Histone-lysine N-methyltransferase

Overview
NameHistone-lysine N-methyltransferase
Smed IDSMED30016924
Length (bp)913
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone-lysine N-methyltransferase (SMED30016924) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase (SMED30016924) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone-lysine N-methyltransferase (SMED30016924) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase (SMED30016924) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016924

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30016924SMESG000044342.1 SmedASXL_009567SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30016924SMESG000044342.1 SmedASXL_009567SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
tail stripeSMED30016924SMESG000044342.1 isotig03820be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30016924SMESG000044342.1 isotig03820be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30016924SMESG000044342.1 SMED_06179_V2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: KMT5A (lysine methyltransferase 5A [Source:HGNC Symbol;Acc:HGNC:29489])

HSP 1 Score: 169.088 bits (427), Expect = 9.612e-50
Identity = 86/174 (49.43%), Postives = 113/174 (64.94%), Query Frame = 2
Query:  344 LLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            L D +  +RRS R  +  L+ ++ + I   I   +E GM+I     KGRG+ +T  F +  FVVEY GDLI    A++ EA+Y QDPS G YM+YF++    YCVDAT+E+ +LGRL+NHSK   NC  K   +DG+P L + A RDI  GEELLYDYGDR K S+EA+PWLK 
Sbjct:  151 LTDFYP-VRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCG-NCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH 322          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: KMT5A (lysine methyltransferase 5A [Source:HGNC Symbol;Acc:HGNC:29489])

HSP 1 Score: 168.703 bits (426), Expect = 3.015e-49
Identity = 86/174 (49.43%), Postives = 113/174 (64.94%), Query Frame = 2
Query:  344 LLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            L D +  +RRS R  +  L+ ++ + I   I   +E GM+I     KGRG+ +T  F +  FVVEY GDLI    A++ EA+Y QDPS G YM+YF++    YCVDAT+E+ +LGRL+NHSK   NC  K   +DG+P L + A RDI  GEELLYDYGDR K S+EA+PWLK 
Sbjct:  181 LTDFYP-VRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCG-NCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH 352          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: KMT5A (lysine methyltransferase 5A [Source:HGNC Symbol;Acc:HGNC:29489])

HSP 1 Score: 108.997 bits (271), Expect = 3.514e-27
Identity = 59/130 (45.38%), Postives = 81/130 (62.31%), Query Frame = 2
Query:  344 LLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVK 733
            L D +  +RRS R  +  L+ ++ + I   I   +E GM+I     KGRG+ +T  F +  FVVEY GDLI    A++ EA+Y QDPS G YM+YF++    YCVDAT+E+ +LGRL+NHSK   NC  K
Sbjct:  172 LTDFYP-VRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCG-NCQTK 299          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: EZH1 (enhancer of zeste 1 polycomb repressive complex 2 subunit [Source:HGNC Symbol;Acc:HGNC:3526])

HSP 1 Score: 81.6481 bits (200), Expect = 1.196e-16
Identity = 49/117 (41.88%), Postives = 70/117 (59.83%), Query Frame = 2
Query:  470 DTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFK-DNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            D    G  I+ +V  +K+ F+ EY G+LIS+ +A     +Y +      YM  F F  +N + VDAT++  K+ R  NHS +NPNCY K + V+G  R+ IFAKR I+ GEEL +DY
Sbjct:  612 DVAGWGTFIKESV--QKNEFISEYCGELISQDEADRRGKVYDK------YMSSFLFNLNNDFVVDATRKGNKI-RFANHS-VNPNCYAKVVMVNGDHRIGIFAKRAIQAGEELFFDY 718          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: EZH1 (enhancer of zeste 1 polycomb repressive complex 2 subunit [Source:HGNC Symbol;Acc:HGNC:3526])

HSP 1 Score: 81.6481 bits (200), Expect = 1.301e-16
Identity = 49/117 (41.88%), Postives = 70/117 (59.83%), Query Frame = 2
Query:  470 DTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFK-DNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            D    G  I+ +V  +K+ F+ EY G+LIS+ +A     +Y +      YM  F F  +N + VDAT++  K+ R  NHS +NPNCY K + V+G  R+ IFAKR I+ GEEL +DY
Sbjct:  551 DVAGWGTFIKESV--QKNEFISEYCGELISQDEADRRGKVYDK------YMSSFLFNLNNDFVVDATRKGNKI-RFANHS-VNPNCYAKVVMVNGDHRIGIFAKRAIQAGEELFFDY 657          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: set-1 (Histone-lysine N-methyltransferase set-1 [Source:UniProtKB/Swiss-Prot;Acc:Q22795])

HSP 1 Score: 140.198 bits (352), Expect = 5.876e-40
Identity = 72/166 (43.37%), Postives = 98/166 (59.04%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILK-CREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWL 859
            +RRS R   K + D+ + ++   +LK   E  + +     KGRGI + V FEK  FVVEY G ++   +A+  E  Y  D   GSYM++F   + K+C+DATKES   GRL+NHS L PN   K + +DG   L + A+R I  GEELLYDYGDR   ++  NPWL
Sbjct:   74 VRRSNRKTSKQISDEAKHALRDTVLKGTNERLLEVYKDVVKGRGIRTKVNFEKGDFVVEYRGVMMEYSEAKVIEEQYSNDEEIGSYMYFFEHNNKKWCIDATKESPWKGRLINHSVLRPNLKTKVVEIDGSHHLILVARRQIAQGEELLYDYGDRSAETIAKNPWL 239          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: set-1 (Histone-lysine N-methyltransferase set-1 [Source:UniProtKB/Swiss-Prot;Acc:Q22795])

HSP 1 Score: 103.605 bits (257), Expect = 1.392e-27
Identity = 50/101 (49.50%), Postives = 63/101 (62.38%), Query Frame = 2
Query:  557 SEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWL 859
            SE K  E +  Y  D   GSYM++F   + K+C+DATKES   GRL+NHS L PN   K + +DG   L + A+R I  GEELLYDYGDR   ++  NPWL
Sbjct:    4 SEAKVIEEQ--YSNDEEIGSYMYFFEHNNKKWCIDATKESPWKGRLINHSVLRPNLKTKVVEIDGSHHLILVARRQIAQGEELLYDYGDRSAETIAKNPWL 102          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: mes-2 (Histone-lysine N-methyltransferase mes-2 [Source:UniProtKB/Swiss-Prot;Acc:O17514])

HSP 1 Score: 78.9518 bits (193), Expect = 3.669e-16
Identity = 54/142 (38.03%), Postives = 72/142 (50.70%), Query Frame = 2
Query:  419 SIISQILKCREGGM------RIIDTPDK--GRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYG 820
            +I S I+KCR  GM      R    P K  G G+      EKD F+ EY G+ IS+ +A    AIY  D  + SY+F     +    +D+ K  G L R  NH   NP CY + + V G  R+  +AKR +EI EEL +DY 
Sbjct:  602 AIDSNIIKCRNFGMTRMIQKRTYCGPSKIAGNGLFLLEPAEKDEFITEYTGERISDDEAERRGAIY--DRYQCSYIFNI---ETGGAIDSYK-IGNLARFANHDSKNPTCYARTMVVAGEHRIGFYAKRRLEISEELTFDYS 737          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: set-2 (Histone-lysine N-methyltransferase set-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18221])

HSP 1 Score: 73.1738 bits (178), Expect = 3.860e-14
Identity = 43/127 (33.86%), Postives = 65/127 (51.18%), Query Frame = 2
Query:  437 LKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            LK R+  ++   +   G G+ +      D  +VEY G  I    A E E  Y++     SY+F     D  + +DATK  G   R +NHS   PNCY K + ++G  R+ I+++  I+ GEE+ YDY
Sbjct:  595 LKFRKKMIKFARSRIHGWGLYAMESIAPDEMIVEYIGQTIRSLVAEEREKAYERRGIGSSYLFRI---DLHHVIDATKR-GNFARFINHS-CQPNCYAKVLTIEGEKRIVIYSRTIIKKGEEITYDY 716          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: set-2 (Histone-lysine N-methyltransferase set-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18221])

HSP 1 Score: 72.0182 bits (175), Expect = 8.751e-14
Identity = 43/127 (33.86%), Postives = 65/127 (51.18%), Query Frame = 2
Query:  437 LKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            LK R+  ++   +   G G+ +      D  +VEY G  I    A E E  Y++     SY+F     D  + +DATK  G   R +NHS   PNCY K + ++G  R+ I+++  I+ GEE+ YDY
Sbjct: 1363 LKFRKKMIKFARSRIHGWGLYAMESIAPDEMIVEYIGQTIRSLVAEEREKAYERRGIGSSYLFRI---DLHHVIDATKR-GNFARFINHS-CQPNCYAKVLTIEGEKRIVIYSRTIIKKGEEITYDY 1484          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: PR-Set7 (gene:FBgn0011474 transcript:FBtr0082929)

HSP 1 Score: 144.05 bits (362), Expect = 2.063e-38
Identity = 74/167 (44.31%), Postives = 105/167 (62.87%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            +RRS R  +  +K++  + +   +L+ R  G+++     KGRG+ +   F+++ FVVEY GDLIS  +A E E  Y  D + G YM+YF+ K  +YC+DAT ++GKLGRL+NHS+   N   K + +   P L + AK DIE GEEL YDYGDR K SL  +PWL F
Sbjct:  526 VRRSVRKTKTAVKEEWMRGLEQAVLEERCDGLQVRHFMGKGRGVVADRPFKRNEFVVEYVGDLISIGEAAEREKRYALDENAGCYMYYFKHKSQQYCIDATVDTGKLGRLINHSRAG-NLMTKVVLIKQRPHLVLLAKDDIEPGEELTYDYGDRSKESLLHHPWLAF 691          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: PR-Set7 (gene:FBgn0011474 transcript:FBtr0309996)

HSP 1 Score: 144.05 bits (362), Expect = 2.063e-38
Identity = 74/167 (44.31%), Postives = 105/167 (62.87%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            +RRS R  +  +K++  + +   +L+ R  G+++     KGRG+ +   F+++ FVVEY GDLIS  +A E E  Y  D + G YM+YF+ K  +YC+DAT ++GKLGRL+NHS+   N   K + +   P L + AK DIE GEEL YDYGDR K SL  +PWL F
Sbjct:  526 VRRSVRKTKTAVKEEWMRGLEQAVLEERCDGLQVRHFMGKGRGVVADRPFKRNEFVVEYVGDLISIGEAAEREKRYALDENAGCYMYYFKHKSQQYCIDATVDTGKLGRLINHSRAG-NLMTKVVLIKQRPHLVLLAKDDIEPGEELTYDYGDRSKESLLHHPWLAF 691          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: PR-Set7 (gene:FBgn0011474 transcript:FBtr0082930)

HSP 1 Score: 144.05 bits (362), Expect = 2.063e-38
Identity = 74/167 (44.31%), Postives = 105/167 (62.87%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            +RRS R  +  +K++  + +   +L+ R  G+++     KGRG+ +   F+++ FVVEY GDLIS  +A E E  Y  D + G YM+YF+ K  +YC+DAT ++GKLGRL+NHS+   N   K + +   P L + AK DIE GEEL YDYGDR K SL  +PWL F
Sbjct:  526 VRRSVRKTKTAVKEEWMRGLEQAVLEERCDGLQVRHFMGKGRGVVADRPFKRNEFVVEYVGDLISIGEAAEREKRYALDENAGCYMYYFKHKSQQYCIDATVDTGKLGRLINHSRAG-NLMTKVVLIKQRPHLVLLAKDDIEPGEELTYDYGDRSKESLLHHPWLAF 691          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: E(z) (gene:FBgn0000629 transcript:FBtr0273338)

HSP 1 Score: 78.5666 bits (192), Expect = 6.640e-16
Identity = 47/112 (41.96%), Postives = 66/112 (58.93%), Query Frame = 2
Query:  485 GRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFK-DNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            G GI      +K+ F+ EY G++IS+ +A     +Y +      YM  F F  +N + VDAT++  K+ R  NHS +NPNCY K + V G  R+ IFAKR I+ GEEL +DY
Sbjct:  637 GWGIFLKEGAQKNEFISEYCGEIISQDEADRRGKVYDK------YMCSFLFNLNNDFVVDATRKGNKI-RFANHS-INPNCYAKVMMVTGDHRIGIFAKRAIQPGEELFFDY 740          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: E(z) (gene:FBgn0000629 transcript:FBtr0076279)

HSP 1 Score: 78.5666 bits (192), Expect = 6.640e-16
Identity = 47/112 (41.96%), Postives = 66/112 (58.93%), Query Frame = 2
Query:  485 GRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFK-DNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            G GI      +K+ F+ EY G++IS+ +A     +Y +      YM  F F  +N + VDAT++  K+ R  NHS +NPNCY K + V G  R+ IFAKR I+ GEEL +DY
Sbjct:  637 GWGIFLKEGAQKNEFISEYCGEIISQDEADRRGKVYDK------YMCSFLFNLNNDFVVDATRKGNKI-RFANHS-INPNCYAKVMMVTGDHRIGIFAKRAIQPGEELFFDY 740          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: kmt5aa (lysine methyltransferase 5Aa [Source:NCBI gene;Acc:751629])

HSP 1 Score: 168.703 bits (426), Expect = 1.330e-49
Identity = 86/167 (51.50%), Postives = 111/167 (66.47%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            +RRS R  +  LK +++Q I + I    E GM +     KGRG+ +T  F+K  +VVEY GDL+    A++ EA+Y QDPS G YM+YF++    YCVDATKES +LGRL+NHSK N NC  K   + G P L + A RDI+ GEELLYDYGDR K S+EA+PWLK 
Sbjct:  179 IRRSSRKSKSELKYEEKQHIDTLISNGIEDGMMVRFIEGKGRGVFATQPFQKGQYVVEYHGDLLQITDAKQREALYAQDPSTGCYMYYFQYLSKTYCVDATKESDRLGRLINHSK-NGNCQTKLHAIAGKPHLILVASRDIQEGEELLYDYGDRSKSSIEAHPWLKH 344          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: kmt5ab (lysine methyltransferase 5Ab [Source:ZFIN;Acc:ZDB-GENE-071004-17])

HSP 1 Score: 160.614 bits (405), Expect = 8.211e-47
Identity = 84/167 (50.30%), Postives = 106/167 (63.47%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            +RRS R  +  LK +K++ I   I    E G+++     KGRG+ +   F+KD FVVEY GDLI    A+  E+ Y QDPS G YM+YFR+ D  YCVDATKE+ +LGRL+NHSK N N   K   +DG P L   A RDI   EELLYDYGDR K ++ A+PWLK 
Sbjct:  150 VRRSCRKSKAELKCEKQRHIEDLIKNNVEEGLKVKCIDGKGRGVFADRAFQKDQFVVEYHGDLIEIADAKARESEYAQDPSTGCYMYYFRYHDRTYCVDATKETERLGRLINHSK-NGNLQTKLHEIDGTPHLIFLASRDIRADEELLYDYGDRSKEAIAAHPWLKH 315          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: kmt5ab (lysine methyltransferase 5Ab [Source:ZFIN;Acc:ZDB-GENE-071004-17])

HSP 1 Score: 160.229 bits (404), Expect = 1.414e-46
Identity = 84/167 (50.30%), Postives = 106/167 (63.47%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            +RRS R  +  LK +K++ I   I    E G+++     KGRG+ +   F+KD FVVEY GDLI    A+  E+ Y QDPS G YM+YFR+ D  YCVDATKE+ +LGRL+NHSK N N   K   +DG P L   A RDI   EELLYDYGDR K ++ A+PWLK 
Sbjct:  150 VRRSCRKSKAELKCEKQRHIEDLIKNDVEEGLKVKCIDGKGRGVFADRAFQKDQFVVEYHGDLIEIADAKARESEYAQDPSTGCYMYYFRYHDRTYCVDATKETERLGRLINHSK-NGNLRTKLHEIDGTPHLIFLASRDIRADEELLYDYGDRSKEAIAAHPWLKH 315          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: kmt5ab (lysine methyltransferase 5Ab [Source:ZFIN;Acc:ZDB-GENE-071004-17])

HSP 1 Score: 159.844 bits (403), Expect = 1.694e-46
Identity = 84/167 (50.30%), Postives = 106/167 (63.47%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            +RRS R  +  LK +K++ I   I    E G+++     KGRG+ +   F+KD FVVEY GDLI    A+  E+ Y QDPS G YM+YFR+ D  YCVDATKE+ +LGRL+NHSK N N   K   +DG P L   A RDI   EELLYDYGDR K ++ A+PWLK 
Sbjct:  150 VRRSCRKSKAELKCEKQRHIEDLIKNDVEEGLKVKCIDGKGRGVFADRLFQKDQFVVEYHGDLIEIADAKARESEYAQDPSTGCYMYYFRYHDRTYCVDATKETERLGRLINHSK-NGNLQTKLHEIDGTPHLIFLASRDIRADEELLYDYGDRSKEAIAAHPWLKH 315          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: kmt5ab (lysine methyltransferase 5Ab [Source:ZFIN;Acc:ZDB-GENE-071004-17])

HSP 1 Score: 108.612 bits (270), Expect = 1.852e-27
Identity = 57/115 (49.57%), Postives = 75/115 (65.22%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSK 709
            +RRS R  +  LK +K++ I   I    E G+++     KGRG+ +   F+KD FVVEY GDLI    A+  E+ Y QDPS G YM+YFR+ D  YCVDATKE+ +LGRL+NHSK
Sbjct:  148 VRRSCRKSKAELKCEKQRHIEDLIKNDVEEGLKVKCIDGKGRGVFADRLFQKDQFVVEYHGDLIEIADAKARESEYAQDPSTGCYMYYFRYHDRTYCVDATKETERLGRLINHSK 262          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: arhgef17 (Rho guanine nucleotide exchange factor 17 [Source:Xenbase;Acc:XB-GENE-6044614])

HSP 1 Score: 161.77 bits (408), Expect = 7.626e-47
Identity = 82/173 (47.40%), Postives = 115/173 (66.47%), Query Frame = 2
Query:  344 LLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLK 862
            L D +  +RRS R  +  L+ ++++ I   I   +E GM++     KGRG+ +T  F++  FVVEY GDLI    A+  EA Y QD + G YM+YF++ +  YC+DAT+E+G+LGRL+NHSK   NC+ K   ++ +P L + A RDI +GEELLYDYGDR K SLEA+PWLK
Sbjct:  165 LTDYYP-VRRSCRKSKTELESEEKKRIDELIQTGKEEGMKMDMITGKGRGVIATRDFQRGEFVVEYHGDLIEITDAKRREATYAQDSNTGCYMYYFQYLNKTYCIDATRETGRLGRLINHSKSG-NCHTKLHNINNVPHLILVASRDINVGEELLYDYGDRRKSSLEAHPWLK 335          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: arhgef17 (Rho guanine nucleotide exchange factor 17 [Source:Xenbase;Acc:XB-GENE-6044614])

HSP 1 Score: 161.384 bits (407), Expect = 9.635e-47
Identity = 82/173 (47.40%), Postives = 115/173 (66.47%), Query Frame = 2
Query:  344 LLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLK 862
            L D +  +RRS R  +  L+ ++++ I   I   +E GM++     KGRG+ +T  F++  FVVEY GDLI    A+  EA Y QD + G YM+YF++ +  YC+DAT+E+G+LGRL+NHSK   NC+ K   ++ +P L + A RDI +GEELLYDYGDR K SLEA+PWLK
Sbjct:  165 LTDYYP-VRRSCRKSKTELESEEKKRIDELIQTGKEEGMKMDMITGKGRGVIATRDFQRGEFVVEYHGDLIEITDAKRREATYAQDSNTGCYMYYFQYLNKTYCIDATRETGRLGRLINHSKSG-NCHTKLHNINNVPHLILVASRDINVGEELLYDYGDRRKSSLEAHPWLK 335          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: ezh2 (enhancer of zeste 2 polycomb repressive complex 2 subunit [Source:NCBI gene;Acc:550047])

HSP 1 Score: 80.8777 bits (198), Expect = 2.195e-16
Identity = 47/112 (41.96%), Postives = 67/112 (59.82%), Query Frame = 2
Query:  485 GRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFK-DNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            G GI      +K+ F+ EY G++IS+ +A     +Y +      YM  F F  +N + VDAT++  K+ R  NHS +NPNCY K + V+G  R+ IFAKR I+ GEEL +DY
Sbjct:  598 GWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDK------YMCSFLFNLNNDFVVDATRKGNKI-RFANHS-VNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDY 701          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: ezh2 (enhancer of zeste 2 polycomb repressive complex 2 subunit [Source:NCBI gene;Acc:550047])

HSP 1 Score: 80.8777 bits (198), Expect = 2.464e-16
Identity = 47/112 (41.96%), Postives = 67/112 (59.82%), Query Frame = 2
Query:  485 GRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFK-DNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            G GI      +K+ F+ EY G++IS+ +A     +Y +      YM  F F  +N + VDAT++  K+ R  NHS +NPNCY K + V+G  R+ IFAKR I+ GEEL +DY
Sbjct:  625 GWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDK------YMCSFLFNLNNDFVVDATRKGNKI-RFANHS-VNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDY 728          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: ezh2 (enhancer of zeste 2 polycomb repressive complex 2 subunit [Source:NCBI gene;Acc:550047])

HSP 1 Score: 80.8777 bits (198), Expect = 2.484e-16
Identity = 47/112 (41.96%), Postives = 67/112 (59.82%), Query Frame = 2
Query:  485 GRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFK-DNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            G GI      +K+ F+ EY G++IS+ +A     +Y +      YM  F F  +N + VDAT++  K+ R  NHS +NPNCY K + V+G  R+ IFAKR I+ GEEL +DY
Sbjct:  640 GWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDK------YMCSFLFNLNNDFVVDATRKGNKI-RFANHS-VNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDY 743          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Kmt5a (lysine methyltransferase 5A [Source:MGI Symbol;Acc:MGI:1915206])

HSP 1 Score: 167.548 bits (423), Expect = 1.292e-49
Identity = 86/174 (49.43%), Postives = 112/174 (64.37%), Query Frame = 2
Query:  344 LLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            L D +  +RRS R  +  L+ ++ + I   I   +E GM+I     KGRG+ +T  F +  FVVEY GDLI    A++ EA+Y QDPS G YM+YF++    YCVDAT+E+ +LGRL+NHSK   NC  K   +DG+P L + A RDI  GEELLYDYGDR K S+EA PWLK 
Sbjct:  124 LTDFYP-VRRSSRKSKAELQSEERKKIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATQETNRLGRLINHSKCG-NCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAYPWLKH 295          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Kmt5a (lysine methyltransferase 5A [Source:MGI Symbol;Acc:MGI:1915206])

HSP 1 Score: 167.162 bits (422), Expect = 7.068e-49
Identity = 86/174 (49.43%), Postives = 112/174 (64.37%), Query Frame = 2
Query:  344 LLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            L D +  +RRS R  +  L+ ++ + I   I   +E GM+I     KGRG+ +T  F +  FVVEY GDLI    A++ EA+Y QDPS G YM+YF++    YCVDAT+E+ +LGRL+NHSK   NC  K   +DG+P L + A RDI  GEELLYDYGDR K S+EA PWLK 
Sbjct:  179 LTDFYP-VRRSSRKSKAELQSEERKKIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATQETNRLGRLINHSKCG-NCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAYPWLKH 350          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Kmt5a (lysine methyltransferase 5A [Source:MGI Symbol;Acc:MGI:1915206])

HSP 1 Score: 167.548 bits (423), Expect = 7.733e-49
Identity = 86/174 (49.43%), Postives = 112/174 (64.37%), Query Frame = 2
Query:  344 LLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            L D +  +RRS R  +  L+ ++ + I   I   +E GM+I     KGRG+ +T  F +  FVVEY GDLI    A++ EA+Y QDPS G YM+YF++    YCVDAT+E+ +LGRL+NHSK   NC  K   +DG+P L + A RDI  GEELLYDYGDR K S+EA PWLK 
Sbjct:  193 LTDFYP-VRRSSRKSKAELQSEERKKIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATQETNRLGRLINHSKCG-NCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAYPWLKH 364          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Ezh1 (enhancer of zeste 1 polycomb repressive complex 2 subunit [Source:MGI Symbol;Acc:MGI:1097695])

HSP 1 Score: 81.6481 bits (200), Expect = 9.321e-17
Identity = 49/117 (41.88%), Postives = 70/117 (59.83%), Query Frame = 2
Query:  470 DTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFK-DNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            D    G  I+ +V  +K+ F+ EY G+LIS+ +A     +Y +      YM  F F  +N + VDAT++  K+ R  NHS +NPNCY K + V+G  R+ IFAKR I+ GEEL +DY
Sbjct:  624 DVAGWGTFIKESV--QKNEFISEYCGELISQDEADRRGKVYDK------YMSSFLFNLNNDFVVDATRKGNKI-RFANHS-VNPNCYAKVVMVNGDHRIGIFAKRAIQAGEELFFDY 730          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Ezh1 (enhancer of zeste 1 polycomb repressive complex 2 subunit [Source:MGI Symbol;Acc:MGI:1097695])

HSP 1 Score: 81.6481 bits (200), Expect = 9.394e-17
Identity = 49/117 (41.88%), Postives = 70/117 (59.83%), Query Frame = 2
Query:  470 DTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFK-DNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            D    G  I+ +V  +K+ F+ EY G+LIS+ +A     +Y +      YM  F F  +N + VDAT++  K+ R  NHS +NPNCY K + V+G  R+ IFAKR I+ GEEL +DY
Sbjct:  621 DVAGWGTFIKESV--QKNEFISEYCGELISQDEADRRGKVYDK------YMSSFLFNLNNDFVVDATRKGNKI-RFANHS-VNPNCYAKVVMVNGDHRIGIFAKRAIQAGEELFFDY 727          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|Q071E0|KT5AA_DANRE (N-lysine methyltransferase KMT5A-A OS=Danio rerio OX=7955 GN=kmt5aa PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 9.726e-49
Identity = 86/167 (51.50%), Postives = 111/167 (66.47%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            +RRS R  +  LK +++Q I + I    E GM +     KGRG+ +T  F+K  +VVEY GDL+    A++ EA+Y QDPS G YM+YF++    YCVDATKES +LGRL+NHSK N NC  K   + G P L + A RDI+ GEELLYDYGDR K S+EA+PWLK 
Sbjct:  179 IRRSSRKSKSELKYEEKQHIDTLISNGIEDGMMVRFIEGKGRGVFATQPFQKGQYVVEYHGDLLQITDAKQREALYAQDPSTGCYMYYFQYLSKTYCVDATKESDRLGRLINHSK-NGNCQTKLHAIAGKPHLILVASRDIQEGEELLYDYGDRSKSSIEAHPWLKH 344          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|Q2YDJ8|KMT5A_BOVIN (N-lysine methyltransferase KMT5A OS=Bos taurus OX=9913 GN=KMT5A PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 1.183e-48
Identity = 86/174 (49.43%), Postives = 113/174 (64.94%), Query Frame = 2
Query:  344 LLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            L D +  +RRS R  +  L+ ++ + I   I   +E GM+I     KGRG+ +T  F +  FVVEY GDLI    A++ EA+Y QDPS G YM+YF++    YCVDAT+E+ +LGRL+NHSK   NC  K   +DG+P L + A RDIE GEELLYDYGDR + S+EA PWLK 
Sbjct:  181 LTDFYP-VRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGEFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCG-NCQTKLHDIDGVPHLILIASRDIEAGEELLYDYGDRSRASIEAYPWLKH 352          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|Q9NQR1|KMT5A_HUMAN (N-lysine methyltransferase KMT5A OS=Homo sapiens OX=9606 GN=KMT5A PE=1 SV=3)

HSP 1 Score: 168.318 bits (425), Expect = 4.651e-48
Identity = 86/174 (49.43%), Postives = 113/174 (64.94%), Query Frame = 2
Query:  344 LLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            L D +  +RRS R  +  L+ ++ + I   I   +E GM+I     KGRG+ +T  F +  FVVEY GDLI    A++ EA+Y QDPS G YM+YF++    YCVDAT+E+ +LGRL+NHSK   NC  K   +DG+P L + A RDI  GEELLYDYGDR K S+EA+PWLK 
Sbjct:  222 LTDFYP-VRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCG-NCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH 393          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|Q2YDW7|KMT5A_MOUSE (N-lysine methyltransferase KMT5A OS=Mus musculus OX=10090 GN=Kmt5a PE=1 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 3.350e-46
Identity = 83/174 (47.70%), Postives = 112/174 (64.37%), Query Frame = 2
Query:  344 LLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            L D +   R S +   +L  ++++++ +  I   +E GM+I     KGRG+ +T  F +  FVVEY GDLI    A++ EA+Y QDPS G YM+YF++    YCVDAT+E+ +LGRL+NHSK   NC  K   +DG+P L + A RDI  GEELLYDYGDR K S+EA PWLK 
Sbjct:  179 LTDFYPVRRSSRKSKAELQSEERKKNEL--IESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYVQDPSTGCYMYYFQYLSKTYCVDATQETNRLGRLINHSKCG-NCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAYPWLKH 349          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|Q0V9E9|KMT5A_XENTR (N-lysine methyltransferase KMT5A OS=Xenopus tropicalis OX=8364 GN=kmt5a PE=2 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 5.104e-46
Identity = 82/173 (47.40%), Postives = 115/173 (66.47%), Query Frame = 2
Query:  344 LLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLK 862
            L D +  +RRS R  +  L+ ++++ I   I   +E GM++     KGRG+ +T  F++  FVVEY GDLI    A+  EA Y QD + G YM+YF++ +  YC+DAT+E+G+LGRL+NHSK   NC+ K   ++ +P L + A RDI +GEELLYDYGDR K SLEA+PWLK
Sbjct:  165 LTDYYP-VRRSCRKSKTELESEEKKRIDELIQTGKEEGMKMDMITGKGRGVIATRDFQRGEFVVEYHGDLIEITDAKRREATYAQDSNTGCYMYYFQYLNKTYCIDATRETGRLGRLINHSKSG-NCHTKLHNINNVPHLILVASRDINVGEELLYDYGDRRKSSLEAHPWLK 335          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A120H2D9 (SETD8 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 469.159 bits (1206), Expect = 3.394e-165
Identity = 260/272 (95.59%), Postives = 266/272 (97.79%), Query Frame = 2
Query:   50 MKSSTRSNFXXXXXXXXXXXXXQNIISNEIQGKTINAVKKITNSKTDTNSNQLPKPKKQMLLNGDVVNDFNFKKPQRRSRSCXXXXXXXXXXXXXXXXLLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            MKSSTRSNFKKISPKESSKKPEQNIISNEIQGKTINAVKKITNSKTDTNSNQLPKPKKQMLLNGDVVNDFNFKKPQRRSRSCSYINKKSKEKSNSNPNLLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVK I ++  PRL IFAKR+IEIGEELLYDYGDRD+ +LEANPWLK+
Sbjct:    1 MKSSTRSNFKKISPKESSKKPEQNIISNEIQGKTINAVKKITNSKTDTNSNQLPKPKKQMLLNGDVVNDFNFKKPQRRSRSCSYINKKSKEKSNSNPNLLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKVISINDSPRLAIFAKREIEIGEELLYDYGDRDRETLEANPWLKY 272          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: H9CXT6 (SETD8-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 460.299 bits (1183), Expect = 1.192e-161
Identity = 256/272 (94.12%), Postives = 262/272 (96.32%), Query Frame = 2
Query:   50 MKSSTRSNFXXXXXXXXXXXXXQNIISNEIQGKTINAVKKITNSKTDTNSNQLPKPKKQMLLNGDVVNDFNFKKPQRRSRSCXXXXXXXXXXXXXXXXLLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            M  STRSN KKISPKESSKKPEQ IISNEIQGKTINAVKKITNSKTDTNSNQLPKPKKQMLLNGDVVNDFNFKKPQRRSRSCSYINKKSKEKSNSNPNLLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVK I ++  PRL IFAKR+IEIGEELLYDYGDRD+ +LEANPWLK+
Sbjct:    1 MXXSTRSNLKKISPKESSKKPEQYIISNEIQGKTINAVKKITNSKTDTNSNQLPKPKKQMLLNGDVVNDFNFKKPQRRSRSCSYINKKSKEKSNSNPNLLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKVISINDSPRLAIFAKREIEIGEELLYDYGDRDRETLEANPWLKY 272          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A068YCU8 (Histone lysine n methyltransferase setd8 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001031500 PE=3 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 2.118e-61
Identity = 94/166 (56.63%), Postives = 124/166 (74.70%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLK 862
            +RR+ R   K ++ +KE  +IS ILK  E GM+++ T DKGRG+ +T  F    FVVEY G+LIS  +AR  EA Y +DP+ GS+MF+F   + +YCVDAT+E+GKLGRL+NHS+L+PNC VK IP++G+PRL +FAK +I  GEELLYDYGDR K SL A+PWLK
Sbjct:  194 IRRTARQFAKDMQQQKEAEVISTILKSEESGMKVVITEDKGRGVLTTRTFLPGEFVVEYIGELISGSEARTREAEYNKDPNVGSFMFFFSHGNQRYCVDATEETGKLGRLINHSRLHPNCVVKVIPINGIPRLALFAKTEIPPGEELLYDYGDRGKASLIAHPWLK 359          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A4S2LKE5 (SET domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006545 PE=3 SV=1)

HSP 1 Score: 208.379 bits (529), Expect = 3.335e-61
Identity = 99/166 (59.64%), Postives = 130/166 (78.31%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLK 862
            +RR+ R  EK  + ++E ++++ I +  E GM+II T +KGRGI +T  F++  FVVEYAGDLISEK A++ E  YK+DPS GSYMFYF     KYCVDAT+E+ +LGRL+NHS+L+PNC+VK IP+DG+PRL +FAK+ I  GEELLYDYGDRDK +LEA+PWLK
Sbjct:  202 IRRTARQYEKDKEREREINVLTSIREEVESGMKIIITEEKGRGIVATRVFQEGEFVVEYAGDLISEKIAKKREMEYKRDPSIGSYMFYFAHNGQKYCVDATQETPRLGRLINHSRLHPNCHVKVIPLDGIPRLVLFAKQMILPGEELLYDYGDRDKETLEAHPWLK 367          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A0R3TNY2 (Histone-lysine N-methyltransferase OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9130 PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 5.033e-61
Identity = 96/168 (57.14%), Postives = 124/168 (73.81%), Query Frame = 2
Query:  362 NLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
             +RR+ R     LK KKE  I++ ILK  E GM++I+T DKGRG+ +T  F +  FVVEY G+LISE++AR  E  YK+DP+ GS+MF+F     +YCVDATKE+ KLGRL+NHS+ +PNC VK IP+DG+PRL++FAK D+  GEELLYDYGD  K SL A+PWLK 
Sbjct:  183 GIRRTARQFANDLKQKKEAEIVAAILKGEETGMKVIETEDKGRGVITTRLFTEGEFVVEYIGELISEREARAREVEYKKDPNIGSFMFFFAHGGQRYCVDATKETDKLGRLINHSRQHPNCIVKVIPIDGVPRLSLFAKMDVPPGEELLYDYGDHSKESLLAHPWLKM 350          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: kmt5aa (N-lysine methyltransferase KMT5A-A [Source:NCBI gene;Acc:103046457])

HSP 1 Score: 170.244 bits (430), Expect = 1.456e-50
Identity = 84/167 (50.30%), Postives = 112/167 (67.07%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            +RRS R  +  LK  ++Q I   I K  E GM +     KGRG+ +T  F+K  +VVEY GDL+ +  A++ EA+Y QDP+ G YM+YF++    YCVDATKE+ ++GRL+NHSK N NC  K   ++G+P L + A RDIE GEELLYDYGDR K S+ A+PWLK 
Sbjct:  148 IRRSSRKSKTELKCAEKQHIDELITKGIENGMMVKYIEGKGRGVFATENFQKGQYVVEYHGDLLLKTDAKKREAVYAQDPTTGCYMYYFQYLSKTYCVDATKETDRMGRLINHSK-NGNCQTKLHDINGIPHLILVASRDIEEGEELLYDYGDRSKASIAAHPWLKH 313          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: kmt5aa (N-lysine methyltransferase KMT5A-A [Source:NCBI gene;Acc:103046457])

HSP 1 Score: 169.474 bits (428), Expect = 7.182e-50
Identity = 84/167 (50.30%), Postives = 112/167 (67.07%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            +RRS R  +  LK  ++Q I   I K  E GM +     KGRG+ +T  F+K  +VVEY GDL+ +  A++ EA+Y QDP+ G YM+YF++    YCVDATKE+ ++GRL+NHSK N NC  K   ++G+P L + A RDIE GEELLYDYGDR K S+ A+PWLK 
Sbjct:  178 IRRSSRKSKTELKCAEKQHIDELITKGIENGMMVKYIEGKGRGVFATENFQKGQYVVEYHGDLLLKTDAKKREAVYAQDPTTGCYMYYFQYLSKTYCVDATKETDRMGRLINHSK-NGNCQTKLHDINGIPHLILVASRDIEEGEELLYDYGDRSKASIAAHPWLKH 343          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: kmt5ab (N-lysine methyltransferase KMT5A-A-like [Source:NCBI gene;Acc:111197404])

HSP 1 Score: 159.458 bits (402), Expect = 2.570e-46
Identity = 81/167 (48.50%), Postives = 110/167 (65.87%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            +RRS R  +  LK +++Q I   I    E G+++     KGRGI +   F+K  FVVEY GDL+   +A++ E  Y QDP+KG YM+YF + +N YCVDATKE+ +LGRL+NHSK N NC  +   ++G+P L + A R I+  EELLYDYGDR K S+ A+PWLK 
Sbjct:  152 IRRSSRKSKAELKCEEQQHIDDLIANNVEDGLKVRYIEGKGRGIFADRDFQKGQFVVEYHGDLLQIAEAKKRETQYAQDPTKGCYMYYFSYLNNNYCVDATKETCRLGRLINHSK-NGNCQTRLHDINGVPHLILVASRHIKAEEELLYDYGDRTKESIAAHPWLKH 317          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: kmt5ab (N-lysine methyltransferase KMT5A-A-like [Source:NCBI gene;Acc:111197404])

HSP 1 Score: 159.073 bits (401), Expect = 3.737e-46
Identity = 81/167 (48.50%), Postives = 110/167 (65.87%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            +RRS R  +  LK +++Q I   I    E G+++     KGRGI +   F+K  FVVEY GDL+   +A++ E  Y QDP+KG YM+YF + +N YCVDATKE+ +LGRL+NHSK N NC  +   ++G+P L + A R I+  EELLYDYGDR K S+ A+PWLK 
Sbjct:  162 IRRSSRKSKAELKCEEQQHIDDLIANNVEDGLKVRYIEGKGRGIFADRDFQKGQFVVEYHGDLLQIAEAKKRETQYAQDPTKGCYMYYFSYLNNNYCVDATKETCRLGRLINHSK-NGNCQTRLHDINGVPHLILVASRHIKAEEELLYDYGDRTKESIAAHPWLKH 327          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: kmt5ab (N-lysine methyltransferase KMT5A-A-like [Source:NCBI gene;Acc:111197404])

HSP 1 Score: 159.073 bits (401), Expect = 4.785e-46
Identity = 81/167 (48.50%), Postives = 110/167 (65.87%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            +RRS R  +  LK +++Q I   I    E G+++     KGRGI +   F+K  FVVEY GDL+   +A++ E  Y QDP+KG YM+YF + +N YCVDATKE+ +LGRL+NHSK N NC  +   ++G+P L + A R I+  EELLYDYGDR K S+ A+PWLK 
Sbjct:  174 IRRSSRKSKAELKCEEQQHIDDLIANNVEDGLKVRYIEGKGRGIFADRDFQKGQFVVEYHGDLLQIAEAKKRETQYAQDPTKGCYMYYFSYLNNNYCVDATKETCRLGRLINHSK-NGNCQTRLHDINGVPHLILVASRHIKAEEELLYDYGDRTKESIAAHPWLKH 339          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005530.1 (pep scaffold:Pmarinus_7.0:GL477000:152:1026:-1 gene:ENSPMAG00000005035.1 transcript:ENSPMAT00000005530.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.813 bits (351), Expect = 1.090e-41
Identity = 70/139 (50.36%), Postives = 91/139 (65.47%), Query Frame = 2
Query:  482 KGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPV------------DGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLK 862
            KGRG+ +T  F +  FVVEY+G+LI   +A+  E  Y +DP KG YM+YF + +  YCVDAT ESG+LGRLLNHSK+  NC  K   V             G+PRL + A R+I +GEEL+YDYGDR + +L A+PWLK
Sbjct:    1 KGRGVFATRSFGRGDFVVEYSGELIGLTEAKTREVNYARDPDKGCYMYYFCYLNKTYCVDATAESGRLGRLLNHSKMG-NCRTKLHLVCCGEGGSPERGRGGVPRLILVAARNIGLGEELMYDYGDRSREALNAHPWLK 138          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004922.1 (pep scaffold:Pmarinus_7.0:GL479351:23010:32607:-1 gene:ENSPMAG00000004401.1 transcript:ENSPMAT00000004922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.6481 bits (200), Expect = 1.626e-17
Identity = 47/112 (41.96%), Postives = 68/112 (60.71%), Query Frame = 2
Query:  485 GRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFK-DNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            G GI   V  +K+ F+ EY G++IS+ +A     +Y +      YM  F F  +N + VDAT++  K+ R  NHS ++PNCY K + V+G  R+ IFAKR I+ GEEL +DY
Sbjct:  660 GWGIFIKVPVQKNEFISEYCGEIISQDEADRRGKVYDK------YMCSFLFNLNNDFVVDATRKGNKI-RFANHS-VSPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDY 763          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: setd1a (SET domain containing 1A, histone lysine methyltransferase [Source:ZFIN;Acc:ZDB-GENE-080521-4])

HSP 1 Score: 69.707 bits (169), Expect = 1.994e-13
Identity = 47/138 (34.06%), Postives = 69/138 (50.00%), Query Frame = 2
Query:  437 LKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEAN 850
            LK R+  +R   +     G+ +      +  V+EY G  I +  A   E  Y+ +    SY+F     D+   +DATK  G L R +NHS  NPNCY K I V+   R+ I++K+ I + EE+ YDY    K  +E N
Sbjct: 1710 LKFRKKKLRFTKSRIHEWGLFALEPIAAEEMVIEYVGQGIRQLVADMREKRYEVEGIGSSYLFRV---DHDTIIDATK-VGNLARFINHS-CNPNCYAKVITVESQKRIVIYSKQAINVNEEITYDY----KFPIEEN 1838          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: SUV39H2 (suppressor of variegation 3-9 homolog 2 [Source:HGNC Symbol;Acc:HGNC:17287])

HSP 1 Score: 67.781 bits (164), Expect = 3.906e-13
Identity = 43/123 (34.96%), Postives = 66/123 (53.66%), Query Frame = 2
Query:  482 KGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVD----GLPRLTIFAKRDIEIGEELLYDYGDRDKIS 838
            +G G+++    +K+SFV+EY G+LI  ++A     IY  D +  +Y+F   F  + Y VDAT   G +   +NHS   PN  V +  ++      PR+  FA  D+  GEEL +DY  +D  S
Sbjct:  264 RGWGVKTMQKIKKNSFVMEYVGELIPSEEAERRGVIY--DRAGTTYLFDLDFCKDDYTVDATF-YGNISHFVNHS-CEPNLQVYSTFINNHDFSQPRIAFFAMDDLAAGEELTFDYNIKDSSS 382          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010827.1 (pep scaffold:Pmarinus_7.0:GL487806:1944:5585:-1 gene:ENSPMAG00000009809.1 transcript:ENSPMAT00000010827.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 1.454e-12
Identity = 40/113 (35.40%), Postives = 61/113 (53.98%), Query Frame = 2
Query:  482 KGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDG-LPRLTIFAKRDIEIGEELLYDY 817
            +G G+ +    EK + V+EY G +I  + A   EA+YK   ++G YMF     D  + +DAT   G   R +NHS  +PNC  + +  D    ++ I + R ++ GEEL YDY
Sbjct:    5 QGLGLYAARDIEKHTMVIEYIGTIIRNEVANRREALYKAQ-NRGVYMFRI---DGDHVIDATLTGGP-ARYINHS-CSPNCVAEVVNFDKERSKIIIISSRRLQKGEELTYDY 111          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Yeast
Match: SET2 (Histone methyltransferase with a role in transcriptional elongation; methylates H3 lysine 36 (H3K36), which suppresses incorporation of acetylated histones and signals for the deacetylation of these histones within transcribed genes; associates with the C-terminal domain(CTD) of Rpo21p; H3K36me3 (trimethylation) requires Spt6p, proline 38 on H3, CTD of Rpo21p, Ctk1p, and C-terminal SRI domain of Ste2p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000003704])

HSP 1 Score: 68.5514 bits (166), Expect = 2.372e-13
Identity = 45/120 (37.50%), Postives = 61/120 (50.83%), Query Frame = 2
Query:  458 MRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            + I  T  KG G+ +    E + F+ EY G++I E + R+    Y Q   K    FYF    N   +DAT + G L R  NHS  +PN YV    V    R+ IFA+R I  GEE+ +DY
Sbjct:  122 IAIFKTKHKGYGVRAEQDIEANQFIYEYKGEVIEEMEFRDRLIDYDQRHFK---HFYFMMLQNGEFIDATIK-GSLARFCNHS-CSPNAYVNKWVVKDKLRMGIFAQRKILKGEEITFDY 236          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Yeast
Match: SET1 (Histone methyltransferase, subunit of the COMPASS (Set1C) complex; COMPASS methylates histone H3K4; Set1p-dependent H3K4 trimethylation recruits Nrd1p, allowing efficient termination of snoRNAs and cryptic unstable transcripts (CUTs) by Nrd1p-Nab3p-Sen1p pathway; modulates histone acetylation levels in promoter proximal regions to ensure efficient Nrd1p-dependent termination; required in transcriptional silencing near telomeres and at silent mating type loci; has a SET domain [Source:SGD;Acc:S000001161])

HSP 1 Score: 64.6994 bits (156), Expect = 4.400e-12
Identity = 43/112 (38.39%), Postives = 59/112 (52.68%), Query Frame = 2
Query:  527 FVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYG-DRDKISLEANPWL 859
             ++EY G+ I +  A   E  Y ++    SY+F     D    +DATK+ G + R +NH   +PNC  K I V G  R+ I+A RDI   EEL YDY  +R+K   E  P L
Sbjct:  963 MIIEYVGERIRQPVAEMREKRYLKNGIGSSYLFRV---DENTVIDATKKGG-IARFINHC-CDPNCTAKIIKVGGRRRIVIYALRDIAASEELTYDYKFEREKDDEERLPCL 1069          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO37682 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF28])

HSP 1 Score: 157.918 bits (398), Expect = 5.306e-48
Identity = 80/166 (48.19%), Postives = 110/166 (66.27%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLK 862
            +RRS+R  +  ++++K+Q+I   +L   E G+ I D   KGRG+ +   F +  FV EYAG+LI    A+E E  Y +    G YM+YF FK+ KYCVDATKESG+LGRLLNHS ++ NC  K I + G P L +   +DI+ GEELLYDYG+R K  +E++PWLK
Sbjct:    7 VRRSQRKCKSAVEEEKQQNIEKAVLLGLEEGLEIRDVEGKGRGVFAVKYFSRGDFVCEYAGELIDYNTAKEREQKYSEKAEVGCYMYYFSFKNKKYCVDATKESGRLGRLLNHS-VHGNCTTKLISIKGNPYLILVTSQDIKPGEELLYDYGERSKDIIESHPWLK 171          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO25957 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD96])

HSP 1 Score: 83.9593 bits (206), Expect = 6.752e-21
Identity = 41/69 (59.42%), Postives = 52/69 (75.36%), Query Frame = 2
Query:  656 VDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLK 862
            VDATKESG+LGRLLNHS ++ NC  K I + G P L +   +DI+ GEELLYDYG+R K  +E++PWLK
Sbjct:    1 VDATKESGRLGRLLNHS-VHGNCTTKLISIKGNPYLILVTSQDIKPGEELLYDYGERSKDIIESHPWLK 68          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO30322 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T142])

HSP 1 Score: 83.5741 bits (205), Expect = 5.774e-18
Identity = 48/112 (42.86%), Postives = 68/112 (60.71%), Query Frame = 2
Query:  485 GRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFK-DNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            G GI      +K+ F+ EY G++IS+ +A     +Y +      YM  F F  +N + VDAT++  K+ R  NHS ++PNCY K + V+G  R+ IFAKRDIE GEEL +DY
Sbjct:  563 GWGIYIKQSVKKNEFISEYCGEVISQDEADRRGKVYDK------YMCSFLFNLNNDFVVDATRKGNKI-RFANHS-ISPNCYAKVMMVNGDHRIGIFAKRDIEAGEELFFDY 666          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO30857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZK5])

HSP 1 Score: 78.5666 bits (192), Expect = 8.049e-17
Identity = 48/123 (39.02%), Postives = 65/123 (52.85%), Query Frame = 2
Query:  449 EGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            +G + +  +   GRG+  T        V+EY+G LI      + EA Y+   SKG   + FR  D  Y VDAT  SG   R +NHS   PNCY + + +DG  ++ IFA + I  GEEL YDY
Sbjct:  149 KGTIAVFRSGIHGRGLYCTRHIAAGEMVIEYSGMLIRSTLTDKREAYYE---SKGIGCYMFRI-DGTYVVDATT-SGNAARFINHS-CEPNCYSRVVTIDGNKKILIFASKSISRGEELTYDY 265          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO30858 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZK6])

HSP 1 Score: 78.5666 bits (192), Expect = 8.398e-17
Identity = 48/123 (39.02%), Postives = 65/123 (52.85%), Query Frame = 2
Query:  449 EGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            +G + +  +   GRG+  T        V+EY+G LI      + EA Y+   SKG   + FR  D  Y VDAT  SG   R +NHS   PNCY + + +DG  ++ IFA + I  GEEL YDY
Sbjct:  175 KGTIAVFRSGIHGRGLYCTRHIAAGEMVIEYSGMLIRSTLTDKREAYYE---SKGIGCYMFRI-DGTYVVDATT-SGNAARFINHS-CEPNCYSRVVTIDGNKKILIFASKSISRGEELTYDY 291          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: kmt5aa (lysine methyltransferase 5A [Source:NCBI gene;Acc:101169793])

HSP 1 Score: 164.081 bits (414), Expect = 6.134e-48
Identity = 80/167 (47.90%), Postives = 113/167 (67.66%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            +RRS R  +  LK ++++ I   I+K  E GM +     KGR + +T CF+K  +VVEY GDL+    A++ EA Y ++P+ G YM+YF++    YCVDAT+E+G++GRL+NHSK N NC  K   ++G P L + A RDI+ GEELLYDYGDR K S+ A+PWLK+
Sbjct:  176 IRRSSRKSKTELKCERKKLIDELIIKGIEEGMEVQYMEGKGRAVFATQCFQKGDYVVEYHGDLLHITDAKKREAEYAENPATGCYMYYFQYLCKTYCVDATRETGRMGRLINHSK-NGNCQTKLHDINGTPHLILVASRDIDKGEELLYDYGDRSKASIAAHPWLKY 341          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: kmt5aa (lysine methyltransferase 5A [Source:NCBI gene;Acc:101169793])

HSP 1 Score: 164.081 bits (414), Expect = 6.330e-48
Identity = 80/167 (47.90%), Postives = 113/167 (67.66%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            +RRS R  +  LK ++++ I   I+K  E GM +     KGR + +T CF+K  +VVEY GDL+    A++ EA Y ++P+ G YM+YF++    YCVDAT+E+G++GRL+NHSK N NC  K   ++G P L + A RDI+ GEELLYDYGDR K S+ A+PWLK+
Sbjct:  166 IRRSSRKSKTELKCERKKLIDELIIKGIEEGMEVQYMEGKGRAVFATQCFQKGDYVVEYHGDLLHITDAKKREAEYAENPATGCYMYYFQYLCKTYCVDATRETGRMGRLINHSK-NGNCQTKLHDINGTPHLILVASRDIDKGEELLYDYGDRSKASIAAHPWLKY 331          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: kmt5ab (N-lysine methyltransferase KMT5A [Source:NCBI gene;Acc:101172663])

HSP 1 Score: 161.384 bits (407), Expect = 6.633e-47
Identity = 80/167 (47.90%), Postives = 107/167 (64.07%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            +RRS R  +  +K ++ + I   I K  E GM +     KGRG+ +   F+K  FVVEY GDL+   +A+  E  Y QDP  G YM+YF+++   YC+DATKESG+LGRL+NHSK + NC  +   +   P L + A RDI+ GEELLYDYGDR K S+ A+PWLKF
Sbjct:  176 IRRSNRKTKGEIKSEEHRQIDDLINKNTEEGMEVRQIEGKGRGVFAVRAFKKGDFVVEYHGDLLDLAEAKTREDQYAQDPQTGCYMYYFQYQSKSYCIDATKESGRLGRLVNHSK-SGNCQTRLHAIGETPHLILVASRDIKAGEELLYDYGDRSKESITAHPWLKF 341          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: ENSORLT00000028726.1 (pep primary_assembly:ASM223467v1:11:17108985:17112944:-1 gene:ENSORLG00000030398.1 transcript:ENSORLT00000028726.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 3.124e-20
Identity = 49/146 (33.56%), Postives = 80/146 (54.79%), Query Frame = 2
Query:  398 LKDKKEQSIISQILKCREGGM---RIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDR 826
            LK + E+  +  I   R+      + ID+  KG+G+ +    E  SFVVEY G++ +  +        K D +  +Y+F F +    +CVDA+ E G LGR +N  + NP+C +K +  +G P L +FA + I  GEE+ ++YG+R
Sbjct:   36 LKLRAEEDALEHIKSRRDKSFLQEKFIDSF-KGKGLFTCESIEPSSFVVEYRGNIFARGEG-------KHDDTVENYIFNFSWNRTNWCVDASAEDGSLGRFVNDEQKNPSCELKTVVYEGKPHLCLFALKKISPGEEITFNYGNR 173          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: ezh2 (enhancer of zeste 2 polycomb repressive complex 2 subunit [Source:NCBI gene;Acc:100125823])

HSP 1 Score: 82.0333 bits (201), Expect = 5.752e-17
Identity = 52/152 (34.21%), Postives = 83/152 (54.61%), Query Frame = 2
Query:  365 LRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFK-DNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            L+  E CP+++     +Q +   + +     + +  +   G GI      +K+ F+ EY G++IS+ +A     +Y +      YM  F F  +N + VDAT++  K+ R  NHS +NPNCY K + V+G  R+ IFAKR I+ GEEL +DY
Sbjct:  586 LQEGEFCPKRVKAVAPKQPLTLPLFQ----HLLLAPSDVAGWGIFIKEPVQKNEFISEYCGEIISQDEADRRGKVYDK------YMCSFLFNLNNDFVVDATRKGNKI-RFANHS-VNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDY 725          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000044342.1 (SMESG000044342.1)

HSP 1 Score: 467.233 bits (1201), Expect = 6.285e-168
Identity = 259/272 (95.22%), Postives = 265/272 (97.43%), Query Frame = 2
Query:   50 MKSSTRSNFXXXXXXXXXXXXXQNIISNEIQGKTINAVKKITNSKTDTNSNQLPKPKKQMLLNGDVVNDFNFKKPQRRSRSCXXXXXXXXXXXXXXXXLLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            MKSSTRSN KKISPKESSKKPEQNIISNEIQGKTINAVKKITNSKTDTNSNQLPKPKKQMLLNGDVVNDFNFKKPQRRSRSCSYINKKSKEKSNSNPNLLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVK I ++  PRL IFAKR+IEIGEELLYDYGDRD+ +LEANPWLK+
Sbjct:    1 MKSSTRSNLKKISPKESSKKPEQNIISNEIQGKTINAVKKITNSKTDTNSNQLPKPKKQMLLNGDVVNDFNFKKPQRRSRSCSYINKKSKEKSNSNPNLLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKVISINDSPRLAIFAKREIEIGEELLYDYGDRDRETLEANPWLKY 272          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000015207.1 (SMESG000015207.1)

HSP 1 Score: 335.88 bits (860), Expect = 6.001e-115
Identity = 172/237 (72.57%), Postives = 198/237 (83.54%), Query Frame = 2
Query:  155 NAVKKITNSKTDTNSNQLPKPKKQMLLNGDVVNDFNFKKPQRRSRSCXXXXXXXXXXXXXXXXLLDLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 865
            N VK+++N KTD  SN++ K +KQMLLNGD++NDF+FKKPQ++SR CS I +K     N    +LD    +RRS+R  E L+ DKKEQ  IS IL  RE G+ II+T +KGRG+ESTVCF+KDSFVVEYAG+LISEK+ARE E+ YK DPSKGSYMFYFRFKD KYCVDAT+ESGKLGRLLNH KLNPNCYVKAIPV+GLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF
Sbjct:  125 NTVKELSNFKTDNISNKIYKSQKQMLLNGDIINDFDFKKPQQKSRKCSNICEKFNLNQN----ILDY---VRRSDRLSETLVNDKKEQMNISHILNNREEGIIIIETKEKGRGVESTVCFKKDSFVVEYAGNLISEKEAREKESFYKADPSKGSYMFYFRFKDRKYCVDATEESGKLGRLLNHCKLNPNCYVKAIPVNGLPRLTIFAKRDIEIGEELLYDYGDRDKISLEANPWLKF 354          

HSP 2 Score: 60.8474 bits (146), Expect = 2.858e-10
Identity = 34/54 (62.96%), Postives = 42/54 (77.78%), Query Frame = 2
Query:  122 IISNEIQGKTINAVKKITNSKTDTNSNQLPKPKKQMLLNGDVVNDFNFKKPQRR 283
            II N+ Q K +N VK I+NSKT T SN+  K  KQMLLNGD+V+DF+FKKPQR+
Sbjct:   24 IIRNKNQ-KDVNDVKMISNSKTYTYSNKANKSLKQMLLNGDIVSDFDFKKPQRK 76          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000045744.1 (SMESG000045744.1)

HSP 1 Score: 73.559 bits (179), Expect = 2.908e-14
Identity = 43/111 (38.74%), Postives = 66/111 (59.46%), Query Frame = 2
Query:  485 GRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            G GI +     K+ F+ EY G++IS+ +A     IY  D +  S++F     +  + VDAT++  K+ R  NHS +NPNC  K + V+G  R+ IFAK +I+ G+EL +DY
Sbjct:  642 GWGIYTKEDIVKNEFIYEYCGEIISQDEADRRGKIY--DKTMSSFLFNL---NQSFVVDATRKGNKI-RFANHS-VNPNCCAKILLVNGDHRIGIFAKHNIKAGDELFFDY 745          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000045744.1 (SMESG000045744.1)

HSP 1 Score: 73.559 bits (179), Expect = 3.039e-14
Identity = 43/111 (38.74%), Postives = 66/111 (59.46%), Query Frame = 2
Query:  485 GRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGEELLYDY 817
            G GI +     K+ F+ EY G++IS+ +A     IY  D +  S++F     +  + VDAT++  K+ R  NHS +NPNC  K + V+G  R+ IFAK +I+ G+EL +DY
Sbjct:  638 GWGIYTKEDIVKNEFIYEYCGEIISQDEADRRGKIY--DKTMSSFLFNL---NQSFVVDATRKGNKI-RFANHS-VNPNCCAKILLVNGDHRIGIFAKHNIKAGDELFFDY 741          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000074842.1 (SMESG000074842.1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.338e-13
Identity = 43/132 (32.58%), Postives = 74/132 (56.06%), Query Frame = 2
Query:  458 MRIIDTPDKGRGIESTVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFK-DNKYCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGL----PRLTIFAKRDIEIGEELLYDYGDRDKIS 838
            ++I  T ++G G+++     + +F++EY G++++  +A E   +Y Q     +Y+F   F  D ++ VDA K+ G +   +NHS  NPN   + + ++ L    PR+  FA RDI+ GEEL +DY     IS
Sbjct:  304 LKIFRTKNRGWGLKTLTKIIRGNFIMEYLGEIVAVDEAEERGKLYDQ--QNLTYLFDLDFAGDPEFTVDAYKK-GNMSHFINHS-CNPNMTSRCVFINNLDIRMPRIAFFAARDIKAGEELTFDYMMTGAIS 431          
The following BLAST results are available for this feature:
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KMT5A9.612e-5049.43lysine methyltransferase 5A [Source:HGNC Symbol;Ac... [more]
KMT5A3.015e-4949.43lysine methyltransferase 5A [Source:HGNC Symbol;Ac... [more]
KMT5A3.514e-2745.38lysine methyltransferase 5A [Source:HGNC Symbol;Ac... [more]
EZH11.196e-1641.88enhancer of zeste 1 polycomb repressive complex 2 ... [more]
EZH11.301e-1641.88enhancer of zeste 1 polycomb repressive complex 2 ... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
set-15.876e-4043.37Histone-lysine N-methyltransferase set-1 [Source:... [more]
set-11.392e-2749.50Histone-lysine N-methyltransferase set-1 [Source:... [more]
mes-23.669e-1638.03Histone-lysine N-methyltransferase mes-2 [Source:... [more]
set-23.860e-1433.86Histone-lysine N-methyltransferase set-2 [Source:... [more]
set-28.751e-1433.86Histone-lysine N-methyltransferase set-2 [Source:... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PR-Set72.063e-3844.31gene:FBgn0011474 transcript:FBtr0082929[more]
PR-Set72.063e-3844.31gene:FBgn0011474 transcript:FBtr0309996[more]
PR-Set72.063e-3844.31gene:FBgn0011474 transcript:FBtr0082930[more]
E(z)6.640e-1641.96gene:FBgn0000629 transcript:FBtr0273338[more]
E(z)6.640e-1641.96gene:FBgn0000629 transcript:FBtr0076279[more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kmt5aa1.330e-4951.50lysine methyltransferase 5Aa [Source:NCBI gene;Acc... [more]
kmt5ab8.211e-4750.30lysine methyltransferase 5Ab [Source:ZFIN;Acc:ZDB-... [more]
kmt5ab1.414e-4650.30lysine methyltransferase 5Ab [Source:ZFIN;Acc:ZDB-... [more]
kmt5ab1.694e-4650.30lysine methyltransferase 5Ab [Source:ZFIN;Acc:ZDB-... [more]
kmt5ab1.852e-2749.57lysine methyltransferase 5Ab [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgef177.626e-4747.40Rho guanine nucleotide exchange factor 17 [Source:... [more]
arhgef179.635e-4747.40Rho guanine nucleotide exchange factor 17 [Source:... [more]
ezh22.195e-1641.96enhancer of zeste 2 polycomb repressive complex 2 ... [more]
ezh22.464e-1641.96enhancer of zeste 2 polycomb repressive complex 2 ... [more]
ezh22.484e-1641.96enhancer of zeste 2 polycomb repressive complex 2 ... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kmt5a1.292e-4949.43lysine methyltransferase 5A [Source:MGI Symbol;Acc... [more]
Kmt5a7.068e-4949.43lysine methyltransferase 5A [Source:MGI Symbol;Acc... [more]
Kmt5a7.733e-4949.43lysine methyltransferase 5A [Source:MGI Symbol;Acc... [more]
Ezh19.321e-1741.88enhancer of zeste 1 polycomb repressive complex 2 ... [more]
Ezh19.394e-1741.88enhancer of zeste 1 polycomb repressive complex 2 ... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q071E0|KT5AA_DANRE9.726e-4951.50N-lysine methyltransferase KMT5A-A OS=Danio rerio ... [more]
sp|Q2YDJ8|KMT5A_BOVIN1.183e-4849.43N-lysine methyltransferase KMT5A OS=Bos taurus OX=... [more]
sp|Q9NQR1|KMT5A_HUMAN4.651e-4849.43N-lysine methyltransferase KMT5A OS=Homo sapiens O... [more]
sp|Q2YDW7|KMT5A_MOUSE3.350e-4647.70N-lysine methyltransferase KMT5A OS=Mus musculus O... [more]
sp|Q0V9E9|KMT5A_XENTR5.104e-4647.40N-lysine methyltransferase KMT5A OS=Xenopus tropic... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A120H2D93.394e-16595.59SETD8 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
H9CXT61.192e-16194.12SETD8-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV... [more]
A0A068YCU82.118e-6156.63Histone lysine n methyltransferase setd8 OS=Echino... [more]
A0A4S2LKE53.335e-6159.64SET domain-containing protein OS=Opisthorchis feli... [more]
A0A0R3TNY25.033e-6157.14Histone-lysine N-methyltransferase OS=Rodentolepis... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kmt5aa1.456e-5050.30N-lysine methyltransferase KMT5A-A [Source:NCBI ge... [more]
kmt5aa7.182e-5050.30N-lysine methyltransferase KMT5A-A [Source:NCBI ge... [more]
kmt5ab2.570e-4648.50N-lysine methyltransferase KMT5A-A-like [Source:NC... [more]
kmt5ab3.737e-4648.50N-lysine methyltransferase KMT5A-A-like [Source:NC... [more]
kmt5ab4.785e-4648.50N-lysine methyltransferase KMT5A-A-like [Source:NC... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005530.11.090e-4150.36pep scaffold:Pmarinus_7.0:GL477000:152:1026:-1 gen... [more]
ENSPMAT00000004922.11.626e-1741.96pep scaffold:Pmarinus_7.0:GL479351:23010:32607:-1 ... [more]
setd1a1.994e-1334.06SET domain containing 1A, histone lysine methyltra... [more]
SUV39H23.906e-1334.96suppressor of variegation 3-9 homolog 2 [Source:HG... [more]
ENSPMAT00000010827.11.454e-1235.40pep scaffold:Pmarinus_7.0:GL487806:1944:5585:-1 ge... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SET22.372e-1337.50Histone methyltransferase with a role in transcrip... [more]
SET14.400e-1238.39Histone methyltransferase, subunit of the COMPASS ... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO376825.306e-4848.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259576.752e-2159.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303225.774e-1842.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308578.049e-1739.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308588.398e-1739.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kmt5aa6.134e-4847.90lysine methyltransferase 5A [Source:NCBI gene;Acc:... [more]
kmt5aa6.330e-4847.90lysine methyltransferase 5A [Source:NCBI gene;Acc:... [more]
kmt5ab6.633e-4747.90N-lysine methyltransferase KMT5A [Source:NCBI gene... [more]
ENSORLT00000028726.13.124e-2033.56pep primary_assembly:ASM223467v1:11:17108985:17112... [more]
ezh25.752e-1734.21enhancer of zeste 2 polycomb repressive complex 2 ... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000044342.16.285e-16895.22SMESG000044342.1[more]
SMESG000015207.16.001e-11572.57SMESG000015207.1[more]
SMESG000045744.12.908e-1438.74SMESG000045744.1[more]
SMESG000045744.13.039e-1438.74SMESG000045744.1[more]
SMESG000074842.11.338e-1332.58SMESG000074842.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016924 ID=SMED30016924|Name=Histone-lysine N-methyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=913bp
TTTTGATAAGTATTAAATTGAAAAGATTATATCAAAGAATTTCTTTATTA
TGAAGAGTTCAACAAGAAGTAATTTTAAAAAAATTTCTCCCAAAGAAAGT
TCTAAAAAACCAGAACAAAACATTATATCAAATGAAATTCAAGGCAAAAC
CATAAATGCAGTAAAAAAAATCACCAATTCGAAAACAGATACTAATTCTA
ATCAATTACCTAAACCGAAAAAGCAAATGCTGTTAAATGGTGATGTCGTC
AATGATTTTAATTTTAAAAAACCTCAGCGAAGAAGTCGCAGTTGTAGCTA
TATTAATAAAAAATCGAAAGAAAAATCGAATTCTAATCCGAATTTATTAG
ATTTGTGGGCTAACTTACGCCGCAGTGAAAGATGCCCGGAAAAATTACTA
AAAGATAAAAAAGAGCAATCGATTATCAGCCAAATTTTGAAATGCCGAGA
AGGAGGTATGAGAATAATCGACACTCCTGATAAAGGTCGTGGTATTGAAA
GCACAGTTTGTTTTGAAAAAGACAGCTTTGTGGTTGAATATGCCGGTGAT
TTAATTTCAGAAAAAAAGGCCAGAGAAAATGAAGCTATATACAAGCAAGA
TCCCAGCAAAGGCTCTTACATGTTCTATTTCAGATTCAAGGATAACAAAT
ATTGTGTCGATGCTACTAAAGAGTCTGGCAAATTGGGGCGTCTACTTAAC
CACAGCAAACTCAATCCCAATTGCTATGTCAAAGCAATCCCAGTAGATGG
TTTACCGCGACTGACCATATTTGCCAAAAGAGACATAGAAATCGGCGAAG
AATTATTGTATGATTATGGAGATCGGGACAAGATATCTTTGGAAGCAAAT
CCTTGGTTGAAATTTTAATGGGATTTATTTACGTTTCTGTCTTTTATTTT
TACAATAAATAAC
back to top

protein sequence of SMED30016924-orf-1

>SMED30016924-orf-1 ID=SMED30016924-orf-1|Name=SMED30016924-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=273bp
MKSSTRSNFKKISPKESSKKPEQNIISNEIQGKTINAVKKITNSKTDTNS
NQLPKPKKQMLLNGDVVNDFNFKKPQRRSRSCSYINKKSKEKSNSNPNLL
DLWANLRRSERCPEKLLKDKKEQSIISQILKCREGGMRIIDTPDKGRGIE
STVCFEKDSFVVEYAGDLISEKKARENEAIYKQDPSKGSYMFYFRFKDNK
YCVDATKESGKLGRLLNHSKLNPNCYVKAIPVDGLPRLTIFAKRDIEIGE
ELLYDYGDRDKISLEANPWLKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000422tail stripe
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR001214SET_dom
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0005515protein binding
GO:0016740transferase activity
GO:0018024histone-lysine N-methyltransferase activity
GO:0008168methyltransferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0032259methylation
GO:0034968histone lysine methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001214SET domainSMARTSM00317set_7coord: 135..263
e-value: 1.7E-28
score: 110.6
IPR001214SET domainPFAMPF00856SETcoord: 146..257
e-value: 5.0E-16
score: 59.6
IPR001214SET domainPROSITEPS50280SETcoord: 135..257
score: 15.411
NoneNo IPR availableGENE3DG3DSA:2.170.270.10coord: 2..267
e-value: 1.6E-45
score: 157.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..31
NoneNo IPR availablePANTHERPTHR46167FAMILY NOT NAMEDcoord: 14..267
NoneNo IPR availableSUPERFAMILYSSF82199SET domaincoord: 131..264