K ++C  CK++FALKSYLNKH ES+C
Sbjct:  108 VSEGYAADAFFITDGRSRRKAANANAAAAPSTASVAAPDSDAGGGGGPGTRGSGSGSASRGGTRVGAGTEARAGSGATGAGGRHACGECGKTYATSSNLSRHKQTHRSLDSQLARRCPTCGKVYVSMPAMAMHLLTHDLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHFQCKRCKKSFALKSYLNKHYESAC 327          
BLAST of Scratch family zinc finger 2 vs. UniProt/SwissProt
Match: sp|Q9BWW7|SCRT1_HUMAN (Transcriptional repressor scratch 1 OS=Homo sapiens OX=9606 GN=SCRT1 PE=1 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 1.139e-75
Identity = 105/133 (78.95%), Postives = 122/133 (91.73%), Query Frame = 1
Query:  871 ECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            ECGK YATSSNLSRHKQTHR+LDSQ AR+CP C K+YVSMPA++MH+LTHDLRH+C +CGKAFSRPWLLQGH R+HTGEKP+GCAHCG+AFADRSNLRAHMQTHS+ K ++C  CK++FALKSYLNKH ES+C
Sbjct:  195 ECGKTYATSSNLSRHKQTHRSLDSQLARRCPTCGKVYVSMPAMAMHLLTHDLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHFQCKRCKKSFALKSYLNKHYESAC 327          
BLAST of Scratch family zinc finger 2 vs. UniProt/SwissProt
Match: sp|Q8BTH6|SCRT2_MOUSE (Transcriptional repressor scratch 2 OS=Mus musculus OX=10090 GN=Scrt2 PE=2 SV=2)

HSP 1 Score: 240.35 bits (612), Expect = 1.078e-74
Identity = 106/139 (76.26%), Postives = 121/139 (87.05%), Query Frame = 1
Query:  853 QRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
             R  C ECGK YATSSNLSRHKQTHR+LDSQ ARKCP C K YVSMPAL+MH+LTH+LRH+C +CGKAFSRPWLLQGH R+HTGEKP+GCAHCG+AFADRSNLRAHMQTHS+ K Y C  C ++FALKSYL+KH E++C
Sbjct:  159 HRHACAECGKTYATSSNLSRHKQTHRSLDSQLARKCPTCGKAYVSMPALAMHVLTHNLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAAC 297          
BLAST of Scratch family zinc finger 2 vs. UniProt/SwissProt
Match: sp|Q9NQ03|SCRT2_HUMAN (Transcriptional repressor scratch 2 OS=Homo sapiens OX=9606 GN=SCRT2 PE=2 SV=3)

HSP 1 Score: 234.187 bits (596), Expect = 1.849e-72
Identity = 105/136 (77.21%), Postives = 118/136 (86.76%), Query Frame = 1
Query:  853 QRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLE 1260
             R  C ECGK YATSSNLSRHKQTHR+LDSQ ARKCP C K YVSMPAL+MH+LTH+LRH+C +CGKAFSRPWLLQGH R+HTGEKP+GCAHCG+AFADRSNLRAHMQTHS+ K Y C  C ++FALKSYL+KH E
Sbjct:  153 HRHACAECGKTYATSSNLSRHKQTHRSLDSQLARKCPTCGKAYVSMPALAMHLLTHNLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHYRCRQCDKSFALKSYLHKHCE 288          
BLAST of Scratch family zinc finger 2 vs. UniProt/SwissProt
Match: sp|O43623|SNAI2_HUMAN (Zinc finger protein SNAI2 OS=Homo sapiens OX=9606 GN=SNAI2 PE=1 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 1.895e-51
Identity = 97/217 (44.70%), Postives = 127/217 (58.53%), Query Frame = 1
Query:  655 SGFQTGVTVGYTYEAFF--ISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKI--------QRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCL 1275
            SG  + +TV  T   F   + +G S    +S+S+  +S            S     + +E     +K+        ++F C  C K Y+T S L++HKQ H    S+++  C +CDK YVS+ AL MHI TH L   C ICGKAFSRPWLLQGH R HTGEKP+ C HC RAFADRSNLRAH+QTHS +K Y+C  C + F+  S L+KH ES CC+
Sbjct:   50 SGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCV 266          
BLAST of Scratch family zinc finger 2 vs. TrEMBL
Match: W6UQD6 (Transcriptional repressor scratch OS=Echinococcus granulosus OX=6210 GN=EGR_01048 PE=4 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 2.745e-101
Identity = 150/218 (68.81%), Postives = 176/218 (80.73%), Query Frame = 1
Query:  625 LIQSGRKRRKSGFQTGVTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQ-----RFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLES 1263
            + + G+KRRKSGFQ G+TVGYTY+AFF+SDGRS+KRK +    GI+          P S  +    E A+  +T +Q     RF C ECGK+YATSSNLSRHKQTHR+LDSQ A+KCPHC K+YVSMPALSMHILTH+L+HQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSS++ +EC  CK+ FAL++YLNKHLE+
Sbjct:    1 MTKLGQKRRKSGFQAGITVGYTYDAFFVSDGRSRKRKCAELSEGINV---------PSSSSSSESSECASRVSTPLQTSLPPRFTCSECGKHYATSSNLSRHKQTHRSLDSQLAKKCPHCGKLYVSMPALSMHILTHNLKHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSLRLHECTHCKKQFALRAYLNKHLET 209          
BLAST of Scratch family zinc finger 2 vs. TrEMBL
Match: A0A068WH47 (Zinc finger C2H2 type OS=Echinococcus granulosus OX=6210 GN=EgrG_000472200 PE=4 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 5.708e-101
Identity = 150/218 (68.81%), Postives = 176/218 (80.73%), Query Frame = 1
Query:  625 LIQSGRKRRKSGFQTGVTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQ-----RFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLES 1263
            + + G+KRRKSGFQ G+TVGYTY+AFF+SDGRS+KRK +    GI+          P S  +    E A+  +T +Q     RF C ECGK+YATSSNLSRHKQTHR+LDSQ A+KCPHC K+YVSMPALSMHILTH+L+HQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSS++ +EC  CK+ FAL++YLNKHLE+
Sbjct:   43 MTKLGQKRRKSGFQAGITVGYTYDAFFVSDGRSRKRKCAELSEGINV---------PSSSSSSESSECASRVSTPLQTSLPPRFTCSECGKHYATSSNLSRHKQTHRSLDSQLAKKCPHCGKLYVSMPALSMHILTHNLKHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSLRLHECTHCKKQFALRAYLNKHLET 251          
BLAST of Scratch family zinc finger 2 vs. TrEMBL
Match: A0A0R3W3I3 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4479 PE=4 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 6.047e-101
Identity = 150/221 (67.87%), Postives = 179/221 (81.00%), Query Frame = 1
Query:  625 LIQSGRKRRKSGFQTGVTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEE---AAESTTKIQ-----RFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLES 1263
            + +SG+KRRKSGFQ G+TVGYTY+AFF+SDGRS+KRK + S  G++             VP+ +  E    A+  +T +Q     RF C ECGK+YATSSNLSRHKQTHR+LDSQ A+KCPHC K+YVSMPALSMHILTH+L+HQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHS+++ +EC  CK+ FAL++YLNKHLE+
Sbjct:   73 IAKSGQKRRKSGFQAGITVGYTYDAFFVSDGRSRKRKCAESSEGVN-------------VPSSSSSESSECASRVSTPLQTSLPPRFTCSECGKHYATSSNLSRHKQTHRSLDSQLAKKCPHCGKLYVSMPALSMHILTHNLKHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSALRLHECTHCKKQFALRAYLNKHLET 280          
BLAST of Scratch family zinc finger 2 vs. TrEMBL
Match: A0A068XYG9 (Zinc finger C2H2 type OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000472200 PE=4 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 7.651e-101
Identity = 153/234 (65.38%), Postives = 182/234 (77.78%), Query Frame = 1
Query:  625 LIQSGRKRRKSGFQTGVTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQ-----RFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCLNP*IIVQEYFTD 1311
            + + G+KRRKSGFQ G+TVGYTY+AFF+SDGRS+KRK +    GI+          P S  +    E A+  +T +Q     RF C ECGK+YATSSNLSRHKQTHR+LDSQ A+KCPHC K+YVSMPALSMHILTH+L+HQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSS++ +EC  CK+ FAL++YLNKHLE +C  N  ++     T+
Sbjct:   43 ITKLGQKRRKSGFQAGITVGYTYDAFFVSDGRSRKRKCAELSEGINV---------PSSSSSSESSECASRVSTPLQTSLPPRFTCSECGKHYATSSNLSRHKQTHRSLDSQLAKKCPHCGKLYVSMPALSMHILTHNLKHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSLRLHECAHCKKQFALRAYLNKHLE-TCGRNATLVPSSTITN 266          
BLAST of Scratch family zinc finger 2 vs. TrEMBL
Match: A0A183TBQ3 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 PE=4 SV=1)

HSP 1 Score: 317.39 bits (812), Expect = 2.081e-100
Identity = 161/275 (58.55%), Postives = 191/275 (69.45%), Query Frame = 1
Query:  601 SKSSKPEKLIQSGR-----KRRKSGFQTGVTVGYTYEAFFISDGRSKKRKFSNSI----------------------SGISKYSFKKGKK----------------DPESVPALT--------VIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCC 1272
            S  S+P++    GR     K+RKSGFQ GVTVGYTYEAFF+SDGRS+KR+  +SI                       G++  S + GK+                D +S  ++T        ++    ++++  QRF C ECGK+YATSSNLSRHKQTHR+LDSQ A+KCPHC K+YVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHS++K +EC  CK+ FALK+YL KHLE SCC
Sbjct:  114 SMRSQPKREGSRGRDSQTLKKRKSGFQAGVTVGYTYEAFFVSDGRSRKRRSFDSIVRGSNAVSELVSPGKTASTSLSEGLTSESVEYGKQVSVPSITSSPSPSSGFDSQSCTSITPPVVRSGLLLASPDDASSHSQRFTCAECGKHYATSSNLSRHKQTHRSLDSQLAKKCPHCGKLYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSTLKHFECPRCKKTFALKTYLTKHLELSCC 388          
BLAST of Scratch family zinc finger 2 vs. Ensembl Cavefish
Match: scrt1a (transcriptional repressor scratch 1-like [Source:NCBI gene;Acc:103041010])

HSP 1 Score: 258.455 bits (659), Expect = 3.874e-83
Identity = 130/239 (54.39%), Postives = 160/239 (66.95%), Query Frame = 1
Query:  568 SPVYS--DQDEKMSKSSKPEKLIQSGRKRRKSGFQTG---VTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            SP+Y     D     S +P+    S R    SG+  G   V+ GY  +AFFI+DGRS+++    S+ G                               +QR  C ECGK YATSSNLSRHKQTHR++DS+ A+KCP C K+YVSMPA++MH+LTHDL+H+CD+CGKAFSRPWLLQGH R+HTGEKP+GCAHCG+AFADRSNLRAHMQTHS+ K Y+C  C + FALKSYLNKH ES+C
Sbjct:   64 SPIYERIHGDYGAPDSDQPD----SPRSEVSSGYINGDNAVSEGYAVDAFFITDGRSRRK----SVGG----------------------------GRTLQRHTCNECGKTYATSSNLSRHKQTHRSMDSKMAKKCPTCGKVYVSMPAMAMHLLTHDLKHKCDVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHYKCKRCNKTFALKSYLNKHYESAC 266          
BLAST of Scratch family zinc finger 2 vs. Ensembl Cavefish
Match: SCRT1 (transcriptional repressor scratch 1-like [Source:NCBI gene;Acc:103031082])

HSP 1 Score: 254.218 bits (648), Expect = 1.650e-81
Identity = 122/199 (61.31%), Postives = 144/199 (72.36%), Query Frame = 1
Query:  673 VTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            V+ GY  +AFFI+DGRS++R      SG ++            VP               QR  C ECGK YATSSNLSRHKQTHR+LDSQ A+KCP C K YVSMPA++MH+LTHDL+H+CD+CGKAFSRPWLLQGH R+HTGEKP+ CAHCG+AFADRSNLRAHMQTHS+ K + C  C + FALKSYLNKH ES+C
Sbjct:  102 VSEGYAADAFFITDGRSRRR-----ASGGAR------------VP---------------QRHACGECGKTYATSSNLSRHKQTHRSLDSQLAKKCPTCGKTYVSMPAMAMHLLTHDLKHKCDVCGKAFSRPWLLQGHMRSHTGEKPFACAHCGKAFADRSNLRAHMQTHSAFKHFRCKRCSKTFALKSYLNKHYESAC 268          
BLAST of Scratch family zinc finger 2 vs. Ensembl Cavefish
Match: scrt2 (scratch family zinc finger 2 [Source:ZFIN;Acc:ZDB-GENE-030131-4097])

HSP 1 Score: 252.677 bits (644), Expect = 5.638e-81
Identity = 135/253 (53.36%), Postives = 162/253 (64.03%), Query Frame = 1
Query:  523 KILTLPVANSSSN-YQSPVYSDQDEKMSKSSKPEKLIQSGRKRRK--SGFQTGVTVGYTY-EAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            K L L +A++ S+   +PV S  +E      +     QSG   R   SG    ++ GYT  +AFFISDGRS+++                                  E      R  C ECGK YATSSNLSRHKQTHR+LDS+ ARKCP C+K+YVSMPAL+MHILTHDL+H+CD+C KAFSRPWLLQGH R+HTGEKP+ CAHCG+AFADRSNLRAHMQTHS+ K Y C  C + FALKSYLNKH ES+C
Sbjct:   42 KKLELKLASAVSDPLYAPVSSGGEEYCEPDLEQPDSPQSGLTARGYYSGEAESLSDGYTTADAFFISDGRSRRK--------------------------------GEEVVGGGPRHTCNECGKTYATSSNLSRHKQTHRSLDSKMARKCPTCNKVYVSMPALAMHILTHDLKHKCDVCSKAFSRPWLLQGHMRSHTGEKPFACAHCGKAFADRSNLRAHMQTHSAFKHYRCKRCDKTFALKSYLNKHYESAC 262          
BLAST of Scratch family zinc finger 2 vs. Ensembl Cavefish
Match: snai2 (snail family transcriptional repressor 2 [Source:NCBI gene;Acc:111191588])

HSP 1 Score: 175.252 bits (443), Expect = 2.183e-51
Identity = 95/203 (46.80%), Postives = 124/203 (61.08%), Query Frame = 1
Query:  673 VTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAE--STTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCL 1275
            +TV  T     +S   S     S  +S +S  S  KG+   ES  +    E  +   S+   ++F C  C K+Y+T S L +HKQ H    ++++  C +C+K YVS+ AL MHI TH L   C +CGKAFSRPWLLQGH R HTGEKP+ C HC RAFADRSNLRAH+QTHS +K Y+C  C + F+  S L+KH ES CC+
Sbjct:   56 ITVWTTSHESPLSPLPSDLSPVSGDLSPLSDAS-SKGRAGSESPRSADEDERGSGKLSSEDSEKFQCGLCAKSYSTYSGLMKHKQLHCDAQARKSFSCKYCEKEYVSLGALKMHIRTHTLPCVCKMCGKAFSRPWLLQGHIRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCV 257          
BLAST of Scratch family zinc finger 2 vs. Ensembl Cavefish
Match: ENSAMXT00000011311.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000047.1:155469:161795:1 gene:ENSAMXG00000011013.2 transcript:ENSAMXT00000011311.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.252 bits (443), Expect = 3.994e-51
Identity = 87/158 (55.06%), Postives = 106/158 (67.09%), Query Frame = 1
Query:  802 VPALTVIEEAAESTTKIQ-RFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCC 1272
            VP++TV      ST   Q RF C +C K Y T S L++H+Q       Q+   C +CDK YVS+ AL MHI TH L   C +CGKAFSRPWLLQGH R HTGEKP+ C HC RAFADRSNLRAH+QTHS +K Y+C +C + F+  S L+KH E+ CC
Sbjct:  118 VPSVTVSLLGLTSTGSSQERFECFDCHKAYFTFSGLAKHRQLQCEWQCQKYFSCKYCDKEYVSLGALKMHIRTHTLPCVCKLCGKAFSRPWLLQGHIRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDIKKYQCRSCSKTFSRISLLSKHEEAGCC 275          
BLAST of Scratch family zinc finger 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007831.1 (pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 gene:ENSPMAG00000007084.1 transcript:ENSPMAT00000007831.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 1.118e-23
Identity = 42/100 (42.00%), Postives = 63/100 (63.00%), Query Frame = 1
Query:  955 KCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            KC  C+K +     L++H+ TH    +C +CGKAF++   LQ H+R HTGEKP+ C+ C +AF+  SNL+ H +TH+  K ++C  C++ F   S L KH
Sbjct:    7 KCTVCEKAFAQSSYLTIHLRTHTKPFRCPLCGKAFAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKHQRTHTGEKPFKCTVCEKAFTESSPLRKH 106          

HSP 2 Score: 59.6918 bits (143), Expect = 1.694e-11
Identity = 37/109 (33.94%), Postives = 51/109 (46.79%), Query Frame = 1
Query:  844 TKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAH 1170
            T  + F C  CGK +A SS+L  H++TH                             T +   +C +C KAFS+   L+ H+R HTGEKP+ C  C +AF + S LR H
Sbjct:   27 THTKPFRCPLCGKAFAKSSDLQSHQRTH-----------------------------TGEKPFKCSVCEKAFSQSSNLKKHQRTHTGEKPFKCTVCEKAFTESSPLRKH 106          

HSP 3 Score: 44.669 bits (104), Expect = 2.924e-6
Identity = 23/52 (44.23%), Postives = 30/52 (57.69%), Query Frame = 1
Query: 1099 TGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            TGEKP+ C  C +AFA  S L  H++TH+  K + C  C + FA  S L  H
Sbjct:    1 TGEKPFKCTVCEKAFAQSSYLTIHLRTHT--KPFRCPLCGKAFAKSSDLQSH 50          
BLAST of Scratch family zinc finger 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004838.1 (pep scaffold:Pmarinus_7.0:GL495265:3215:3667:-1 gene:ENSPMAG00000004400.1 transcript:ENSPMAT00000004838.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 1.564e-21
Identity = 46/113 (40.71%), Postives = 66/113 (58.41%), Query Frame = 1
Query:  928 RTLDSQQARKCPH--CDKIYVSMPALSMHILTH--DLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            R    +++R C    C++ +     L  H  TH  +  H+CD CG+AF+R   L+ HRR HTGE+PYGC  CGRAFA   NL+ H +TH+  + + C+ C R+F L S +  H
Sbjct:    7 RNHRPERSRPCKRSFCERRFEEPAYLKRHERTHAGEKPHRCDACGRAFARRSGLEYHRRVHTGERPYGCEVCGRAFAQYGNLKVHRRTHTGERPHRCDVCGRSFTLCSNMKTH 119          

HSP 2 Score: 70.0922 bits (170), Expect = 4.685e-15
Identity = 35/105 (33.33%), Postives = 59/105 (56.19%), Query Frame = 1
Query:  874 CGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTH--DLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTH 1182
            C + +   + L RH++TH     ++  +C  C + +     L  H   H  +  + C++CG+AF++   L+ HRR HTGE+P+ C  CGR+F   SN++ H +TH
Sbjct:   22 CERRFEEPAYLKRHERTHA---GEKPHRCDACGRAFARRSGLEYHRRVHTGERPYGCEVCGRAFAQYGNLKVHRRTHTGERPHRCDVCGRSFTLCSNMKTHQRTH 123          
BLAST of Scratch family zinc finger 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003942.1 (pep scaffold:Pmarinus_7.0:GL476449:727695:728537:-1 gene:ENSPMAG00000003607.1 transcript:ENSPMAT00000003942.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 2.590e-21
Identity = 49/137 (35.77%), Postives = 72/137 (52.55%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALS-----MHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            + C +CGK + T +  + HK  H     QQ  KC  C + ++   A +     M I T D+ + CD+CG+ F+    L+ HR  H+G KP+ C  CG+AFA  S L  HM+ H+  K + C  C R F+  + LN H
Sbjct:    4 YSCEQCGKGFKTLNYFNHHKGMHGE-QQQQPFKCAVCGRAFMQSSAFTYLAQHMRIHTGDMPYACDVCGEKFNYSLSLKCHRTVHSGVKPHACQQCGKAFARASYLTQHMRMHTGEKPFVCPVCGRGFSQYAGLNYH 139          

HSP 2 Score: 64.3142 bits (155), Expect = 1.026e-12
Identity = 37/108 (34.26%), Postives = 54/108 (50.00%), Query Frame = 1
Query:  958 CPHCDKIYVSMPALSMHILTHDLRHQ----CDICGKAFSR----PWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHL 1257
            C  C K + ++   + H   H  + Q    C +CG+AF +     +L Q H R HTG+ PY C  CG  F    +L+ H   HS +K + C  C + FA  SYL +H+
Sbjct:    6 CEQCGKGFKTLNYFNHHKGMHGEQQQQPFKCAVCGRAFMQSSAFTYLAQ-HMRIHTGDMPYACDVCGEKFNYSLSLKCHRTVHSGVKPHACQQCGKAFARASYLTQHM 112          

HSP 3 Score: 56.225 bits (134), Expect = 5.631e-10
Identity = 37/126 (29.37%), Postives = 50/126 (39.68%), Query Frame = 1
Query:  808 ALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHS 1185
            A T + +     T    + C  CG+ +  S +L  H+  H  +                               H C  CGKAF+R   L  H R HTGEKP+ C  CGR F+  + L  H +THS
Sbjct:   48 AFTYLAQHMRIHTGDMPYACDVCGEKFNYSLSLKCHRTVHSGVKP-----------------------------HACQQCGKAFARASYLTQHMRMHTGEKPFVCPVCGRGFSQYAGLNYHKKTHS 144          
BLAST of Scratch family zinc finger 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009831.1 (pep scaffold:Pmarinus_7.0:GL485667:2222:3316:-1 gene:ENSPMAG00000008891.1 transcript:ENSPMAT00000009831.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.5817 bits (218), Expect = 1.051e-20
Identity = 50/129 (38.76%), Postives = 70/129 (54.26%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTH--DLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKS 1239
            F C  CG+ +A S++L  H++T       +A KC  C K +    AL  H   H  +  ++C +CG  F+R   L+ H R HTGEKP+ CA CG+AFA    L  H + H+  + YEC AC + FA  S
Sbjct:   58 FECRACGEAFARSADLRAHQET--AHGDGEAHKCDVCGKAFARPEALLSHQRVHMGEKPYRCSVCGMDFTRAEHLRSHHRTHTGEKPFRCATCGKAFAHPGTLSIHQRIHTRERPYECGACGKAFAESS 184          
BLAST of Scratch family zinc finger 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002487.1 (pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1 gene:ENSPMAG00000002270.1 transcript:ENSPMAT00000002487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 1.605e-20
Identity = 50/149 (33.56%), Postives = 84/149 (56.38%), Query Frame = 1
Query:  814 TVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMH--ILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            + ++E  +  T  + +VC ECGK+++ SS ++ H++TH     ++   C  C + +   P L  H  I T +  + C+ICGK+FS  + L+ H++ H  E+PY C  CG+ F+D+  L  HM+TH+ +K Y C  C   F+   +L  H
Sbjct:  143 STLKEHHKIHTGERPYVCKECGKSFSYSSAMTVHQKTH---TGEKPFICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAH 288          

HSP 2 Score: 87.4261 bits (215), Expect = 1.025e-18
Identity = 48/136 (35.29%), Postives = 74/136 (54.41%), Query Frame = 1
Query:  853 QRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQ--CDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            Q F+C ECG+ ++ +S+L  H+  H     ++   CP C K +    +L  H   H       C  CGK+FS    L+ H++ HTG+KP+ C  CGR F+ + +L++H +TH+  K YEC  C + F+L   L  H
Sbjct:  380 QPFICQECGRRFSQTSSLKTHQLLH---TGEKTFLCPDCGKRFSFPSSLKQHQQMHSSERPFICKECGKSFSYYSNLKVHQKTHTGDKPFTCTLCGRGFSQKPHLKSHQRTHTGEKPYECQDCGKYFSLNCNLKVH 512          

HSP 3 Score: 87.0409 bits (214), Expect = 1.072e-18
Identity = 49/148 (33.11%), Postives = 76/148 (51.35%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQ--CDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCLNP*IIVQ 1296
            F+C +CGK +  +S L  H   H+    ++   C  C K +    A+++H  TH       C  CG+ F++   L+ H+R HTGEKPY C  CG++F+   NL+AH +TH   + Y C  C + F+ K  L  H+ +   + P I   
Sbjct:  130 FICTDCGKRFLQASTLKEH---HKIHTGERPYVCKECGKSFSYSSAMTVHQKTHTGEKPFICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAHQKTHLKERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTH 274          

HSP 4 Score: 86.6557 bits (213), Expect = 1.607e-18
Identity = 49/148 (33.11%), Postives = 77/148 (52.03%), Query Frame = 1
Query:  820 IEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTH-RTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQ--CDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            I +   +T   + ++C +CGK +++   L +H + H RT   ++   C  C K +     L  H LTH L     C+ CGK FS+   ++ HR  HTGE+PY C  CG+ F+  S+L+ H  TH+  + + C  C + F   S L +H
Sbjct:    1 ILKNQSATNAEKMYMCEQCGKTFSSRRTLGQHLKAHLRTHTGEKPFICQDCGKRFSLKSTLKTHSLTHSLEKPFVCNDCGKGFSKASYMKVHRLTHTGERPYACQDCGQRFSQPSSLKTHQFTHTGERPFICTDCGKRFLQASTLKEH 148          

HSP 5 Score: 83.5741 bits (205), Expect = 1.424e-17
Identity = 46/134 (34.33%), Postives = 72/134 (53.73%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMH--ILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            + C +CG+ ++  S+L  H+ TH     ++   C  C K ++    L  H  I T +  + C  CGK+FS    +  H++ HTGEKP+ C  CGR FA + +L+ H + H+  K Y CN C ++F+L   L  H
Sbjct:  102 YACQDCGQRFSQPSSLKTHQFTH---TGERPFICTDCGKRFLQASTLKEHHKIHTGERPYVCKECGKSFSYSSAMTVHQKTHTGEKPFICKDCGRGFAQKPHLKTHQRIHTGEKPYACNICGKSFSLNYNLKAH 232          

HSP 6 Score: 83.1889 bits (204), Expect = 2.189e-17
Identity = 48/134 (35.82%), Postives = 73/134 (54.48%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLR--HQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            + C  CGK+++ + NL  H++TH     ++   C  C K +     L +H+ TH     + C  CG  FS+   L+ H+R HTGE+P+ C  CG+ FA +S L+ H  THS  K + C  C + ++LKS L  H
Sbjct:  214 YACNICGKSFSLNYNLKAHQKTHL---KERPYMCELCGKRFSDKRTLVVHMRTHTGVKPYICTHCGNKFSQGQHLKAHKRIHTGERPFICKICGKGFALKSTLKTHEFTHSVEKPFICKHCGKGYSLKSTLKNH 344          

HSP 7 Score: 82.4185 bits (202), Expect = 4.132e-17
Identity = 48/134 (35.82%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQ--CDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            F+C  CGK +A  S L  H+ TH     ++   C HC K Y     L  H + H       C  CGK FS+   L+ H+  H GE+P+ C  CGR F+  S+L+ H   H+  KT+ C  C + F+  S L +H
Sbjct:  298 FICKICGKGFALKSTLKTHEFTHSV---EKPFICKHCGKGYSLKSTLKNHEIVHSGEKPFLCKECGKGFSQGSSLKNHKLTHDGEQPFICQECGRRFSQTSSLKTHQLLHTGEKTFLCPDCGKRFSFPSSLKQH 428          

HSP 8 Score: 80.8777 bits (198), Expect = 1.241e-16
Identity = 44/134 (32.84%), Postives = 70/134 (52.24%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTH--DLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            F+C +CGK ++  S L  H  TH     ++   C  C K +     + +H LTH  +  + C  CG+ FS+P  L+ H+  HTGE+P+ C  CG+ F   S L+ H + H+  + Y C  C ++F+  S +  H
Sbjct:   46 FICQDCGKRFSLKSTLKTHSLTH---SLEKPFVCNDCGKGFSKASYMKVHRLTHTGERPYACQDCGQRFSQPSSLKTHQFTHTGERPFICTDCGKRFLQASTLKEHHKIHTGERPYVCKECGKSFSYSSAMTVH 176          

HSP 9 Score: 78.5666 bits (192), Expect = 6.583e-16
Identity = 43/110 (39.09%), Postives = 63/110 (57.27%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTH--DLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTH 1182
            F+C +CGK ++  S+L +H+Q H    S++   C  C K +     L +H  TH  D    C +CG+ FS+   L+ H+R HTGEKPY C  CG+ F+   NL+ H +TH
Sbjct:  410 FLCPDCGKRFSFPSSLKQHQQMH---SSERPFICKECGKSFSYYSNLKVHQKTHTGDKPFTCTLCGRGFSQKPHLKSHQRTHTGEKPYECQDCGKYFSLNCNLKVHKKTH 516          
BLAST of Scratch family zinc finger 2 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 77.411 bits (189), Expect = 1.626e-15
Identity = 36/105 (34.29%), Postives = 58/105 (55.24%), Query Frame = 1
Query:  955 KCPHCDKIYVSMPALSMHILTHDLRHQ---CDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYEC--NACKRNFALKSYLNKH 1254
            +CP+C +++     L +H+ +H + ++   CD CGK F++   L+ H R HTGEKPY C  C + F+ + NL AH+ TH  +K + C    C + F     +  H
Sbjct:  594 ECPYCHRLFSQATHLEVHVRSH-IGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAH 697          

HSP 2 Score: 72.0182 bits (175), Expect = 7.292e-14
Identity = 32/85 (37.65%), Postives = 47/85 (55.29%), Query Frame = 1
Query: 1027 RHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCLNP 1281
            +H+C  C + FS+   L+ H R+H G KP+ C +CG+ F    NLR H + H+  K Y C+ C + F+ K  L  HL +   L P
Sbjct:  592 KHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKP 676          
BLAST of Scratch family zinc finger 2 vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 71.633 bits (174), Expect = 7.862e-14
Identity = 33/94 (35.11%), Postives = 50/94 (53.19%), Query Frame = 1
Query: 1036 CDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECN---------ACKRNFALKSYLNKHLESSC---CLNP 1281
            CD+CGK F+RP+ L+ H R HT E+P+ C+ CG+AFA + + + H   H+  K Y C           C + FA    L +H ++     C+ P
Sbjct:  571 CDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESGRRCITP 664          
BLAST of Scratch family zinc finger 2 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 72.0182 bits (175), Expect = 8.114e-14
Identity = 48/145 (33.10%), Postives = 69/145 (47.59%), Query Frame = 1
Query:  826 EAAESTTKIQRFVCC--ECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTH--DLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLN 1248
            EA   T     + C   +C + +     L RH + H      +  KC  C + + S   L  H  TH  +  ++C IC K F+    L+ H R HTGEKP  C  CG+ F + SNL  H++TH   K Y+C+ C ++F     LN
Sbjct:  727 EAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKY---KPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTH--QKKYKCSDCSKSFDDLGKLN 866          

HSP 2 Score: 68.1662 bits (165), Expect = 1.266e-12
Identity = 39/134 (29.10%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  874 CGKNYATSSNLSRHKQTHRTLDSQQARKC--PHCDKIYVSMPALSMHILTHDLR--HQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLES 1263
            C K+++++  L+ H +       +   +C    C + +     L  H+  H     ++C  C + FS    L  H R H+GEKPY C  C + FA  S+L+ H++TH+  K  +C  C + F   S L+KH+++
Sbjct:  712 CNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKT 845          
BLAST of Scratch family zinc finger 2 vs. Ensembl Yeast
Match: FZF1 (Transcription factor involved in sulfite metabolism; sole identified regulatory target is SSU1; overexpression suppresses sulfite-sensitivity of many unrelated mutants due to hyperactivation of SSU1, contains five zinc fingers; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003223])

HSP 1 Score: 66.2402 bits (160), Expect = 1.374e-12
Identity = 32/77 (41.56%), Postives = 43/77 (55.84%), Query Frame = 1
Query: 1039 DICGKAFSRPWLLQGHRRAHTGEKPYGCAH--CGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLES 1263
            D C K ++RP LLQ H+ +HT +KPY C    CG+ F    +LR H  THS +K   C  C++ F     L +HL S
Sbjct:   17 DGCEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIRPCHLRVHKWTHSQIKPKACTLCQKRFVTNQQLRRHLNS 93          
BLAST of Scratch family zinc finger 2 vs. Ensembl Yeast
Match: YPR015C_mRNA (Putative zinc finger transcription factor; binds DNA in sequence-specific manner; overexpression causes a cell cycle delay or arrest [Source:SGD;Acc:S000006219])

HSP 1 Score: 58.5362 bits (140), Expect = 2.970e-10
Identity = 26/55 (47.27%), Postives = 35/55 (63.64%), Query Frame = 1
Query: 1024 LRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCA--HCGRAFADRSNLRAHMQTH 1182
            LR QC ICGK  SRP  L+ H   HTG+ P+ C   HC ++F  +SN+  H++TH
Sbjct:  183 LRKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTH 237          
BLAST of Scratch family zinc finger 2 vs. Ensembl Nematostella
Match: EDO40180 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S823])

HSP 1 Score: 224.172 bits (570), Expect = 6.515e-72
Identity = 99/138 (71.74%), Postives = 119/138 (86.23%), Query Frame = 1
Query:  856 RFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            R+VC ECGK+YATSSNLSRHKQTHR+LD + A++C  C K YVSMPAL+MH+LTH L H+C+ICGK+FSRPWLLQGH+R+HTGE+PY C  C +AFADRSNLRAH+QTH+ +K Y+C  C R FALKSYLNKHLES+C
Sbjct:   14 RYVCAECGKSYATSSNLSRHKQTHRSLDGKLAKRCHQCGKAYVSMPALAMHVLTHKLLHKCEICGKSFSRPWLLQGHKRSHTGERPYSCPECNKAFADRSNLRAHLQTHNPLKQYKCERCDRTFALKSYLNKHLESAC 151          
BLAST of Scratch family zinc finger 2 vs. Ensembl Nematostella
Match: SNAILB (Predicted protein; Snail [Source:UniProtKB/TrEMBL;Acc:Q6WGJ9])

HSP 1 Score: 145.976 bits (367), Expect = 1.660e-40
Identity = 83/161 (51.55%), Postives = 98/161 (60.87%), Query Frame = 1
Query:  793 PESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARK--CPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            P   P+  V  EA     K+Q   C  C K +   + L RH Q      +Q  R   C +C+K+Y S+ AL MHI TH L  +C ICGKAFSRPWLLQGH R HTGEKPY C  C RAFADRSNLRAH+QTHS +K Y C  C ++F+  S L KH E SC
Sbjct:  106 PSHDPSRVVTSEAP---AKLQ---CPNCMKGFNALATLMRH-QYFYCPPTQHKRPFHCKYCEKLYDSLGALKMHIRTHTLPCKCKICGKAFSRPWLLQGHVRTHTGEKPYKCTQCQRAFADRSNLRAHLQTHSDVKKYSCKQCSKSFSRMSLLLKH-EGSC 258          
BLAST of Scratch family zinc finger 2 vs. Ensembl Nematostella
Match: EDO38419 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCX8])

HSP 1 Score: 110.923 bits (276), Expect = 3.123e-26
Identity = 56/135 (41.48%), Postives = 79/135 (58.52%), Query Frame = 1
Query:  865 CCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLR--HQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLES 1263
            C +CGK +A +SNL+ H +TH     ++  KC  C K++     L+ H+ TH     H+C  CGK F++   L  H R H+GEKP+ C  CG+AFA  SNL  HM+ HS  K Y+C  C + FA  S+L KH+ +
Sbjct:  403 CTQCGKAFAQASNLTTHMRTH---SGEKPHKCTQCGKVFAHAGNLTTHMRTHSGEKPHKCTQCGKVFAQAGNLTTHMRTHSGEKPHKCTQCGKAFAHASNLTKHMRIHSGEKPYKCTQCGKVFAHTSHLTKHMRT 534          

HSP 2 Score: 108.227 bits (269), Expect = 2.574e-25
Identity = 54/135 (40.00%), Postives = 78/135 (57.78%), Query Frame = 1
Query:  865 CCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLR--HQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLES 1263
            C +CGK +A +S L+RH +TH     ++  KC  C K++     L+ H+ TH     H+C  CGK F++  +L  H R H+GEKP+ C  CG+AFA  SNL  HM+THS  K ++C  C + FA    L  H+ +
Sbjct:  319 CTQCGKAFARASVLTRHMRTH---SGEKPHKCTQCGKVFAHAGNLTTHMRTHSGEKPHKCTQCGKVFAQAGILTTHMRTHSGEKPHKCTQCGKAFAQASNLTTHMRTHSGEKPHKCTQCGKVFAHAGNLTTHMRT 450          

HSP 3 Score: 103.219 bits (256), Expect = 1.143e-23
Identity = 52/135 (38.52%), Postives = 75/135 (55.56%), Query Frame = 1
Query:  865 CCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLR--HQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLES 1263
            C +CGK +A + NL+ H +TH     ++  KC  C K++     L+ H+ TH     H+C  CGKAF++   L  H R H+GEKP+ C  CG+ FA   NL  HM+THS  K ++C  C + FA    L  H+ +
Sbjct:  347 CTQCGKVFAHAGNLTTHMRTH---SGEKPHKCTQCGKVFAQAGILTTHMRTHSGEKPHKCTQCGKAFAQASNLTTHMRTHSGEKPHKCTQCGKVFAHAGNLTTHMRTHSGEKPHKCTQCGKVFAQAGNLTTHMRT 478          

HSP 4 Score: 92.0485 bits (227), Expect = 5.172e-20
Identity = 52/151 (34.44%), Postives = 78/151 (51.66%), Query Frame = 1
Query:  817 VIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLR--HQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLES 1263
            ++ E  E++++    VC  C K++     +  H  TH      +  KC  C K +    +L+ H+ TH     H+C  CGKAF+R  +L  H R H+GEKP+ C  CG+ FA   NL  HM+THS  K ++C  C + FA    L  H+ +
Sbjct:  251 IVSEHCENSSR----VCPICEKDFCDYRYMIMHILTH---TKYKPYKCTQCGKAFAHASSLTEHMRTHSGEKPHKCTQCGKAFARASVLTRHMRTHSGEKPHKCTQCGKVFAHAGNLTTHMRTHSGEKPHKCTQCGKVFAQAGILTTHMRT 394          

HSP 5 Score: 90.1225 bits (222), Expect = 2.355e-19
Identity = 47/112 (41.96%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  865 CCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLR--HQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMK 1194
            C +CGK +A + NL+ H +TH     ++  KC  C K++     L+ H+ TH     H+C  CGKAF+    L  H R H+GEKPY C  CG+ FA  S+L  HM+THS  K
Sbjct:  431 CTQCGKVFAHAGNLTTHMRTH---SGEKPHKCTQCGKVFAQAGNLTTHMRTHSGEKPHKCTQCGKAFAHASNLTKHMRIHSGEKPYKCTQCGKVFAHTSHLTKHMRTHSREK 539          

HSP 6 Score: 80.8777 bits (198), Expect = 2.046e-16
Identity = 53/166 (31.93%), Postives = 78/166 (46.99%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQ---------------------THRTLDSQ--------QARKCPHCDKIYVSMPALSMHILTHDLR--HQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLES 1263
            + C +C + + +S+ L  H++                     T +TL            +R CP C+K +     + MHILTH     ++C  CGKAF+    L  H R H+GEKP+ C  CG+AFA  S L  HM+THS  K ++C  C + FA    L  H+ +
Sbjct:  201 YTCKKCSRCFTSSNALLWHRKRCYIEPTGDELKCKLCQQQCATPKTLTGHIVSEHCENSSRVCPICEKDFCDYRYMIMHILTHTKYKPYKCTQCGKAFAHASSLTEHMRTHSGEKPHKCTQCGKAFARASVLTRHMRTHSGEKPHKCTQCGKVFAHAGNLTTHMRT 366          
BLAST of Scratch family zinc finger 2 vs. Ensembl Nematostella
Match: EDO47708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLK7])

HSP 1 Score: 98.2117 bits (243), Expect = 2.444e-24
Identity = 55/134 (41.04%), Postives = 71/134 (52.99%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQ--CDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKH 1254
            FVC  CGK +  SS L RHK  H     ++  KC  C+K +     L  H+ TH       CDICGK F +   L+ H   HTGEKP+ C  C RAF   SNL+ HM TH+    Y+C  C++ F  K+ L +H
Sbjct:   10 FVCNICGKGFRLSSTLCRHKIIH---TQKKPHKCEVCNKSFNRSSTLKTHVRTHSEEKAFVCDICGKGFHQKGNLRNHIMIHTGEKPFQCTKCHRAFNKMSNLKFHMHTHTDNLPYQCKTCRKKFEKKTDLKQH 140          
BLAST of Scratch family zinc finger 2 vs. Ensembl Nematostella
Match: EDO45330 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT54])

HSP 1 Score: 96.2857 bits (238), Expect = 1.159e-23
Identity = 57/142 (40.14%), Postives = 74/142 (52.11%), Query Frame = 1
Query:  838 STTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHD--LRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHL 1257
            S T  + FVC  CGK +  SS L RHK  H T    +  KC  C+K +     L  HI TH     + C++CGK F +   L+ H   HTGEKPY CA C +AF   SNL+ HM  H+    Y C  CK +F+ +  L  H+
Sbjct:    3 SHTGTRPFVCGVCGKGFRLSSTLCRHKIIHTT---DRPHKCHICNKAFNRSSTLKTHIRTHSEVKEYICEVCGKGFHQKGNLRNHSLIHTGEKPYKCALCEKAFNKLSNLKFHMHVHTDNSPYRCKYCKVSFSRRCDLKSHI 141          
BLAST of Scratch family zinc finger 2 vs. Ensembl Medaka
Match: scrt1a (transcriptional repressor scratch 1 [Source:NCBI gene;Acc:101155400])

HSP 1 Score: 264.618 bits (675), Expect = 3.592e-85
Identity = 138/268 (51.49%), Postives = 168/268 (62.69%), Query Frame = 1
Query:  466 DAEISKLQSVDPTNEAINLKILTLPVANSSSNYQSPVYSDQDEKMSKSSKPEKLIQSGRKRRKSGFQTGVTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            DA  S    +  T    +  I+   V N+ S     ++SD      +   P   + S      SG  T V+ GYT +AFFI DGRS+ RK ++S  G                                QR  C ECGK YATSSNLSRHKQTHR++DS+ A+KCP C KIYVSMPA++MH+LTHDL+H+CD+CGKAFSRPWLLQGH R+HTGEKP+GCAHCG+AFADRSNLRAHMQTHS+ K Y+C  C + FALKSYLNKH ES+C
Sbjct:   53 DAVGSDSSIITKTPSPSHPSIIYGHVNNTYSGIHGDIHSDIHGDSDQPDSPRSEVSSSAGGYISG-DTAVSEGYTVDAFFIMDGRSR-RKATSSQRGAP------------------------------QRHTCSECGKTYATSSNLSRHKQTHRSMDSKMAKKCPTCGKIYVSMPAMAMHLLTHDLKHKCDVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHYKCKRCNKTFALKSYLNKHYESAC 288          
BLAST of Scratch family zinc finger 2 vs. Ensembl Medaka
Match: scrt2 (transcriptional repressor scratch 1 [Source:NCBI gene;Acc:101172495])

HSP 1 Score: 264.618 bits (675), Expect = 4.756e-85
Identity = 129/209 (61.72%), Postives = 148/209 (70.81%), Query Frame = 1
Query:  655 SGFQTG----VTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            SGF TG    +  GYT +AFFISDGRS+++         S+ S   G                 E    I R  C ECGK YATSSNLSRHKQTHR+LDS+ ARKCP C K+YVSMPAL+MHILTHDL+H+CD+C KAFSRPWLLQGH R+HTGEKP+ CAHCG+AFADRSNLRAHMQTHS+ K Y C  C + FALKSYLNKH ES+C
Sbjct:  111 SGFYTGESEALAEGYTMDAFFISDGRSRRKGEGEQRESGSRSSSANGG--------------VQERGGGIPRHTCNECGKTYATSSNLSRHKQTHRSLDSKMARKCPTCGKVYVSMPALAMHILTHDLKHKCDVCSKAFSRPWLLQGHMRSHTGEKPFACAHCGKAFADRSNLRAHMQTHSAFKHYRCKRCNKTFALKSYLNKHYESAC 305          
BLAST of Scratch family zinc finger 2 vs. Ensembl Medaka
Match: ENSORLT00000047079.1 (scratch family transcriptional repressor 1 [Source:NCBI gene;Acc:101167481])

HSP 1 Score: 259.225 bits (661), Expect = 1.829e-83
Identity = 122/206 (59.22%), Postives = 147/206 (71.36%), Query Frame = 1
Query:  664 QTGVTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCLNP 1281
             T V+ GYT +AFFI+DGRS+++                                A  S   +QR  C ECGK YATSSNLSRHKQTHR+LDS+ A+KCP C K+YVSMPA++MH+LTHDL+H+CD+CGKAFSRPWLLQGH R+HTGEKP+GCAHCG+AFADRSNLRAHMQTHS+ K ++C  C + FALKSYLNKH ES+C   P
Sbjct:   98 DTAVSEGYTVDAFFITDGRSRRK--------------------------------ALGSPRSLQRHTCNECGKTYATSSNLSRHKQTHRSLDSKLAKKCPTCGKVYVSMPAMAMHLLTHDLKHKCDVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHSAFKHFKCKRCNKTFALKSYLNKHYESACFKGP 271          
BLAST of Scratch family zinc finger 2 vs. Ensembl Medaka
Match: snai2 (snail family transcriptional repressor 2 [Source:NCBI gene;Acc:101173257])

HSP 1 Score: 175.637 bits (444), Expect = 1.576e-51
Identity = 81/144 (56.25%), Postives = 102/144 (70.83%), Query Frame = 1
Query:  844 TKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCL 1275
             + ++F C  C K+Y+T S L +HKQ H    ++++  C +C+K YVS+ AL MHI TH L   C ICGKAFSRPWLLQGH R HTGEKP+ C HC RAFADRSNLRAH+QTHS +K Y+C  C + F+  S L+KH ES CC+
Sbjct:  115 VEAEKFQCSLCSKSYSTYSGLLKHKQLHCDAQTRKSFSCKYCEKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCV 258          
BLAST of Scratch family zinc finger 2 vs. Ensembl Medaka
Match: snai1b (protein snail homolog Sna [Source:NCBI gene;Acc:101160236])

HSP 1 Score: 154.066 bits (388), Expect = 2.945e-43
Identity = 77/152 (50.66%), Postives = 98/152 (64.47%), Query Frame = 1
Query:  859 FVCCECGKNYATSSNLSRHKQTHRTLDSQQARK-------------CPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLES-SCC 1272
            + C  C K+Y++ ++LS H+ +H+ L S Q                C HC K Y S+ AL MHI +H L   C  CGKAFSRPWLL+GH R HTGE+P+ C HC RAFADRSNLRAH+QTHS +K Y+C++C R F+  S L+KH  S SCC
Sbjct:  113 YQCLHCNKSYSSLASLSHHQISHQQLVSAQQTPSLSGEASIRPVFHCKHCSKKYTSLGALKMHIRSHTLPCVCPTCGKAFSRPWLLRGHIRTHTGERPFACQHCNRAFADRSNLRAHLQTHSEVKKYQCSSCSRTFSRMSLLHKHCASGSCC 264          
BLAST of Scratch family zinc finger 2 vs. Planmine SMEST
Match: SMESG000041786.1 (SMESG000041786.1)

HSP 1 Score: 780.785 bits (2015), Expect = 0.000e+0
Identity = 371/371 (100.00%), Postives = 371/371 (100.00%), Query Frame = 1
Query:  169 MNTSYFNSTEMLSKSFSDNMKPDFGQGLIYNFNYDHLTAIALRLANIFPWQNMSAPSPQYLVPPFSNLNNLSLWQNFQKPDEKYADFEISETKHLATLKDAEISKLQSVDPTNEAINLKILTLPVANSSSNYQSPVYSDQDEKMSKSSKPEKLIQSGRKRRKSGFQTGVTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCLNP 1281
            MNTSYFNSTEMLSKSFSDNMKPDFGQGLIYNFNYDHLTAIALRLANIFPWQNMSAPSPQYLVPPFSNLNNLSLWQNFQKPDEKYADFEISETKHLATLKDAEISKLQSVDPTNEAINLKILTLPVANSSSNYQSPVYSDQDEKMSKSSKPEKLIQSGRKRRKSGFQTGVTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCLNP
Sbjct:    1 MNTSYFNSTEMLSKSFSDNMKPDFGQGLIYNFNYDHLTAIALRLANIFPWQNMSAPSPQYLVPPFSNLNNLSLWQNFQKPDEKYADFEISETKHLATLKDAEISKLQSVDPTNEAINLKILTLPVANSSSNYQSPVYSDQDEKMSKSSKPEKLIQSGRKRRKSGFQTGVTVGYTYEAFFISDGRSKKRKFSNSISGISKYSFKKGKKDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCLNP 371          
BLAST of Scratch family zinc finger 2 vs. Planmine SMEST
Match: SMESG000064846.1 (SMESG000064846.1)

HSP 1 Score: 149.058 bits (375), Expect = 4.459e-41
Identity = 77/161 (47.83%), Postives = 96/161 (59.63%), Query Frame = 1
Query:  847 KIQRFVCCECGKNYATSSNLSRHKQTHRT------------------LDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSCCL 1275
            K + F C +CGK Y   + L RH+    T                   D++Q   C  C+K+Y S+ AL MH+ TH L  +C ICGKAFSR WLL GH R HTGEKP+ C+ C RAFADRSNLRAHMQTHS +K Y+C+ C + F+    L KH +SSC L
Sbjct:  146 KTKPFNCVQCGKGYCNENGLKRHQAQKCTGSSLSDSITSTETNNSSSSDTRQY-SCRQCNKVYFSLSALKMHVRTHTLPCKCTICGKAFSRMWLLTGHMRTHTGEKPFSCSECDRAFADRSNLRAHMQTHSQVKRYQCDLCHKTFSRMGLLTKH-KSSCLL 304          
BLAST of Scratch family zinc finger 2 vs. Planmine SMEST
Match: SMESG000076673.1 (SMESG000076673.1)

HSP 1 Score: 124.405 bits (311), Expect = 1.349e-32
Identity = 60/105 (57.14%), Postives = 71/105 (67.62%), Query Frame = 1
Query:  955 KCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            +CP C K + S  AL MH  TH+    C  CGKAFSR WLL GH R HTGE+PY C  C RAFADRSNLRAHMQTH++ K Y+C+ C R+F+ +S L KH    C
Sbjct:  125 ECPLCGKKHNSSSALKMHQRTHNPPCICPQCGKAFSRMWLLSGHLRIHTGERPYVCNRCQRAFADRSNLRAHMQTHTTRKRYQCDKCPRSFSRQSLLRKHSLQCC 229          
BLAST of Scratch family zinc finger 2 vs. Planmine SMEST
Match: SMESG000067393.1 (SMESG000067393.1)

HSP 1 Score: 120.168 bits (300), Expect = 2.201e-31
Identity = 50/78 (64.10%), Postives = 63/78 (80.77%), Query Frame = 1
Query: 1036 CDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFALKSYLNKHLESSC 1269
            C+ CGK F+RPWLLQGH R HTGE+P+ C  CG+ FAD+SNLRAH+QTHS++K ++C+ C R F+LKSYL KH  SSC
Sbjct:  122 CNFCGKTFTRPWLLQGHVRTHTGERPFKCNICGKTFADKSNLRAHIQTHSTVKPFQCSKCCRCFSLKSYLAKHKASSC 199          

HSP 2 Score: 50.447 bits (119), Expect = 6.255e-7
Identity = 27/85 (31.76%), Postives = 42/85 (49.41%), Query Frame = 1
Query:  958 CPHCDKIYVSMPALSMHILTH--DLRHQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYEC 1206
            C  C K +     L  H+ TH  +   +C+ICGK F+    L+ H + H+  KP+ C+ C R F+ +S L  H  +    K  +C
Sbjct:  122 CNFCGKTFTRPWLLQGHVRTHTGERPFKCNICGKTFADKSNLRAHIQTHSTVKPFQCSKCCRCFSLKSYLAKHKASSCDKKLNKC 206          
BLAST of Scratch family zinc finger 2 vs. Planmine SMEST
Match: SMESG000053472.1 (SMESG000053472.1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.350e-20
Identity = 50/135 (37.04%), Postives = 77/135 (57.04%), Query Frame = 1
Query:  841 TTKIQRFVCCECGKNYATSSNLSRHKQTHRTLDSQQARK--CPHCDKIYVSMPALSMHIL-THDLR--HQCDICGKAFSRPWLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACKRNFA 1230
            + KI+ F C +CGK +A     ++H +  R +D Q  RK  C  C + +     L +H+L  H+    H+C +CGK+FS+   L  H R H+GE+PY C +C +AF   S LR H++ HS  K ++C  C ++FA
Sbjct:  348 SDKIEGFSCEQCGKMFAYEYYKAKHLKYTRCVD-QGNRKFPCSQCSRSFEKRDRLRIHVLHVHEKHRPHKCTVCGKSFSQSSSLNKHLRVHSGERPYKCIYCDKAFTASSILRTHIRQHSGEKPFKCKYCWKSFA 481          
The following BLAST results are available for this feature:
BLAST of Scratch family zinc finger 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCRT13.564e-7678.95scratch family transcriptional repressor 1 [Source... [more]
SCRT13.564e-7678.95scratch family transcriptional repressor 1 [Source... [more]
SCRT23.851e-7377.21scratch family transcriptional repressor 2 [Source... [more]
SNAI23.947e-5244.70snail family transcriptional repressor 2 [Source:H... [more]
SNAI35.577e-4958.16snail family transcriptional repressor 3 [Source:H... [more]
back to top
BLAST of Scratch family zinc finger 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ces-19.110e-6869.12CES-1; CEll death Specification [Source:UniProtKB... [more]
snai-13.436e-4253.57SNAIl family zinc finger 2 transcription factor ho... [more]
scrt-11.134e-3064.56SCRaTch (Zinc finger transcriptional repressor) ho... [more]
pag-36.522e-2335.40Zinc finger protein PAG-3 [Source:UniProtKB/TrEMB... [more]
Y55F3AM.144.655e-1935.10pep chromosome:WBcel235:IV:1058845:1063187:-1 gene... [more]
back to top
BLAST of Scratch family zinc finger 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scrt3.250e-8059.35gene:FBgn0004880 transcript:FBtr0333136[more]
scrt3.250e-8059.35gene:FBgn0004880 transcript:FBtr0073165[more]
CG126051.494e-7376.64gene:FBgn0035481 transcript:FBtr0073168[more]
CG126051.350e-7276.64gene:FBgn0035481 transcript:FBtr0073166[more]
CG126051.350e-7276.64gene:FBgn0035481 transcript:FBtr0333137[more]
back to top
BLAST of Scratch family zinc finger 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scrt1a4.233e-8555.10scratch family zinc finger 1a [Source:ZFIN;Acc:ZDB... [more]
scrt1b3.784e-8459.62scratch family zinc finger 1b [Source:ZFIN;Acc:ZDB... [more]
scrt1b3.784e-8459.62scratch family zinc finger 1b [Source:ZFIN;Acc:ZDB... [more]
scrt22.961e-8353.54scratch family zinc finger 2 [Source:ZFIN;Acc:ZDB-... [more]
snai21.848e-5154.90snail family zinc finger 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Scratch family zinc finger 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCRT13.700e-8157.94scratch family transcriptional repressor 1 [Source... [more]
srpk21.333e-5158.16SRSF protein kinase 2 [Source:Xenbase;Acc:XB-GENE-... [more]
snai12.631e-5156.16snail family zinc finger 1 [Source:NCBI gene;Acc:3... [more]
SNAI37.337e-4254.48snail family zinc finger 3 [Source:NCBI gene;Acc:1... [more]
ddx581.868e-2339.55DEXD/H-box helicase 58 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Scratch family zinc finger 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scrt14.090e-7955.45scratch family zinc finger 1 [Source:MGI Symbol;Ac... [more]
Scrt14.090e-7955.45scratch family zinc finger 1 [Source:MGI Symbol;Ac... [more]
Scrt21.541e-7576.26scratch family zinc finger 2 [Source:MGI Symbol;Ac... [more]
Snai24.078e-5258.87snail family zinc finger 2 [Source:MGI Symbol;Acc:... [more]
Snai38.781e-4954.30snail family zinc finger 3 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Scratch family zinc finger 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99M85|SCRT1_MOUSE2.861e-7855.45Transcriptional repressor scratch 1 OS=Mus musculu... [more]
sp|Q9BWW7|SCRT1_HUMAN1.139e-7578.95Transcriptional repressor scratch 1 OS=Homo sapien... [more]
sp|Q8BTH6|SCRT2_MOUSE1.078e-7476.26Transcriptional repressor scratch 2 OS=Mus musculu... [more]
sp|Q9NQ03|SCRT2_HUMAN1.849e-7277.21Transcriptional repressor scratch 2 OS=Homo sapien... [more]
sp|O43623|SNAI2_HUMAN1.895e-5144.70Zinc finger protein SNAI2 OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Scratch family zinc finger 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6UQD62.745e-10168.81Transcriptional repressor scratch OS=Echinococcus ... [more]
A0A068WH475.708e-10168.81Zinc finger C2H2 type OS=Echinococcus granulosus O... [more]
A0A0R3W3I36.047e-10167.87Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A068XYG97.651e-10165.38Zinc finger C2H2 type OS=Echinococcus multilocular... [more]
A0A183TBQ32.081e-10058.55Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of Scratch family zinc finger 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scrt1a3.874e-8354.39transcriptional repressor scratch 1-like [Source:N... [more]
SCRT11.650e-8161.31transcriptional repressor scratch 1-like [Source:N... [more]
scrt25.638e-8153.36scratch family zinc finger 2 [Source:ZFIN;Acc:ZDB-... [more]
snai22.183e-5146.80snail family transcriptional repressor 2 [Source:N... [more]
ENSAMXT00000011311.23.994e-5155.06pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Scratch family zinc finger 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007831.11.118e-2342.00pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 g... [more]
ENSPMAT00000004838.11.564e-2140.71pep scaffold:Pmarinus_7.0:GL495265:3215:3667:-1 ge... [more]
ENSPMAT00000003942.12.590e-2135.77pep scaffold:Pmarinus_7.0:GL476449:727695:728537:-... [more]
ENSPMAT00000009831.11.051e-2038.76pep scaffold:Pmarinus_7.0:GL485667:2222:3316:-1 ge... [more]
ENSPMAT00000002487.11.605e-2033.56pep scaffold:Pmarinus_7.0:GL476414:876407:883640:1... [more]
back to top
BLAST of Scratch family zinc finger 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
AZF11.626e-1534.29Zinc-finger transcription factor; involved in diau... [more]
CRZ17.862e-1435.11Transcription factor, activates transcription of s... [more]
ZAP18.114e-1433.10Zinc-regulated transcription factor; binds to zinc... [more]
FZF11.374e-1241.56Transcription factor involved in sulfite metabolis... [more]
YPR015C_mRNA2.970e-1047.27Putative zinc finger transcription factor; binds D... [more]
back to top
BLAST of Scratch family zinc finger 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO401806.515e-7271.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
SNAILB1.660e-4051.55Predicted protein; Snail [Source:UniProtKB/TrEMBL... [more]
EDO384193.123e-2641.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477082.444e-2441.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453301.159e-2340.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Scratch family zinc finger 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scrt1a3.592e-8551.49transcriptional repressor scratch 1 [Source:NCBI g... [more]
scrt24.756e-8561.72transcriptional repressor scratch 1 [Source:NCBI g... [more]
ENSORLT00000047079.11.829e-8359.22scratch family transcriptional repressor 1 [Source... [more]
snai21.576e-5156.25snail family transcriptional repressor 2 [Source:N... [more]
snai1b2.945e-4350.66protein snail homolog Sna [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Scratch family zinc finger 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041786.10.000e+0100.00SMESG000041786.1[more]
SMESG000064846.14.459e-4147.83SMESG000064846.1[more]
SMESG000076673.11.349e-3257.14SMESG000076673.1[more]
SMESG000067393.12.201e-3164.10SMESG000067393.1[more]
SMESG000053472.12.350e-2037.04SMESG000053472.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016942 ID=SMED30016942|Name=Scratch family zinc finger 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1395bp
TCTTCCGATCTCACATACACAAAACATTAATTTCAATTCTGCCAACGACA
GCAGATGGGCTGTTGCTCCGATAAATCAGCTGCATCAAGTCGCACTGATT
GGCTTGGAATTATGATTGTCGCATATTTATTGGTGGCATTTCTACTGAGC
AGTTACTAGCATTAGCAAATGAATACCTCTTACTTCAATTCAACAGAAAT
GTTATCGAAATCGTTTTCCGATAACATGAAACCGGATTTTGGGCAAGGAT
TAATTTACAATTTCAACTACGATCATTTGACGGCCATTGCGTTGAGATTG
GCAAACATTTTCCCATGGCAAAATATGTCGGCTCCTTCTCCGCAATATTT
GGTGCCACCTTTCAGCAATTTGAACAATCTTTCACTTTGGCAAAATTTCC
AGAAACCCGATGAAAAATATGCCGATTTCGAAATCAGCGAGACGAAACAT
TTGGCTACATTGAAAGACGCTGAAATATCAAAACTTCAATCAGTAGACCC
AACAAATGAAGCAATCAACCTAAAAATCCTCACTCTACCAGTAGCGAATT
CCAGCAGTAATTATCAATCTCCTGTTTACAGTGATCAGGACGAGAAAATG
AGCAAATCCTCCAAGCCTGAAAAACTCATTCAATCGGGCCGAAAACGTCG
AAAGTCCGGTTTCCAAACCGGTGTCACTGTCGGTTATACATATGAAGCGT
TTTTTATCAGCGATGGAAGATCGAAAAAACGAAAATTCTCCAATTCGATT
TCCGGTATTTCAAAATATTCTTTTAAAAAAGGCAAAAAAGATCCCGAATC
GGTGCCAGCTCTGACGGTCATTGAAGAAGCTGCAGAAAGCACTACGAAAA
TCCAAAGATTTGTCTGTTGTGAATGCGGAAAAAATTATGCGACTTCGTCG
AATTTAAGCCGACACAAACAAACCCACAGAACTCTCGACAGTCAGCAAGC
TCGAAAATGTCCACATTGCGATAAAATCTATGTCAGTATGCCAGCTTTGT
CGATGCATATTTTGACCCATGACCTGAGACATCAATGCGACATTTGCGGT
AAAGCGTTTTCTCGGCCCTGGCTGTTGCAAGGCCATCGGCGAGCGCACAC
TGGTGAAAAACCTTATGGATGCGCTCATTGTGGTCGAGCTTTTGCTGACA
GGTCTAACTTACGAGCGCACATGCAAACTCATTCGTCAATGAAAACCTAT
GAATGCAATGCTTGCAAAAGAAATTTCGCTCTTAAATCCTATCTTAACAA
ACATCTTGAATCGTCTTGTTGTTTGAATCCATAAATTATTGTGCAAGAAT
ATTTTACAGATATATTATCGATTTATCCAAATGAGTTTGACATTCCAAAA
TGGTTCAATTTGTTTTAATTAATAAATTGTATGAACACTTTTCGG
back to top

protein sequence of SMED30016942-orf-1

>SMED30016942-orf-1 ID=SMED30016942-orf-1|Name=SMED30016942-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=372bp
MNTSYFNSTEMLSKSFSDNMKPDFGQGLIYNFNYDHLTAIALRLANIFPW
QNMSAPSPQYLVPPFSNLNNLSLWQNFQKPDEKYADFEISETKHLATLKD
AEISKLQSVDPTNEAINLKILTLPVANSSSNYQSPVYSDQDEKMSKSSKP
EKLIQSGRKRRKSGFQTGVTVGYTYEAFFISDGRSKKRKFSNSISGISKY
SFKKGKKDPESVPALTVIEEAAESTTKIQRFVCCECGKNYATSSNLSRHK
QTHRTLDSQQARKCPHCDKIYVSMPALSMHILTHDLRHQCDICGKAFSRP
WLLQGHRRAHTGEKPYGCAHCGRAFADRSNLRAHMQTHSSMKTYECNACK
RNFALKSYLNKHLESSCCLNP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0043516regulation of DNA damage response, signal transduction by p53 class mediator
GO:0043523regulation of neuron apoptotic process
GO:2000177regulation of neural precursor cell proliferation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000030midline
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0007561head margin
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 288..310
e-value: 0.0043
score: 26.3
coord: 344..364
e-value: 68.0
score: 5.9
coord: 231..253
e-value: 0.064
score: 22.4
coord: 316..338
e-value: 9.1E-4
score: 28.5
coord: 262..284
e-value: 0.038
score: 23.1
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 231..253
e-value: 3.0E-4
score: 21.1
coord: 318..338
e-value: 1.2E-5
score: 25.4
coord: 288..310
e-value: 9.4E-5
score: 22.7
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 290..310
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 318..338
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 233..253
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 288..315
score: 15.604
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 316..343
score: 14.108
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 231..258
score: 11.739
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 344..371
score: 9.619
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 313..337
e-value: 1.7E-13
score: 52.0
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 214..286
e-value: 2.8E-10
score: 42.1
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 338..365
e-value: 1.2E-5
score: 27.2
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 287..312
e-value: 1.4E-11
score: 46.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 132..161
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 142..158
NoneNo IPR availablePANTHERPTHR23226:SF139FI01106P-RELATEDcoord: 98..369
NoneNo IPR availablePANTHERPTHR23226ZINC FINGER PROTEINcoord: 98..369
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 329..363
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 226..271
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 261..299
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 288..338