Vacuolar protein sorting-associated protein 16 homolog

Overview
NameVacuolar protein sorting-associated protein 16 homolog
Smed IDSMED30016921
Length (bp)2613
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Vacuolar protein sorting-associated protein 16 homolog (SMED30016921) t-SNE clustered cells

Violin plots show distribution of expression levels for Vacuolar protein sorting-associated protein 16 homolog (SMED30016921) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Vacuolar protein sorting-associated protein 16 homolog (SMED30016921) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Vacuolar protein sorting-associated protein 16 homolog (SMED30016921) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016921

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30016921h1SMcG0004108 PL05010A1D05smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
posterior sideSMED30016921h1SMcG0004108 dd_Smed_v4_4534_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30016921h1SMcG0004108 dd_Smed_v4_4534_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Human
Match: VPS16 (VPS16 core subunit of CORVET and HOPS complexes [Source:HGNC Symbol;Acc:HGNC:14584])

HSP 1 Score: 280.796 bits (717), Expect = 3.650e-81
Identity = 218/858 (25.41%), Postives = 423/858 (49.30%), Query Frame = 2
Query:  107 MDVIVENWSLIGDN-YYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVI------SKAHSNQELI-VFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQV--IADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAG-----EDCLVFFHQDYLYLMDTEPQSTYSLYLEDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSD-KESLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMY--------MENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSMKY*YRCSNVID 2608
            MD    NW+ +GD+ +Y KY  Y+M W +  +  ++   A   YGG IA++       KA S + ++ ++S SG  ++ ++WK  PV+ L WS +E +  +Q+ G V ++ LH ++ ++  MG+ V Q+ V   R F +  G+G+ +LT  +      N+ +       ++   +V  +    + W       D+    + A    L  L +     +   G       S   ++++S T + +A+    G I++     S+ +  C+F+  I      Q+ W       E  +V   +  L ++   P+S   +  ED  + PE+DGVR+ + + HEF+ ++P+  E++++ +S +P  LL +AQ+  + +  +A  +L  I  + GQ+  A+  C+ AA +  +P  QKS+L A   G+ +   +  +    +   L +LN ++  ++ +P+T  Q +++ +  ++ RL+ R  YP    IC  LR+P+  G++R+L HWA   +++ D  +  +A  + ++L +     ++ IA +AY   + ELA KL+E E R   QV +LLK+K+   ALS++I+SGD++L+  V+  L+  L   DF   +   P+A ++Y        +E L DL NQD +   Q L       +   E         E I+  ++++    D + KA N+F  +  +D+      +    +  E ++    + + +HD ++ L      ++AE + +  ++ D++ +WLKL + A + +W+E +   +  ++K+P  Y    EIC    N+    K   ++ PE++V+  + +  + +A ++A   +NE  +  V S      C+   D
Sbjct:    1 MDCYTANWNPLGDSAFYRKYELYSMDWDL-KEELRDCLVAAAPYGGPIALLRNPWRKEKAASVRPVLDIYSASGMPLASLLWKSGPVVSLGWSAEEELLCVQEDGAVLVYGLHGDFRRHFSMGNEVLQNRVLDARIFHTEFGSGVAILTGAHRFTLSANVGDL-----KLRRMPEVPGLQSAPSCWTVLCQ--DRVAHILLAVGPDLYLLDHAACSAVTPPGLA--PGVSSFLQMAVSFTYRHLALFTDTGYIWM--GTASLKEKLCEFNCNIR-APPKQMVWCSRPRSKERAVVVAWERRLMVVGDAPESIQFVLDEDSYLVPELDGVRIFSRSTHEFLHEVPAASEEIFKIASMAPGALLLEAQKEYEKESQKADEYLREI-QELGQLTQAVQQCIEAAGHEHQPDMQKSLLRAASFGKCFLDRFPPDSFVHMCQDLRVLNAVRDYHIGIPLTYSQYKQLTIQVLLDRLVLRRLYPLAIQICEYLRLPEVQGVSRILAHWACYKVQQKDVSDEDVARAINQKLGDTPGVSYSDIAARAYGCGRTELAIKLLEYEPRSGEQVPLLLKMKRSKLALSKAIESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNH--QELGSFHIRASYAAE---------ERIEGRVAALQTAADAFYKAKNEFAAKATEDQ----MRLLRLQRRLEDELGGQFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSK--SKKSPIGYLPFVEICMKQHNKYEAKKYASRVGPEQKVKALLLVGDVAQAADVAIEHRNEAELSLVLS-----HCTGATD 822          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Human
Match: VPS16 (VPS16 core subunit of CORVET and HOPS complexes [Source:HGNC Symbol;Acc:HGNC:14584])

HSP 1 Score: 127.487 bits (319), Expect = 1.187e-29
Identity = 101/382 (26.44%), Postives = 190/382 (49.74%), Query Frame = 2
Query: 1490 YPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSD-KESLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMY--------MENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSMKY*YRCSNVID 2608
            YP    IC  LR+P+  G++R+L HWA   +++ D  +  +A  + ++L +     ++ IA +AY   + ELA KL+E E R   QV +LLK+K+   ALS++I+SGD++L+  V+  L+  L   DF   +   P+A ++Y        +E L DL NQD +   Q L       +   E         E I+  ++++    D + KA N+F  +  +D+      +    +  E ++    + + +HD ++ L      ++AE + +  ++ D++ +WLKL + A + +W+E +   +  ++K+P  Y    EIC    N+    K   ++ PE++V+  + +  + +A ++A   +NE  +  V S      C+   D
Sbjct:  319 YPLAIQICEYLRLPEVQGVSRILAHWACYKVQQKDVSDEDVARAINQKLGDTPGVSYSDIAARAYGCGRTELAIKLLEYEPRSGEQVPLLLKMKRSKLALSKAIESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNH--QELGSFHIRASYAAE---------ERIEGRVAALQTAADAFYKAKNEFAAKATEDQ----MRLLRLQRRLEDELGGQFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSK--SKKSPIGYLPFVEICMKQHNKYEAKKYASRVGPEQKVKALLLVGDVAQAADVAIEHRNEAELSLVLS-----HCTGATD 678          

HSP 2 Score: 98.5969 bits (244), Expect = 1.606e-20
Identity = 49/160 (30.63%), Postives = 88/160 (55.00%), Query Frame = 2
Query:  107 MDVIVENWSLIGDN-YYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVI------SKAHSNQELI-VFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNL 562
            MD    NW+ +GD+ +Y KY  Y+M W +  +  ++   A   YGG IA++       KA S + ++ ++S SG  ++ ++WK  PV+ L WS +E +  +Q+ G V ++ LH ++ ++  MG+ V Q+ V   R F +  G+G+ +LT  +      N+
Sbjct:    1 MDCYTANWNPLGDSAFYRKYELYSMDWDL-KEELRDCLVAAAPYGGPIALLRNPWRKEKAASVRPVLDIYSASGMPLASLLWKSGPVVSLGWSAEEELLCVQEDGAVLVYGLHGDFRRHFSMGNEVLQNRVLDARIFHTEFGSGVAILTGAHRFTLSANV 159          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Human
Match: VPS16 (VPS16 core subunit of CORVET and HOPS complexes [Source:HGNC Symbol;Acc:HGNC:14584])

HSP 1 Score: 51.9878 bits (123), Expect = 1.136e-6
Identity = 32/132 (24.24%), Postives = 65/132 (49.24%), Query Frame = 2
Query:  746 GWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAG-----EDCLVFFHQDYLYLMDTEPQSTYSLYLEDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSS 1126
            G     S   ++++S T + +A+    G I++    L   +  C+F+  I      Q+ W       E  +V   +  L ++   P+S   +  ED  + PE+DGVR+ + + HEF+ ++P+  E++++ +S
Sbjct:   96 GLAPGVSSFLQMAVSFTYRHLALFTDTGYIWMGTASLK--EKLCEFNCNIRAPPK-QMVWCSRPRSKERAVVVAWERRLMVVGDAPESIQFVLDEDSYLVPELDGVRIFSRSTHEFLHEVPAASEEIFKIAS 224          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Celegans
Match: vps-16 (Vacuolar protein sorting-associated protein 16 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q11182])

HSP 1 Score: 105.145 bits (261), Expect = 8.328e-23
Identity = 186/823 (22.60%), Postives = 337/823 (40.95%), Query Frame = 2
Query:  215 YFAHEIYGGSIAVI-SKAHSNQELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYV----QMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNT--DSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVV--AVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGD---NVQLEWAGEDC---------LVFFHQDYLYLMDTEPQSTYSLYLEDPLMFPEIDGVRLITATKHEFIQKIPSQ-LEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQ-MQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSY---FPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSDKESL-IAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQ--------VQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMYMENLFDLSNQDTDRSKQ--SLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIE--PEKRVRLYVKMNKLQEAEELARMIKNEYLIHYV 2566
            YF    + G IAV  S   ++  + + + SGR + R M  + PV  + W+    + +L K+GR  I +   E I  V    QM D    H  ++F   TS   +G+ V+    ++  + +++N+  + VI ++K     +   +T +   + LT   ++  AVF        L+        S  + W   ++   K  +     RIA++ ++GKI I+  DLS    TC     I D D    +   W G            +VF +         E Q  Y     +  +  E DG+RL  +T+ EF++    + +  L +  +E  A L   AQ+     MS+         S   Q +  AID C+S A +  +P  QK +L A R G +Y    PD  + K+     ++ +LN L++    +P+T  Q   IG T +I RLI+   Y     +   L       ++R+L  W  + I +  K ++ + +  ++ L+        +    +         E  +    R+F +        V +LL+L    +AL ++  S    LI  VV  L  S     +   I R P+A+ +Y + +          S+Q  +L E   +   +T      A    N    L+++   +D  K   +  + +I++D           I+ G++D+S       + D +  +  +    K   +KQ+ +++D+Q     +   AK    ++     QK   ++P  Y    + C  Y   + + K   K+   P+  V  ++ M    EA +LA   ++  ++H V
Sbjct:   50 YFTACQFSGPIAVAYSPRPASWYIWIRTISGRILKRDMAFNEPVF-MEWTRAHCLLVLNKAGRAHIFSSLGEKISEVIFDSQMSDV---HECRTF--ATSRGDSGIAVM----DVDGQVSVVNSVSEPVIWSMKPPYSEMPTAWTAFQPHSQLTHILLIFEAVFLMGCQGESLREQ------SHAASWVDSNTKYVKCVVDDARSRIAMMTESGKIQIVSIDLS----TCFCTVEITDHDIAKCINFGWVGNSAVFVQMSPSLIVFVNVSARRKPGDEVQ-IYEKMTANAKISIEPDGIRLFESTQVEFVEAASREKIAVLNRNPNEDGAHLYKAAQE-----MSQGTGHNSFAASTVIQDLYKAIDDCISTACDTWQPEEQKLLLKAARFGMAYTNTTPD--TTKLMRAIKEIRVLNELRMVRTGIPLTHRQFRAIGETCVINRLIDMGSYSVAIKVAQWLGGETSENVDRVLLEWVRRSISKVSKSNMKMDQPALEALDEKISAKLLQFPHVSIADAARRAIEAKLPELARLFIRRETDDANHVAVLLQLNDVSAALQKASASQRPQLIHQVVRHLMNSESRSSYELAISRIPLAQCLYQDLVRQEGETRGASSRQMLALLEQASDFERQTLFHFDVAETERNPDERLNALRRAKDAAKSMGDKAIEEILNDVSAF---APLQIQRGQADMS-------VRDTVIEMAHDT--AKVAQLKQQARLTDKQVLLWTIEGLAKKGKMEQLFDLAQK---RSPIGYAPFVKACVRYKRLDEIKKYFAKVNGYPD-LVAAHLAMKNYVEAAKLAYDRRDRDVLHAV 828          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Fly
Match: Vps16A (gene:FBgn0285911 transcript:FBtr0081979)

HSP 1 Score: 236.498 bits (602), Expect = 1.048e-65
Identity = 201/823 (24.42%), Postives = 388/823 (47.14%), Query Frame = 2
Query:  128 WSLIGDNYYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVIS--------KAHSNQELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIY--------KLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEW------AGEDCLVFFHQDYLYLMDTEPQSTYSLYLEDPLMF--PEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSDKESLIAERVIKRLENHA--DFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMYMENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEA 2518
            W  +  +YY K       W +D D  +  +     YGG +AV          K ++   + +F  +GR +  I+W    +I + WS+ E +  +Q++  V ++++     +   +GD      +   + F S  GTG+ V+T    +F K N   T+  +  I NS      N + W   T+            RNS   L  D+E +    G    + ++ ++        K+S+S   Q +A+    G +++   D+   +  C+FD    D   +Q+EW      +  D +V  +  YL +++     +   Y  DP+MF   E+DGVR+IT + HE IQ++P  +E ++  +S+ PA  LF+AQ+  + K  ++  +L +   K   + +A+  C+ AA+    P  QKS+L     G+ +  ++  ++   +   L +LN L+   +AMP+T  Q   +    I+ RL+ R +Y     +   L +P+    + +LEHWA   +     ++ +A ++ ++ +N +     F  IA +A++  + +LA KL+E E R    V +LLK++K   A+  +  SGD+ LI+ V+ E++  ++  +    I  +P+A  +Y + +   SN+       + E+  + +A   E   + A+  E +++ LS I    + Y +       ++  D   +++   T   + + ++S  G++  IH+ +  L      ++AE I+ + K+ DR+F+WL++ + +  + W+E +   +  ++K+P  Y    E+C   DN     K I +    +RV  Y++ N   EA
Sbjct:   10 WFKVRPDYYRKVELATPDWPLDLD-LEYMWVEVAPYGGPLAVTRDPTKLVPVKGNARPMIRIFDTTGREMGHILWNHGKLIAMGWSDMEELICIQENATVFVYDMFGREKESYSIGDEASVTKIVEGKVFQSSAGTGVAVMTTSGRVFLKQNSSKTERKLPDIPNSSM----NCSCWEIVTE-----------GRNSYCLLGRDREVIKLFPGETVGTITANLFEKPHERIIKISVSYNHQHLALYTNTGLLWLGSVDMR--QKYCEFDTGRKDMP-LQMEWIMNSDNSEADAVVISYPSYLLIVNRNADRSDFPY--DPVMFLVAEMDGVRIITQSSHEIIQRLPKCVENIFAVNSQEPASYLFEAQKKFEEKSYKSDEYLSMCREK---IDLAVSECIEAASYEFCPETQKSLLRTAYFGKGFIRNHNPDEYMRIMRILRVLNTLRHERIAMPITFKQFSHLNTEVILSRLVFRKHYAIAIQVAKHLNLPE----SWILEHWAYHKVMNDPNDTEVARKITEKFKNPSVEGISFCNIASKAHQAGRDDLAIKLLELESRASLHVPLLLKMRKFDRAVGSATQSGDTELITQVLLEMKMHMMLSNLHMTIRDHPLALNIY-KKIMRESNRAGLYGIYNTEDDQKAIA---EYHFQNAIETEGLESNLSMIG---NAYAQGRCTLEAELCADTSRLIKLQKTL--STKYNVSLNGLS--IHETIQELLLIGELKEAERIRSEFKVPDRRFWWLRILTLSSQHKWEELEKLAK--SKKSPIGYDPFVEVCLKQDNVMEARKYIPRCRDNRRVVWYMRANLFNEA 791          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Zebrafish
Match: vps16 (vacuolar protein sorting 16 homolog [Source:ZFIN;Acc:ZDB-GENE-050809-9])

HSP 1 Score: 300.827 bits (769), Expect = 1.075e-88
Identity = 232/857 (27.07%), Postives = 428/857 (49.94%), Query Frame = 2
Query:  107 MDVIVENWSLIGDNYYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVIS-----KAHSNQELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFI----LERDLSVVKSTCQFDFTINDGDNVQLEWA----GEDCLVFFHQDYLYLMDTEPQSTYSLYLED-PLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAG-KYIKRSDKESLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMY--------MENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSMKY*YRCSNVID 2608
            M  +  NW+ +G+ +Y K   Y MAW +  D  K+  FA   YGG IA++         +  +L ++S SG  ++   WK   V  L W+  + +  +Q+ G V +++L   + ++  MG+ V Q  V   + F S  GTG+ +LT        TN+   D  ++ +     + A   + W   T   D++   + A+   L  L  D          G    +S I  + +S + + +A++  +G +++    L+  LS V++  +           Q+ W      ++       D L L+  E + T    L+D  ++ PE+DGVR+I+ T HE +Q++P   E++++ +S +P  LL +A +  + +  +A  +L  I  ++  +  A+  C+ AA +  EP  QK++L A   G+ +  ++  E+   +   L +LN ++   + +P+T  Q +++ +  +I RL+ R  YP    +C  L+ P+  G++R+L+HWA  K  ++ + + +IA+ V  +L + A   +++IA +AYE  + ELA KL+E E R   QV +LLK+KK   ALS++I+SGD++L+  VV  L+  L   DF  M+   PVA ++Y         + L DL NQD D       E   N  +K       + + + ++A ++ + +  D Y KA N+F  +  +DE  +L+      K  E    P+ +   +HD ++ L     ++ AE + +  ++ D++F+WLKL + A+  +WDE +   +  ++K+P  Y    ++C  + N+    K + K+ PE++V+ ++ +  ++ A E A   +N+  I  V S     RCS+  D
Sbjct:    1 MAFVTANWNPLGEAFYRKIELYEMAWKL-KDGLKDCLFAAAPYGGPIALLKWHNRRSPSARPQLEIYSSSGLPLASFPWKSGVVKQLGWTVSDDLLCVQEDGTVLVYDLLGGFKRHFSMGNEVSQSQVLETKIFHSPYGTGVAILTGALRFTLATNI--DDIKLRRLPEVPGIQAAP-SCWAVLTQ--DRQSKVLVASGAHLFIL--DNTACTPVTPPGLSPQASSILHMCVSFSYKYLALLTDSGHVWMGTSNLKEKLSEVETKIK-------TPPRQMAWCRRPKSQEPSAVVMWDGLLLVVGECKETIQYQLDDDSILVPELDGVRIISGTHHELLQEVPGACEEIFKIASMAPGALLLEAHKEYEKESQKADEYLREI-KEQSLLSEAVQQCVEAAGHEHEPETQKTLLRAASFGKCFLSNFPPEQFVSMCRDLRVLNAVRDYTIGIPLTHTQFKQMTVQVLIDRLVYRKLYPLAIEVCRYLKTPEYQGVSRVLKHWACFKVQQKEESDEVIAKAVSVKLADAAGISYSEIATKAYESGRTELAIKLLEFEPRSGEQVPLLLKMKKSPLALSKAIESGDTDLVYTVVMYLKNELNRGDFFMMLRNQPVALSLYRQFCKHQEQDTLKDLFNQDDDH------EELGNFYVKA------SYKEQRLEARIALLQSAVDEYYKAKNEFSAKSTEDEMRLLRFQR---KLEEEKGEPL-VGFSLHDTMTTLLSVGLHKHAEQLYKDFRVPDKRFWWLKLKALAEKEDWDELEKFAK--SKKSPIGYLPFVDVCIKHHNKYEARKYVSKVTPEQKVKAHLAVGDMEGAAEAAIERRNDTEISTVLS-----RCSSTTD 818          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Zebrafish
Match: vps16 (vacuolar protein sorting 16 homolog [Source:ZFIN;Acc:ZDB-GENE-050809-9])

HSP 1 Score: 300.827 bits (769), Expect = 1.120e-88
Identity = 232/857 (27.07%), Postives = 429/857 (50.06%), Query Frame = 2
Query:  107 MDVIVENWSLIGDNYYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVIS-----KAHSNQELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFI----LERDLSVVKSTCQFDFTINDGDNVQLEWA----GEDCLVFFHQDYLYLMDTEPQSTYSLYLED-PLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAG-KYIKRSDKESLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMY--------MENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSMKY*YRCSNVID 2608
            M  +  NW+ +G+ +Y K   Y MAW++  D  K+  FA   YGG IA++         +  +L ++S SG  ++   WK   V  L W+  + +  +Q+ G V +++L   + ++  MG+ V Q  V   + F S  GTG+ +LT        TN+   D  ++ +     + A   + W   T   D++   + A+   L  L  D          G    +S I  + +S + + +A++  +G +++    L+  LS V++  +           Q+ W      ++       D L L+  E + T    L+D  ++ PE+DGVR+I+ T HE +Q++P   E++++ +S +P  LL +A +  + +  +A  +L  I  ++  +  A+  C+ AA +  EP  QK++L A   G+ +  ++  E+   +   L +LN ++   + +P+T  Q +++ +  +I RL+ R  YP    +C  L+ P+  G++R+L+HWA  K  ++ + + +IA+ V  +L + A   +++IA +AYE  + ELA KL+E E R   QV +LLK+KK   ALS++I+SGD++L+  VV  L+  L   DF  M+   PVA ++Y         + L DL NQD D       E   N  +K       + + + ++A ++ + +  D Y KA N+F  +  +DE  +L+      K  E    P+ +   +HD ++ L     ++ AE + +  ++ D++F+WLKL + A+  +WDE +   +  ++K+P  Y    ++C  + N+    K + K+ PE++V+ ++ +  ++ A E A   +N+  I  V S     RCS+  D
Sbjct:    1 MAFVTANWNPLGEAFYRKIELYEMAWNL-KDGLKDCLFAAAPYGGPIALLKWHNRRSPSARPQLEIYSSSGLPLASFPWKSGVVKQLGWTVSDDLLCVQEDGTVLVYDLLGGFKRHFSMGNEVSQSQVLETKIFHSPYGTGVAILTGALRFTLATNI--DDIKLRRLPEVPGIQAAP-SCWAVLTQ--DRQSKVLVASGAHLFIL--DNTACTPVTPPGLSPQASSILHMCVSFSYKYLALLTDSGHVWMGTSNLKEKLSEVETKIK-------TPPRQMAWCRRPKSQEPSAVVMWDGLLLVVGECKETIQYQLDDDSILVPELDGVRIISGTHHELLQEVPGACEEIFKIASMAPGALLLEAHKEYEKESQKADEYLREI-KEQSLLSEAVQQCVEAAGHEHEPETQKTLLRAASFGKCFLSNFPPEQFVSMCRDLRVLNAVRDYTIGIPLTHTQFKQMTVQVLIDRLVYRKLYPLAIEVCRYLKTPEYQGVSRVLKHWACFKVQQKEESDEVIAKAVSVKLADAAGISYSEIATKAYESGRTELAIKLLEFEPRSGEQVPLLLKMKKSPLALSKAIESGDTDLVYTVVMYLKNELNRGDFFMMLRNQPVALSLYRQFCKHQEQDTLKDLFNQDDDH------EELGNFYVKA------SYKEQRLEARIALLQSAVDEYYKAKNEFSAKSTEDEMRLLRFQR---KLEEEKGEPL-VGFSLHDTMTTLLSVGLHKHAEQLYKDFRVPDKRFWWLKLKALAEKEDWDELEKFAK--SKKSPIGYLPFVDVCIKHHNKYEARKYVSKVTPEQKVKAHLAVGDMEGAAEAAIERRNDTEISTVLS-----RCSSTTD 818          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Xenopus
Match: vps16 (VPS16, CORVET/HOPS core subunit [Source:NCBI gene;Acc:448414])

HSP 1 Score: 247.669 bits (631), Expect = 2.070e-69
Identity = 212/851 (24.91%), Postives = 413/851 (48.53%), Query Frame = 2
Query:  107 MDVIVENWSLIGDNYYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVISK--AHSNQELI-VFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAGED-----CLVFFHQDYLYLMDTEPQSTYSLYLEDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSDK-ESLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMYM--------ENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSMKY*YRCSNVID 2608
            MD    NW  +G  YY K+  Y M W +  D F+    A   Y G++A++    A   + ++ ++S +G  +S I WK   V+ L W+  + +  +Q+ G V I+++ C + ++  +G  VKQ+ V   + F +   TG+ +LT   +    +N+   D V          +    T W       D+  + + A    L  L       +   G    + S++  ++++S   + +AV    G I++     S+    C+F   +      Q+ W          L    +  ++L+    +  +    E   + PE+DG+R+++++ HEF+ +IP   E +++ +S +P  LL +AQ+  + +  +A ++L  I   +  +  A++ C+ AA     P  QKS+L A   G+ +   Y       +   L +LN +    + +P+TM Q +++ +  ++ RL+ R  YP    IC  L+     G++R+L HWA   +++ +K +  IA+ + ++L +     +++IA +A E  + ELA KL+E E +   QV +LLK+K+   AL+++I+SGD++L+  VV+ ++      DF   +  +PVA ++Y         E L DL NQD +  +        N  +++    +K  R E   A L   NAV++ Y KA ++   +  +D+  +L++        +  +    +   +HD +  L  +  ++KAE + ++ K+ D++++WLK+++ A+  +W+E +   +  ++K+   Y    EIC  + N+    K I ++  E+RV+ ++ +  L +A E A   +NE  ++ V S     RC++  D
Sbjct:    1 MDFYTANWYPMGSVYYRKFDCYRMEWDL-RDGFRECLVAAGPYAGTVALMRNYCAKPGRPILEIYSAAGVLLSSIPWKSGQVVHLGWTLTQDLVCIQEDGTVLIYDIFCAFKRHFSLGSEVKQNQVLEAKVFHTEYRTGIAILTGALKFTVASNI---DDVKLRRLPEIPALRGPPTCWTVL--FNDRVPLVLAAVGPDLYLLDNTSCTAVTLPGMSPLAGSAL--QMAVSFNYKYLAVFTDTGYIWM--GTASLTDKLCEFSSDLRQAPK-QMAWCIRPGSRNIALALMWEKLIFLVGRAREGVHFPLDEPSFIVPELDGIRIVSSSTHEFLHEIPKVTEDIFKIASMAPGALLLEAQKEYEKESQKADDYLREI-KDQNHLSDAVENCIEAAGYEHAPEMQKSLLRAASFGKCFVEKYSPADFVTMCQDLRILNAIHDYQIGIPLTMTQYKQLTIQVLLDRLVLRRLYPLALKICEYLKFSDFQGVSRILAHWACYKVQQKEKSDDEIAQAINQKLGDTLGISYSEIASRACECGRTELAIKLLEYEPKSEDQVPLLLKMKRSNLALAKAIESGDTDLVYTVVTYMKNEFNRGDFFMTLQNHPVALSLYRQFCKHQEPETLKDLYNQDDNHLELG------NFYVRSSYGAEK--RVEGRVAELQ--NAVEE-YNKAKSELAARATEDQIKLLRNQRAL----QDKVDKPYLDFSLHDTVYNLILDGMHKKAEQLYKEFKIPDKRYWWLKISALAEKEDWEELEKFSK--SKKSAIGYLPFVEICMKHQNKVEAKKYIARVGIEQRVKAFLLVGDLDQAAESAIEHRNEQEMNMVLS-----RCASAAD 817          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Mouse
Match: Vps16 (VSP16 CORVET/HOPS core subunit [Source:MGI Symbol;Acc:MGI:2136772])

HSP 1 Score: 281.952 bits (720), Expect = 9.638e-82
Identity = 220/856 (25.70%), Postives = 423/856 (49.42%), Query Frame = 2
Query:  107 MDVIVENWSLIGDN-YYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVI------SKAHSNQELI-VFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAG-----EDCLVFFHQDYLYLMDTEPQSTYSLYLEDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSD-KESLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMY--------MENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSMKY*YRCSNVID 2608
            MD    NW+ +GD+ +Y KY  Y+M W +  +  K+   A   YGG IA++       KA S + ++ ++S SG  ++ ++WK  PV+ L WS +E +  +Q+ G V ++ LH ++ ++  MG+ V Q+ V   R F +  G+G+ +LT         N+ +       ++   +V           T   D+    + A    L  L +     +    +G     S   ++++S T + +A+    G I++     S+ +  C+F+  I      Q+ W       E  +V   +  L ++   P+S   +  ED  + PE+DGVR+ + + HEF+ ++P   E++++ +S +P  LL +AQ+  + +  +A  +L  I  + GQ+  A+  C+ AA +  +P  QKS+L A   G+ +   +  +    +   L +LN ++  ++ +P+T  Q +++ +  ++ RL+ R  YP    IC  LR+P+  G++R+L HWA   +++ D  +  +A  + ++L +     ++ IA +AY   + ELA KL+E E R   QV +LLK+K+   ALS++I+SGD++L+  V+  L+  L   DF   +   P+A ++Y        ++ L DL NQD +   Q L       +   E         E I+  ++++    D + KA N+F  +  +D+  +L+      +  E ++    + + +HD ++ L      ++AE + +  ++ D++ +WLKL + A + +W+E +   +  ++K+P  Y    EIC    N++   K   ++ PE++V+  + +  + +A E+A   +NE  +  V S      C+   D
Sbjct:    1 MDCYTANWNPLGDSAFYRKYELYSMDWDL-KEELKDCLVAAAPYGGPIALLRNCWRKEKAASVRPVLEIYSASGLPLASLLWKSGPVVALGWSAEEELLCVQEDGAVLVYGLHGDFRRHFSMGNEVLQNRVLDARIFHTEFGSGVAILTGAYRFTLSANVGDL-----KLRRMPEVPGLQSAPSCWTTLCHDRVPHILLAVGPDLYLLDHATCSAVTP--AGLAPGVSSFLQMAVSFTYRYLALFTDTGYIWM--GTASLKEKLCEFNCNIR-APPKQMVWCSRPRSKERAVVVAWERRLMVVGNAPESIQFVLDEDSYLVPELDGVRIFSRSTHEFLHEVPVASEEIFKIASMAPGALLLEAQKEYEKESQKADEYLREI-QELGQLIQAVQQCIEAAGHEHQPDMQKSLLRAASFGKCFLDRFPPDSFVHMCQDLRVLNAIRDYHIGIPLTYTQYKQLTIQVLLDRLVLRRLYPLAIQICEYLRLPEVQGVSRILAHWACYKVQQKDVSDEDVARAINQKLGDTPGVSYSDIAARAYGCGRTELAIKLLEYEPRSGEQVPLLLKMKRSKLALSKAIESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELDTLKDLYNQDDNH--QELGSFHIRASYAAE---------ERIEGRVAALQTAADAFYKAKNEFAAKATEDQMRLLRIQ----RRLEDELGGRFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWEELEKFSK--SKKSPIGYLPFVEICMKQHNKHEAKKYASRVGPEQKVKALLLVGDVAQAAEVAIEHRNETELSLVLS-----HCTGATD 822          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Mouse
Match: Vps16 (VSP16 CORVET/HOPS core subunit [Source:MGI Symbol;Acc:MGI:2136772])

HSP 1 Score: 130.568 bits (327), Expect = 9.815e-33
Identity = 92/366 (25.14%), Postives = 167/366 (45.63%), Query Frame = 2
Query:  107 MDVIVENWSLIGDN-YYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVI------SKAHSNQELI-VFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILER-DLSVVKSTCQFDFTINDGDNVQLEWAG-----EDCLVFFHQDYLYLMDTEPQSTYSLYLEDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQ 1162
            MD    NW+ +GD+ +Y KY  Y+M W +  +  K+   A   YGG IA++       KA S + ++ ++S SG  ++ ++WK  PV+ L WS +E +  +Q+ G V ++ LH ++ ++  MG+ V Q+ V   R F +  G+G+ +LT         N       +  +K  +                   EV  + +  +  T L +D+ P I                         +AV      +++L+    S V+  C+F+  I      Q+ W       E  +V   +  L ++   P+S   +  ED  + PE+DGVR+ + + HEF+ ++P   E++++ +S +P  LL +AQ+
Sbjct:    1 MDCYTANWNPLGDSAFYRKYELYSMDWDL-KEELKDCLVAAAPYGGPIALLRNCWRKEKAASVRPVLEIYSASGLPLASLLWKSGPVVALGWSAEEELLCVQEDGAVLVYGLHGDFRRHFSMGNEVLQNRVLDARIFHTEFGSGVAILTGAYRFTLSAN-------VGDLKLRRM-----------------PEVPGLQSAPSCWTTLCHDRVPHIL------------------------LAV---GPDLYLLDHATCSAVEKLCEFNCNIRAPPK-QMVWCSRPRSKERAVVVAWERRLMVVGNAPESIQFVLDEDSYLVPELDGVRIFSRSTHEFLHEVPVASEEIFKIASMAPGALLLEAQK 313          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. UniProt/SwissProt
Match: sp|Q9H269|VPS16_HUMAN (Vacuolar protein sorting-associated protein 16 homolog OS=Homo sapiens OX=9606 GN=VPS16 PE=1 SV=2)

HSP 1 Score: 280.796 bits (717), Expect = 1.753e-80
Identity = 218/858 (25.41%), Postives = 423/858 (49.30%), Query Frame = 2
Query:  107 MDVIVENWSLIGDN-YYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVI------SKAHSNQELI-VFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQV--IADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAG-----EDCLVFFHQDYLYLMDTEPQSTYSLYLEDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSD-KESLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMY--------MENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSMKY*YRCSNVID 2608
            MD    NW+ +GD+ +Y KY  Y+M W +  +  ++   A   YGG IA++       KA S + ++ ++S SG  ++ ++WK  PV+ L WS +E +  +Q+ G V ++ LH ++ ++  MG+ V Q+ V   R F +  G+G+ +LT  +      N+ +       ++   +V  +    + W       D+    + A    L  L +     +   G       S   ++++S T + +A+    G I++     S+ +  C+F+  I      Q+ W       E  +V   +  L ++   P+S   +  ED  + PE+DGVR+ + + HEF+ ++P+  E++++ +S +P  LL +AQ+  + +  +A  +L  I  + GQ+  A+  C+ AA +  +P  QKS+L A   G+ +   +  +    +   L +LN ++  ++ +P+T  Q +++ +  ++ RL+ R  YP    IC  LR+P+  G++R+L HWA   +++ D  +  +A  + ++L +     ++ IA +AY   + ELA KL+E E R   QV +LLK+K+   ALS++I+SGD++L+  V+  L+  L   DF   +   P+A ++Y        +E L DL NQD +   Q L       +   E         E I+  ++++    D + KA N+F  +  +D+      +    +  E ++    + + +HD ++ L      ++AE + +  ++ D++ +WLKL + A + +W+E +   +  ++K+P  Y    EIC    N+    K   ++ PE++V+  + +  + +A ++A   +NE  +  V S      C+   D
Sbjct:    1 MDCYTANWNPLGDSAFYRKYELYSMDWDL-KEELRDCLVAAAPYGGPIALLRNPWRKEKAASVRPVLDIYSASGMPLASLLWKSGPVVSLGWSAEEELLCVQEDGAVLVYGLHGDFRRHFSMGNEVLQNRVLDARIFHTEFGSGVAILTGAHRFTLSANVGDL-----KLRRMPEVPGLQSAPSCWTVLCQ--DRVAHILLAVGPDLYLLDHAACSAVTPPGLA--PGVSSFLQMAVSFTYRHLALFTDTGYIWM--GTASLKEKLCEFNCNIR-APPKQMVWCSRPRSKERAVVVAWERRLMVVGDAPESIQFVLDEDSYLVPELDGVRIFSRSTHEFLHEVPAASEEIFKIASMAPGALLLEAQKEYEKESQKADEYLREI-QELGQLTQAVQQCIEAAGHEHQPDMQKSLLRAASFGKCFLDRFPPDSFVHMCQDLRVLNAVRDYHIGIPLTYSQYKQLTIQVLLDRLVLRRLYPLAIQICEYLRLPEVQGVSRILAHWACYKVQQKDVSDEDVARAINQKLGDTPGVSYSDIAARAYGCGRTELAIKLLEYEPRSGEQVPLLLKMKRSKLALSKAIESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNH--QELGSFHIRASYAAE---------ERIEGRVAALQTAADAFYKAKNEFAAKATEDQ----MRLLRLQRRLEDELGGQFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSK--SKKSPIGYLPFVEICMKQHNKYEAKKYASRVGPEQKVKALLLVGDVAQAADVAIEHRNEAELSLVLS-----HCTGATD 822          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. UniProt/SwissProt
Match: sp|Q920Q4|VPS16_MOUSE (Vacuolar protein sorting-associated protein 16 homolog OS=Mus musculus OX=10090 GN=Vps16 PE=1 SV=3)

HSP 1 Score: 280.026 bits (715), Expect = 2.898e-80
Identity = 220/856 (25.70%), Postives = 422/856 (49.30%), Query Frame = 2
Query:  107 MDVIVENWSLIGDN-YYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVI------SKAHSNQELI-VFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAG-----EDCLVFFHQDYLYLMDTEPQSTYSLYLEDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSD-KESLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMY--------MENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSMKY*YRCSNVID 2608
            MD    NW+ +GD+ +Y KY  Y+M W +  +  K+   A   YGG IA++       KA S + ++ ++S SG  ++ ++WK  PV+ L WS +E +  +Q+ G V ++ LH ++ ++  MG+ V Q+ V   R F +  G+G+ +LT         N+ +       ++   +V           T   D+    + A    L  L +     +    +G     S   ++++S T + +A+    G I++     S+ +  C+F+  I      Q+ W       E  +V   +  L ++   P+S   +  ED  + PE+DGVR+ + + HEF+ ++P   E++++ +S +P  LL +AQ+  + +  +A  +L  I  + GQ+  A+  C+ AA +  +P  QKS+L A   G+ +   +  +    +   L +LN ++  ++ +P+T  Q +++ +  ++ RL+ R  YP    IC  LR+P+  G++R+L HWA    +  D ++  +A  + ++L +     ++ IA +AY   + ELA KL+E E R   QV +LLK+K+   ALS++I+SGD++L+  V+  L+  L   DF   +   P+A ++Y        ++ L DL NQD +   Q L       +   E         E I+  ++++    D + KA N+F  +  +D+  +L+      +  E ++    + + +HD ++ L      ++AE + +  ++ D++ +WLKL + A + +W+E +   +  ++K+P  Y    EIC    N++   K   ++ PE++V+  + +  + +A E+A   +NE  +  V S      C+   D
Sbjct:    1 MDCYTANWNPLGDSAFYRKYELYSMDWDL-KEELKDCLVAAAPYGGPIALLRNCWRKEKAASVRPVLEIYSASGLPLASLLWKSGPVVALGWSAEEELLCVQEDGAVLVYGLHGDFRRHFSMGNEVLQNRVLDARIFHTEFGSGVAILTGAYRFTLSANVGDL-----KLRRMPEVPGLQSAPSCWTTLCHDRVPHILLAVGPDLYLLDHATCSAVTP--AGLAPGVSSFLQMAVSFTYRYLALFTDTGYIWM--GTASLKEKLCEFNCNIR-APPKQMVWCSRPRSKERAVVVAWERRLMVVGNAPESIQFVLDEDSYLVPELDGVRIFSRSTHEFLHEVPVASEEIFKIASMAPGALLLEAQKEYEKESQKADEYLREI-QELGQLIQAVQQCIEAAGHEHQPDMQKSLLRAASFGKCFLDRFPPDSFVHMCQDLRVLNAIRDYHIGIPLTYTQYKQLTIQVLLDRLVLRRLYPLAIQICEYLRLPEVQGVSRILAHWACYKARAWDMRDEDVARAINQKLGDTPGVSYSDIAARAYGCGRTELAIKLLEYEPRSGEQVPLLLKMKRSKLALSKAIESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELDTLKDLYNQDDNH--QELGSFHIRASYAAE---------ERIEGRVAALQTAADAFYKAKNEFAAKATEDQMRLLRIQ----RRLEDELGGRFLDLSLHDTVTTLILGGHNKRAEQLARDFRIPDKRLWWLKLAALADLEDWEELEKFSK--SKKSPIGYLPFVEICMKQHNKHEAKKYASRVGPEQKVKALLLVGDVAQAAEVAIEHRNETELSLVLS-----HCTGATD 822          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. UniProt/SwissProt
Match: sp|Q5E9L7|VPS16_BOVIN (Vacuolar protein sorting-associated protein 16 homolog OS=Bos taurus OX=9913 GN=VPS16 PE=2 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 3.427e-79
Identity = 217/856 (25.35%), Postives = 417/856 (48.71%), Query Frame = 2
Query:  107 MDVIVENWSLIGDN-YYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVI-------SKAHSNQELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAG-----EDCLVFFHQDYLYLMDTEPQSTYSLYLEDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSD-KESLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMY--------MENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSMKY*YRCSNVID 2608
            MD    NW+ +GD+ +Y KY  Y+M W +  +  ++   A   YGG IA++         A +   L ++S SG  ++ ++WK  PV+ L WS +E +  +Q+ G V ++ LH ++ ++  MG+ V Q+ V   R F +  G+G+ +LT  +      N+ +       ++   +V           T   D+    + A    L  L +     +   G       S   ++++S T + +A+    G I++     S+ +  C+F+  I      Q+ W       E  +V   +  L ++   P+S   +  ED  + PE+DGVR+ + + HEF+ ++P   E++++ +S +P  LL +AQ+  + +  +A  +L  I  + GQ+  A+  C+ AA +   P  QKS+L A   G+ +   +  +    +   L +LN ++  ++ +P+T  Q +++ +  ++ RL+ R  YP    IC  LR+P+  G++R+L HWA   +++ D  +  +A  + ++L +     ++ IA +AY   + ELA KL+E E R   QV +LLK+K+   ALS++I+SGD++L+  V+  L+  L   DF   +   P+A ++Y        +E L DL NQD +   Q L       +   E         E I+  ++++    D + KA N+F  +  +D+      +    +  E ++    + + +HD ++ L  +   ++AE + +  ++ D++ +WLKL + A + +W+E +   +  ++K+P  Y    EIC    N+    K   ++ PE++V+  + +  + +A ++A   +NE  +  V S      C+   D
Sbjct:    1 MDCYTANWNPLGDSAFYRKYELYSMDWDL-KEELRDCLVAAAPYGGPIALLRNPWRKEKPASARPVLEIYSASGVPLASLLWKSGPVVSLGWSAEEELLCVQEDGVVLVYGLHGDFRRHFSMGNEVLQNRVLDARIFHTEFGSGVAILTGAHRFTLSANVGDL-----KLRRMPEVPGLXSAPSCWTTVCQDRVAHILLAVGPDLYLLDHAACSAVTPPGLA--PGVSSFLQMAVSFTYRHLALFTDTGYIWM--GTASLKEKLCEFNCNIR-APPKQMVWCSRPRSKERAVVVAWERRLMVVGDAPESIQFVLDEDSYLVPELDGVRVFSRSTHEFLHEVPVASEEIFKIASMAPGALLLEAQKEYEKESQKADEYLREI-QELGQLPQAVQQCIEAAGHEHWPDMQKSLLRAASFGKCFLDRFPPDSFVRMCQDLRVLNAIRDYHIGIPLTYSQYKQLTIQVLLDRLVLRRLYPLAIQICEYLRLPEVQGVSRILAHWACYKVQQKDVSDEDVARAINQKLGDTPGVSYSDIAARAYGCGRTELAIKLLEYEPRSGEQVPLLLKMKRSKLALSKAIESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMALSLYRQFCKHQELETLKDLYNQDDNH--QELGSFHIRASYAAE---------ERIEGRVAALQTAADAFYKAKNEFAAKATEDQ----MRLLRLQRRLEDELGGQFLDLSLHDTVTTLILSGQNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSK--SKKSPIGYLPFVEICMKQHNKYEAKKYASRVGPEQKVKALLLVGDVAQAADVAIEHRNEAEMSLVLS-----HCTGATD 822          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. UniProt/SwissProt
Match: sp|Q55C58|VPS16_DICDI (Vacuolar protein sorting-associated protein 16 homolog OS=Dictyostelium discoideum OX=44689 GN=vps16 PE=3 SV=2)

HSP 1 Score: 219.935 bits (559), Expect = 6.653e-59
Identity = 213/857 (24.85%), Postives = 416/857 (48.54%), Query Frame = 2
Query:  113 VIVENWSLIGDNYYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVISKAHSNQE---------LIVFSPSGRFISRIMWKDAP-VIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNL----MNTDSVIKTIKNSKQVIADNFTDWLAF-TDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAGEDCLVFFH---QDYLYLMDTEPQSTYSLYLEDPL-MFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSDKESLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMYM-----ENLFDLSNQDTDRSKQSLEESDENL--AMKTE-NQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKI-EPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSMKY*YRCSN 2599
            +I   W +IG++ YIK   Y+M+W +D    K        + G IAV+  +    E         L +F+ SG  IS+++W  +  ++ ++W E E + ++ ++  V I N+ CE +    +GD V++  +   + ++     G++VLT  ++L+   ++    + +  VI+     ++  A    +W       +  + + +F + N    L  D++ V           +  I K+ +S   +++A     G + IL+ D S   +T           +  L+W G D ++ +    +D +    ++  S     L+ P+ +  EIDG+R+I+ T  EF  K+      +++  + SPA +L+DA  H  +K  +A    E I S   Q++ A++ C+ AA        Q  +L A   G+ +  +Y   +   +   L +LN ++   + +P+++ Q   IG+  +I RLI+R  +     IC  L+I  D  +N    HWA   ++    +  + + +IK+LE+     FA IA  AY   + +LA KL+E E +   QV  L+K+ +   AL+++I+SGD++L+  V+  +Q+SL   DF+ +     VA  + +     +N F L  +      QS E  +  L  A+ +  +QL + ++A N   ++   +  +D   +A + F+     D++I L+ +   ++    D S VGI+  I+D +  L      +KA++I+ + K+ D++F+W+K+ + + +N+W+E     ++  +K+P  Y    E+C D  N+    K I KI +   +++ Y+++   +EA ++A   KN  L++ +S      +C+N
Sbjct:    1 MIAAQWKIIGNSTYIKKEIYSMSWDVD---LKQQVSVGSPFAGPIAVMRDSSKFVEMNSQNMKPYLKIFTASGDLISQMIWDSSKNIVAMDWIEKERLVIVLQNATVLIFNVFCEQMTQFSLGDIVREEEILECKIWSD----GIVVLTSASQLYSVPSINDFFVESGRVIRLPPLPEEPKAR--PEWAILEPQFSLSQSIEIFMSINGTLYL-IDEDKV-----ESQLEATEPIQKMVVSPCGKKLACFDTKGTLLILKTDGS---TTNPDRMDTKATKSPVLKWCGSDGVMMYWDSIKDPILFYFSKGDSWAKFTLDQPVSLVTEIDGLRIISDTTSEFFHKVSDVTIDIFKIGTTSPASILYDATDHFISKSPQAD---ESIRSINDQLEDAVNDCILAAGFEFNGGEQSKLLKAASFGKCFLENYNPSQFVTMCRSLRVLNAVRHHEIGIPLSIKQYYHIGIEELIDRLISRRKHLLAWRICDYLKIKSDVVLN----HWACTKVRTDIPDQELGKIIIKKLESVPGISFANIASAAYLAGRSKLATKLLEYEPKAAEQVPPLIKMGESGLALNKAIESGDTDLVYLVLLAMQRSLPLADFLELTFSKVVALDLLISMCKQKNDFPLLREIYHIKDQSKEMGNIYLQEALSSHPSQLDQRIKAYN--KSIEHYHHSKDKDDQATSKFI-----DDQIKLEMLQKELETNLQDESFVGIS--INDTIYKLITMNQPKKAQSIRSEFKVPDKRFWWIKIKALSIMNDWEELMKFSKE--KKSPIGYEPFVEVCLDQKNQIEALKYIPKITDILPKIQFYIQIGYFREAADIAFKEKNFDLLNLISR-----KCTN 816          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. UniProt/SwissProt
Match: sp|Q9UT38|VPS16_SCHPO (Probable vacuolar protein sorting-associated protein 16 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps16 PE=3 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 8.977e-55
Identity = 209/837 (24.97%), Postives = 395/837 (47.19%), Query Frame = 2
Query:  128 WSLIGDNYYIKYHFYNMAWS-IDNDNFKNYYFAHEIYGGSIAVISKAHSNQE------------LIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRF-----FTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIK-NSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSM--IYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAGEDCLVFFHQDYLYLMDTEPQSTYSLYLEDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKR-SDKESLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMYME--------NLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWN---RKTPDNYYDIGEICADYDNENVLSKIIDK---IEPEKRVRLYVKMNKLQEAEELA 2530
            W L+ D YY K       W  ID  +F    FA    GG+IA I+++ SN +            + VF  SG+ +  + W    ++G+ W+E+E + ++ K G+V ++NL  E+ ++  +G  V+   ++  +F     F  LQ    + +T   E + KT      + ++    +S  +I + F+      DL    VV V  +      L+ D+      Q S   S SS+  +  +S+S   + +A+    GK+ ++  D S      +   T+ +    Q+ W G D +V  H++ L L+     S   LY   P++  E+DGVR++T    EF++K+P+ LE ++   S++P   L +A Q +  K   +V   +++L  + ++  A+DTC+ A+ N     WQK +L A  LG++    Y  ++  DV  +L +LN  + P V + +T  +   +GL  +I R   R  Y         ++IP D     +   WA  YIK+ S+ E ++ + ++KRL +     + KIA  AY+  +L L+ KL++ E    +QV +LL ++ +  AL + I++ D+NLI YVV ++++ +    F  +++  P A  +Y+E         L D   QD ++   ++   ++ L   T NQ   +L++    A + S +    L +K         + DE  +LQ   T     E   +   + + +++ +  L Q    ++A  ++   ++ +++F WLKL +   I +W      +++W    R++P  +           N+   +K I +   +  +++V ++V++  ++ A E A
Sbjct:   12 WELLQDTYYQKSAIGKAEWEYIDPVDF---MFAVAPCGGAIA-ITRSESNLQSNYKYDQVPMYSICVFCLSGQLLQTLTWDKTSLVGMGWNENEELIVVSKQGQVRVYNLLGEFHQF-SLGKGVENIGIRECQFSEGGVFALLQNDTFISITGFEEPWRKTYASIPFNTLEYYNIDSWALIPNPFS-----PDLGMDIVVTVGPH-----ILQIDE------QDSQLHSISSLQHVSHISISPNARYLALYESVGKVRVISSDFSKELLDLRLPETVAEASLKQMAWCGNDAVVLVHENLLTLVGPFGGSVPYLYNHTPIVSTEVDGVRILTKDSSEFLRKVPAPLENIFHIGSKTPGAKLVEAFQKMKLK---SVFAEKMLLELKDELHDAVDTCVQASLNEFSIEWQKVLLEAASLGKNSLRMYNHQEYVDVCRELRVLNAARDPNVGIYITHEEYLHLGLERLIQRFSCRQLYGLAVQASMWMQIPCDW----VYIQWAQTYIKQSSEPEEVVLDNIVKRLSSRKYISYEKIARTAYQEGRLILSTKLLDFEPLAKHQVMLLLNMEAYEQALKKVIETMDNNLIIYVVLQIKQQMAIASFFQILNEYPDAVKVYVEFAKKNDRKTLHDFFYQDDNKQGIAVLAVEDTLKTATVNQRITSLKSA---AKVCSESKELSLEEKC--------LGDEIKLLQLQQTY----EDQFTGNFVGLTVNEVVVKLIQINQTQRANKLRSDFQIPEKRFAWLKLRALVAIRDW----VQIEQWAGSMRRSPIGFEPFVTEILSAGNKKEAAKYIPRCTQLTTQEKVDMWVQVGDVKSASEEA 801          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. TrEMBL
Match: A0A5A9NVZ8 (Vacuolar protein sorting-associated protein 16 homolog OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti009185 PE=3 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 4.800e-88
Identity = 233/851 (27.38%), Postives = 426/851 (50.06%), Query Frame = 2
Query:  107 MDVIVENWSLIGDNYYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVIS-----KAHSNQELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEW--AGEDCLVFFHQDYLYLMDTEPQSTYSLYLE-DPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAG-KYIKRSDKESLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMY--------MENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSMKY*YRCSNVID 2608
            M  +  NW+ +G+ +Y K   Y+M+W +  ++ + Y  A   YGG IA++         +  +L +FS SG  ++   WK   V  L W+  + +  +Q+ G V +++L   + ++  MG+ V Q  V   + F S  GTG+ +LT        TN+   D  +K +      +    T W   T   D++   + AN   L  L  D          G    +S I  + +S + + +A++  +G +++   +L   +   + D  I +    Q+ W  A +   V    D L L+  E +      L+ D ++ PE+DGVR+I  T HE +Q++P   E++++ +S +P  LL +A +  + +  +A  +L  I  ++  +  A+  C+ AA +  EP  QK++L A   G+ +  ++  E    +   L +LN ++   V MP+T  Q +++ +  +I RL++R  YP    +C  L+ P+  G++R+L+HWA  K  ++ + + +IA+ V  RL + +   +++IA +AYE  + ELA KL+E E R   QV +LLK+KK   ALS++I+SGD++L+  VV  L+  L   DF  M+   PVA ++Y        +  L DL NQD +  +                 +K +     ++A ++ + +  D + KA N+F  +  ++E  +L+      K  E+   P+ +   +HD ++ L     ++ AE + +  ++SD++F+WLKL + A+  +WDE +   +  ++K+P  Y    E+C  + N++   K + ++ PE++V+ ++ +  LQ A E A   +NE  I+ V S     RCS   D
Sbjct:    1 MAFVTANWNPLGEAFYRKVELYDMSWKL-KESLREYLIAAAPYGGPIALLKGYQGRSPSTRPQLEIFSASGVPMASFPWKSGLVKQLGWTVSDDLLCVQEDGTVLVYDLLGGFKRHFSMGNEVSQSQVMETKIFHSPYGTGVAILTGALRFTLATNI--DDIKLKRLPEVPG-LEGAPTCWAVLTQ--DRQSKVMVANGYHLFIL--DNTSCTSVTPPGLSPQASSILHMCVSFSYKYLAILTDSGHVWMGTSNLK--EKISEVDTNIRNPPK-QMAWHEASQQSSVVIMWDRLLLVVGECKEIIQYPLDSDSVLVPEMDGVRIINETHHELLQEVPGACEEIFKIASMAPGALLLEAHKEYEKESQKADEYLREI-KEQNLLAEAVKQCVEAAGHEYEPETQKTLLRAASFGKCFLSNFPPELFISMCRDLRVLNAVRDYTVGMPLTHTQFKQMTIQVLIDRLVHRKLYPLAIEVCRYLKTPEYQGVSRVLKHWACYKVQQKEESDEVIAKTVNMRLADASGISYSEIATKAYESGRTELAIKLLEYEPRSGEQVPLLLKMKKSPLALSKAIESGDTDLVYTVVMYLKNELNRGDFFMMLRNQPVALSLYRQFCKHQELNTLMDLFNQDDNHQELG------------NYYVKASYNEPRLEARVALLQSSVDEFNKAKNEFAAKATEEEMRLLRFQR---KLEEAKGEPL-LGFSLHDTITALLSVGLHKHAEQLYKDFRVSDKRFWWLKLKALAEKGDWDELEKFAK--SKKSPIGYLPFVEVCIKHQNKHEARKYVSRVTPEQKVKAHLAVGDLQSATEAAIERRNESEINTVLS-----RCSATTD 816          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. TrEMBL
Match: A0A1S3I6Y6 (Vacuolar protein sorting-associated protein 16 homolog OS=Lingula unguis OX=7574 GN=LOC106161529 PE=3 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 1.121e-87
Identity = 225/841 (26.75%), Postives = 426/841 (50.65%), Query Frame = 2
Query:  107 MDVIVENWSLIGDNYYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVI-------SKAHSN--QELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKL----KYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAGEDCLVFFHQDYLYLMDTEPQSTYSLYLED-PL-MFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSDKE-SLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMYMENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNW---DEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSS 2572
            M +   +W+ +G+ +Y K   Y M W  D      Y  A   YGG IA+I       +K   N    + ++S +GR I+R  W    VI L WS  E +  +Q  G V ++++   + +   +G  VK   V   + F +   TG+ VLT    +F   N+   D  ++ +     + A   + W       D++  A+ A  N L  L    +Y ++ V  S         S I ++S+S   + +A+    G ++I   DL   K  C+F+ T +     QL W G   +V +  +   L+   P   +  Y  D P+ +  EIDG+R+I    HEF+Q++P  +E++++  S +P  +L++A +        A  ++ +I  K   + +A++ C+  A    EP+ QK++L A   G+ +  D R E   ++   L +LN ++   V +P+T  QL+ + L  +I RL+ R +YP    IC  L+IP+  G +R++ HWA   ++++  E   IA  + ++L +     +++IA +A ++ + ELA +L++ E R   QV +L+K+KK   ALS++I+SGD++L+  V+  L++ +   DF   I   PVA A+Y++       Q+  ++ Q L   ++N   + + ++K+    E +++ +  + A  + Y KA N++  ++ +++  +L+      +  E +++   + + +H  +  L +   ++ AE +K++ K+ DR+F+WLK+ + A+  +W   D F  T     +K+P  Y    E+C +  N    +K + ++ PE +V+ +V++ +L+EA E+A   +NE  +++V S
Sbjct:    1 MALATADWNPLGEVFYRKTELYQMEWMQD---LYKYNVATAPYGGPIALIQDESKLVAKVQGNIKPTVYIYSAAGREITRFTWNSGHVIQLGWSNTEDLLCVQDDGGVLVYDIFGNFKRTFSLGTEVKDTKVLEVKIFQTANTTGIAVLTSTYRIFVCNNI--EDPRVRRLAEVPGLQAPP-SSWAIINQ--DRQTRALVAKENELFLLDHGGQYQQQTVDVS-----IPVESFI-EMSVSFNNKYLALFTNTGLLWIGSADLQ--KVYCEFN-TKSAVRPTQLCWCGTGSIVSYWAELNLLLMVGPSKDWVKYSYDTPVTLVQEIDGLRIIGNDTHEFLQRVPPVVEEIFKIGSMAPGAMLYEASREFGKGSQRADEYIRMIKDK---LDLAVEQCIEGAGYEYEPKSQKALLRAASFGKCFLTDVRPETFVNMCQMLRVLNAVRDYTVGLPLTYTQLQSLTLPVLIDRLVVRRHYPLAVRICQYLKIPEADGASRIMAHWACYKVEQTGVEDEAIARSISQKLGDTPGVSYSEIANKALDVGRPELATRLLDYEPRAAEQVPLLMKMKKEQLALSKAIESGDTDLMYMVILNLKEKMSLGDFYMTIRNMPVAHALYLQ----YCRQENLKNLQDLYYQEDNFQEEGDCRVKECYTEERLESRIDCLMAAMECYNKARNEWAAKVTEEQVKLLKYQ----RKMEEELNKPYLNLSLHRTMYQLVKENNHKLAETLKKEFKVPDRRFWWLKIRALAEAGDWMELDRFSKT-----KKSPIGYEPFIEVCMENHNRFEATKYLTRVAPENKVKCHVRVGQLKEAAEIAFQQRNEEELNFVLS 808          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. TrEMBL
Match: A5D6T0 (Vacuolar protein sorting-associated protein 16 homolog OS=Danio rerio OX=7955 GN=vps16 PE=1 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 2.406e-85
Identity = 232/857 (27.07%), Postives = 428/857 (49.94%), Query Frame = 2
Query:  107 MDVIVENWSLIGDNYYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVIS-----KAHSNQELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFI----LERDLSVVKSTCQFDFTINDGDNVQLEWA----GEDCLVFFHQDYLYLMDTEPQSTYSLYLED-PLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAG-KYIKRSDKESLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMY--------MENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSMKY*YRCSNVID 2608
            M  +  NW+ +G+ +Y K   Y MAW +  D  K+  FA   YGG IA++         +  +L ++S SG  ++   WK   V  L W+  + +  +Q+ G V +++L   + ++  MG+ V Q  V   + F S  GTG+ +LT        TN+   D  ++ +     + A   + W   T   D++   + A+   L  L  D          G    +S I  + +S + + +A++  +G +++    L+  LS V++  +           Q+ W      ++       D L L+  E + T    L+D  ++ PE+DGVR+I+ T HE +Q++P   E++++ +S +P  LL +A +  + +  +A  +L  I  ++  +  A+  C+ AA +  EP  QK++L A   G+ +  ++  E+   +   L +LN ++   + +P+T  Q +++ +  +I RL+ R  YP    +C  L+ P+  G++R+L+HWA  K  ++ + + +IA+ V  +L + A   +++IA +AYE  + ELA KL+E E R   QV +LLK+KK   ALS++I+SGD++L+  VV  L+  L   DF  M+   PVA ++Y         + L DL NQD D       E   N  +K       + + + ++A ++ + +  D Y KA N+F  +  +DE  +L+      K  E    P+ +   +HD ++ L     ++ AE + +  ++ D++F+WLKL + A+  +WDE +   +  ++K+P  Y    ++C  + N+    K + K+ PE++V+ ++ +  ++ A E A   +N+  I  V S     RCS+  D
Sbjct:    1 MAFVTANWNPLGEAFYRKIELYEMAWKL-KDGLKDCLFAAAPYGGPIALLKWHNRRSPSARPQLEIYSSSGLPLASFPWKSGVVKQLGWTVSDDLLCVQEDGTVLVYDLLGGFKRHFSMGNEVSQSQVLETKIFHSPYGTGVAILTGALRFTLATNI--DDIKLRRLPEVPGIQAAP-SCWAVLTQ--DRQSKVLVASGAHLFIL--DNTACTPVTPPGLSPQASSILHMCVSFSYKYLALLTDSGHVWMGTSNLKEKLSEVETKIK-------TPPRQMAWCRRPKSQEPSAVVMWDGLLLVVGECKETIQYQLDDDSILVPELDGVRIISGTHHELLQEVPGACEEIFKIASMAPGALLLEAHKEYEKESQKADEYLREI-KEQSLLSEAVQQCVEAAGHEHEPETQKTLLRAASFGKCFLSNFPPEQFVSMCRDLRVLNAVRDYTIGIPLTHTQFKQMTVQVLIDRLVYRKLYPLAIEVCRYLKTPEYQGVSRVLKHWACFKVQQKEESDEVIAKAVSVKLADAAGISYSEIATKAYESGRTELAIKLLEFEPRSGEQVPLLLKMKKSPLALSKAIESGDTDLVYTVVMYLKNELNRGDFFMMLRNQPVALSLYRQFCKHQEQDTLKDLFNQDDDH------EELGNFYVKA------SYKEQRLEARIALLQSAVDEYYKAKNEFSAKSTEDEMRLLRFQR---KLEEEKGEPL-VGFSLHDTMTTLLSVGLHKHAEQLYKDFRVPDKRFWWLKLKALAEKEDWDELEKFAK--SKKSPIGYLPFVDVCIKHHNKYEARKYVSKVTPEQKVKAHLAVGDMEGAAEAAIERRNDTEISTVLS-----RCSSTTD 818          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. TrEMBL
Match: A0A2R8QEF2 (Vacuolar protein sorting-associated protein 16 homolog OS=Danio rerio OX=7955 GN=vps16 PE=1 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 2.506e-85
Identity = 232/857 (27.07%), Postives = 429/857 (50.06%), Query Frame = 2
Query:  107 MDVIVENWSLIGDNYYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVIS-----KAHSNQELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFI----LERDLSVVKSTCQFDFTINDGDNVQLEWA----GEDCLVFFHQDYLYLMDTEPQSTYSLYLED-PLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAG-KYIKRSDKESLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMY--------MENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSMKY*YRCSNVID 2608
            M  +  NW+ +G+ +Y K   Y MAW++  D  K+  FA   YGG IA++         +  +L ++S SG  ++   WK   V  L W+  + +  +Q+ G V +++L   + ++  MG+ V Q  V   + F S  GTG+ +LT        TN+   D  ++ +     + A   + W   T   D++   + A+   L  L  D          G    +S I  + +S + + +A++  +G +++    L+  LS V++  +           Q+ W      ++       D L L+  E + T    L+D  ++ PE+DGVR+I+ T HE +Q++P   E++++ +S +P  LL +A +  + +  +A  +L  I  ++  +  A+  C+ AA +  EP  QK++L A   G+ +  ++  E+   +   L +LN ++   + +P+T  Q +++ +  +I RL+ R  YP    +C  L+ P+  G++R+L+HWA  K  ++ + + +IA+ V  +L + A   +++IA +AYE  + ELA KL+E E R   QV +LLK+KK   ALS++I+SGD++L+  VV  L+  L   DF  M+   PVA ++Y         + L DL NQD D       E   N  +K       + + + ++A ++ + +  D Y KA N+F  +  +DE  +L+      K  E    P+ +   +HD ++ L     ++ AE + +  ++ D++F+WLKL + A+  +WDE +   +  ++K+P  Y    ++C  + N+    K + K+ PE++V+ ++ +  ++ A E A   +N+  I  V S     RCS+  D
Sbjct:    1 MAFVTANWNPLGEAFYRKIELYEMAWNL-KDGLKDCLFAAAPYGGPIALLKWHNRRSPSARPQLEIYSSSGLPLASFPWKSGVVKQLGWTVSDDLLCVQEDGTVLVYDLLGGFKRHFSMGNEVSQSQVLETKIFHSPYGTGVAILTGALRFTLATNI--DDIKLRRLPEVPGIQAAP-SCWAVLTQ--DRQSKVLVASGAHLFIL--DNTACTPVTPPGLSPQASSILHMCVSFSYKYLALLTDSGHVWMGTSNLKEKLSEVETKIK-------TPPRQMAWCRRPKSQEPSAVVMWDGLLLVVGECKETIQYQLDDDSILVPELDGVRIISGTHHELLQEVPGACEEIFKIASMAPGALLLEAHKEYEKESQKADEYLREI-KEQSLLSEAVQQCVEAAGHEHEPETQKTLLRAASFGKCFLSNFPPEQFVSMCRDLRVLNAVRDYTIGIPLTHTQFKQMTVQVLIDRLVYRKLYPLAIEVCRYLKTPEYQGVSRVLKHWACFKVQQKEESDEVIAKAVSVKLADAAGISYSEIATKAYESGRTELAIKLLEFEPRSGEQVPLLLKMKKSPLALSKAIESGDTDLVYTVVMYLKNELNRGDFFMMLRNQPVALSLYRQFCKHQEQDTLKDLFNQDDDH------EELGNFYVKA------SYKEQRLEARIALLQSAVDEYYKAKNEFSAKSTEDEMRLLRFQR---KLEEEKGEPL-VGFSLHDTMTTLLSVGLHKHAEQLYKDFRVPDKRFWWLKLKALAEKEDWDELEKFAK--SKKSPIGYLPFVDVCIKHHNKYEARKYVSKVTPEQKVKAHLAVGDMEGAAEAAIERRNDTEISTVLS-----RCSSTTD 818          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. TrEMBL
Match: A0A087TTA1 (Uncharacterized protein (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_12661 PE=4 SV=1)

HSP 1 Score: 295.434 bits (755), Expect = 2.262e-83
Identity = 235/850 (27.65%), Postives = 429/850 (50.47%), Query Frame = 2
Query:  107 MDVIVENWSLIGDN-YYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVISKAHSNQE--------LIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQG-TGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDS-SMIYKLSLSMTEQRIAVVMKNGKIFILERDLSV--VKSTCQFDFTINDGDNVQLEWAGEDCLVFFHQ----DYLYLMDTEPQSTYSLYLEDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSDKESLIAERVI-KRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMYMENLFDLSNQDTDRSKQSL-EESDEN-----LAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDE-KIM-LQSM-STTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSM 2575
            M +   +W+ +G N YY K   Y+M W +D  N   +  A   +GG IA+       Q+        + +FS SG+ +S I W   P++ + WS  E +  + + G V +++++        MG  VK   V   R F S +  TG+ VLT    +F   N+   D  I+ + +   + A   + W    +  D++   + A   +L  L  ++   +  Q    F++  + I ++++S   Q +A+   NG +++   +L V  +K  C+FD T +     QL W G   +V F Q    + + ++  E      ++     + PEIDGVR+I  T HE +QK+P  +  +++  S SP+ LL +A      +  +A  ++ +I  K  +++ A++ CL AA +  +P  QK +L A   G+++ PD   E    +   L +LN +++  + +P+T  QLE + L  ++ RL+ R +Y +   IC  L+IP   G +R+L+HWA   +KR++ +     R I ++L       +A+I+ +A +     LA KL++ E R   QV +L+KL++   A+ ++I+SGD++LI  V+  L+ +L   DF   I + PVA ++Y++       QD  + + S  +ESD N     L M++    K  LR+  +Q AL+S       YKKA N+F IQI +D+ K+M  QSM          D+S       +H  +  L   + ++ A++++++ K+ D++++WL++   A   +W E +   +  ++K+P  Y    ++C  +DN     K + K++ E +V  YVK   L++A ++A   K+   ++++ S+
Sbjct:    1 MALYTADWTPLGKNVYYRKTELYSMQW-VDQVNLSEFIVAAAPFGGPIALTQDRKKLQKVQFANKSNIYIFSASGQPLSTIKWNSGPLVHMGWSSSEDLICVLEDGNVLLYDIYGNLQMTTSMGQDVKDTGVLECRIFNSPKFYTGVAVLTGAFNIFLVNNI--KDPRIRKLPSVPGLDAPP-SSWAVVAE--DRQTKVLVAKDATLYALLQNEGKCV--QVFPKFNNPINAITEIAVSFNNQHVALFCDNGALWMGAANLEVCYLKKYCEFD-TQSKVRPQQLVWCGNGAVVAFWQIEIENIMIVIGPEKDFINEIFYTPIHLVPEIDGVRIIGNTTHELLQKVPDAVADVFRIGSLSPSALLLEASNEFRRRSHKADEYIRMIREK-NELEEAVECCLKAAGHEFQPSTQKMLLRAAAFGKNFVPDMDPEPFVKMCQTLRVLNAVRVNVIGLPITYTQLEFLTLPVLLDRLVLRRHYAYAICICQYLKIPDTEGASRILDHWACYKVKRTNLDPEQTARAIAEKLGCTPGISYAEISNKAMDYGHPSLAVKLLDYETRASEQVPLLIKLRQETQAMVKAIESGDTDLIYSVIRYLKTTLSKGDFHMKIRQFPVAHSLYLKL---CKEQDLQQLRMSYSQESDFNSEGDCLVMESYQTKKIELRSSLLQEALNS-------YKKAKNEFAIQITEDQLKLMKYQSMFEEKFPQNFCDLS-------LHQTMKQLLTQREFKLADDLRKEFKVPDKRYWWLQITVLADGGDWLELEKFSR--SKKSPIGYEPFVDVCVKHDNIYEAKKYLPKVKEENKVTYYVKARLLEDAAKIAFEKKDIAALNHIQSL 821          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Cavefish
Match: vps16 (vacuolar protein sorting 16 homolog [Source:ZFIN;Acc:ZDB-GENE-050809-9])

HSP 1 Score: 242.662 bits (618), Expect = 4.385e-68
Identity = 197/725 (27.17%), Postives = 357/725 (49.24%), Query Frame = 2
Query:  107 MDVIVENWSLIGDNYYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVISKAH-----SNQELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFI----LERDLSVVKSTCQFDFTINDGDNVQLEWA----GEDCLVFFHQDYLYLMDTEPQSTYSLYLED-PLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWA-GKYIKRSDKESLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMY--------MENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIH 2212
            M  +  NW+ +G+ +Y K   Y M W++  D  ++   A   YGG IA++ +       S  +L ++S SG  ++  +WK   V  L W+  + +  +Q+ G V I++L   + ++  MG+ V Q  V   + F S  GTG+ ++T  +     TN+   D  ++ +      +    T W   T   D++   + AN   L  L Y     +     G    +S I  + +S + + +A+   +G +++    L+  LS V++  +           Q+ W          V    D   L+  E + T S +LED  ++ PE+DGVR+I  T HE +Q++P+  E++++ +S +P  LL +A +  + +  +A  +L  I  ++G +  A+  C+ AA +  E   QK++L A   G+ +  ++  E    +   L +LN ++   V +P+T  Q +++ +  +I RL+ R  YP    IC  L+ P+  G++R+L+HWA  K  ++ + + +IA  +  +L   A   +++IA +AYE  + ELA KL+E E R   QV +LLK+K+   ALS++I+SGD++L+  VV+ L+  +   DF   +   PVA ++Y         + L DL NQD D  +        N  +K   + K+      ++A ++ + +  D Y KA N+F  +  ++E  +L+         E  I P+ IA+ +H
Sbjct:    1 MAFVTANWNPLGEAFYRKTELYEMGWNL-KDGLRDCLLAAAPYGGPIALLKEPQRRSPSSRPQLEIYSASGVTMASFLWKSGVVRQLGWTVCDDLLCIQEDGTVLIYDLFGSFKRHFSMGNEVGQSQVVEAKVFHSPYGTGVAIVTGASRFTLATNI--DDLKLRRLPEVPG-LQGAPTCWAVLTQ--DRQSKVLVANGGDLFILDYTACTAV--NPPGLSPQASSIVHMCVSFSYKYLALFTDSGHVWMGSANLKEKLSEVETKVR-------NPPKQMAWCRRPKSRQPSVVIMWDRHLLVVGEGKDTISYHLEDDSILVPEMDGVRIINGTNHELLQEVPASCEEIFKIASMAPGALLLEAHKEYEKESQKADEYLREI-KEQGLLAEAVRQCVEAAGHEQEAETQKTLLRAASFGKCFLSNFPPELFVIMCRDLRVLNAVRDYTVGIPLTHTQFKQMTVQVLIDRLVYRKLYPLAIEICRYLKTPEYQGVSRVLKHWACCKVQQKEESDEVIARTISLKLGEAAGISYSEIATKAYECGRTELAIKLLEFEPRSGEQVPLLLKMKRSQLALSKAIESGDTDLVYTVVTYLKNEMNRGDFFMTLRNQPVALSLYRQFCKHQEQDTLKDLFNQDDDHQELG------NFYVKASYKEKR------LEARVAHLQSAVDEYNKAKNEFAAKATEEEMRLLRFQKKL--EEEKAIEPLAIAVRMH 695          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Yeast
Match: VPS16 (Subunit of the HOPS and the CORVET complexes; part of the Class C Vps complex essential for membrane docking and fusion at Golgi-to-endosome and endosome-to-vacuole protein transport stages [Source:SGD;Acc:S000005966])

HSP 1 Score: 57.3806 bits (137), Expect = 8.503e-9
Identity = 44/174 (25.29%), Postives = 83/174 (47.70%), Query Frame = 2
Query:  818 MKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAGEDCLVFFHQDYLYLMDTEPQSTYSLYLEDPL----MFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRS 1327
            MK+ K+ I  RD + +      D T +D     + W G D +    +D + L    P   Y  +   P     +  E+DG+++IT  K  F+ ++  Q   +++  S  P  +L D+   L++   +A+  L+  + ++G +      C++AA +  EP+ QK +LNA   G++
Sbjct:  208 MKDNKLQIF-RDPARILMEHNLDSTPDD-----ICWCGNDTVACSFEDEIKLYG--PDGLYVTFWY-PFTVTNLRAEVDGLKVITTEKIYFLSRVQPQTSNIFRIGSTEPGAMLVDSFSLLEDHAPKAIEILKNFVLEKGVLD-----CIAAAIDEFEPKLQKMLLNAASYGKA 367          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Nematostella
Match: EDO49038 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHU4])

HSP 1 Score: 271.937 bits (694), Expect = 3.815e-79
Identity = 216/807 (26.77%), Postives = 393/807 (48.70%), Query Frame = 2
Query:  107 MDVIVENWSLIGDNYYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVISKAHSNQE---LIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSL-TKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAGEDCLVFFHQDYLYLMDTEPQSTYSLYL-EDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPY-VAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSDKESLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMYMENLFDLSNQDTDRSKQSLEESD-ENLA-MKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMN 2503
            M  +  +W+ +GD +Y K   Y+M W++++ +   +  A   +GG IA++ +    Q    + +FS +G+ +S+I +    +I + W+  E +  +   G V+++++H  + +   MG   +   V   R F S  GTGL +LT        TN+   D   K   +   + A   + WL        +++    N+  L  KL   +  V FS+        + I +++LS     +A+   +G ++I   DL   K  C+F+         QL W G   +V +  DYL ++      T  +YL E+P      DGVR+I    HEF+QK+P  +E +++  S  P  +LFDA +  + K + A  ++ +I   + ++  A++ C+ AAA   EP  Q+++L A  LG S+  D++  +V     + L + N    + V +P+T  QLE + L  +I RL+ R +Y     IC  L+IPK  G +R+L HWA   +++ D +  IA  +  +L N     + +IA +A E  K ELA KL++ E +   QV +L+K+ K   AL +++ SGD++L+  V+ +L+K L   +F+  + + PVA  +YM+  F   N   D     L +S   +LA M     + K L   ++++ +  ++  +  Y KA N    +I +++  +L   S   K    +     ++    D +    +    + AE +++  K+ D  ++W+K+ + A   NW E +   +  +RK+P  Y    + C   ++     K I K++PE + + Y+K+ 
Sbjct:    1 MAHVTADWTPLGDVFYRKQELYSMTWNLNDVDLSKFGKAASPFGGPIALVRETTQIQVKPLIYIFSSAGKELSKISFDGGRLIHIAWTASEELMCIAVDGSVSLYDIHGTFFRTFTMGHEAQMSQVIECRVFRSSAGTGLAILTGSYHFIVTTNI--DDVRCKQFADPPGLNAPP-SSWLVLPQDRRADLLVAIDNQLFLINKLDVQQMSVTFSE------PVNSITEMALSFNGAYLALFTDSGLLWIGSADLQ--KVYCEFNAQCTSRPK-QLSWCGTGAVVCYWSDYLDVIG----PTKDVYLVEEP------DGVRIIGGDNHEFLQKVPVAVENVFKIGSMEPGAMLFDAAKEFERKSARADEYVRMI---KDRLPDAVEQCIQAAAAEYEPAIQRNLLRAASLGNSFL-DHKQPRVFVQTCQTLRVLNAVRDFNVGIPLTYAQLELLTLRVLIDRLVLRRHYCLAIRICDYLKIPKAEGTSRILGHWACFKVQQQDSDEEIAHAINAKLCNSTGISYTEIASKALEKGKPELATKLLDYEPKAADQVPLLMKMNKDKVALEKAVQSGDTDLVYMVIMKLKKDLKLGEFLLELSKCPVALNLYMK--FCKENNPNDLESIYLMQSQFMDLANMSVRKSINKEL---DVESKMDCLSDAKMNYTKAGNVIYTKITEEQMKLLDDQSRLEKEQHQEFKNTSLS----DTIEKCIELGHLKDAEKLRKDFKVPDVHYHWIKVKALAGSRNWTELEKFSK--SRKSPIGYEPFVDFCLQQNHRIEAEKYIAKVQPENKAKYYLKIG 770          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Medaka
Match: vps16 (VPS16 core subunit of CORVET and HOPS complexes [Source:NCBI gene;Acc:101160619])

HSP 1 Score: 281.567 bits (719), Expect = 7.893e-82
Identity = 227/841 (26.99%), Postives = 415/841 (49.35%), Query Frame = 2
Query:  107 MDVIVENWSLIGDNYYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVISKA-----HSNQELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWA----GEDCLVFFHQDYLYLMDTEPQSTYSLYLEDP-LMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSD-KESLIAERVIKRLENHADFDFAKIXXXXXXXXXXXXXXXXXXXXGRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMYMENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALSSINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSMKY*YRCS 2596
            M  +  +W+ +G+ +Y K   Y M WSI  D  ++   A   YGG IA++ +       S  +L ++S SG  I+   WK  PV+ L WS  + +  +Q+ G V I++L   + ++  MG  V Q  V   + F S  GTG+ ++T  +     TN+   D  ++ +      +      W+  T   D++   + +    L  L  D          G    +  I  +S+S + + +++   +G ++    +L       +FD    +    Q+ W      +   V    D L L+  E   T    +EDP ++  E+DGVR+I +T  E +Q++P   + +++ +S +P  LL +A +  +    +A  +L  I  ++  ++ A+  C+ AAA+  +P  QKS++ A   G+ +  D+ S+       +L +LN ++   V MP+T  Q +++ L  +I RL+ R +YP    IC  L+IP   G++R+L+HWA   +++ D  +  IA  V  ++       ++ IA +AYE  + ELA KL++ E R   QV +LLK+K+   ALS++++SGD++L+  VV+ L+  +   DF   +   PVA ++Y +    L  Q+T +    L   D+N        +  + R + ++++LS +    D Y KA NDF  +  ++E  +L+       + E     +G+++ +   +  L     +++AE + +  K+ D++++WLKL S A+   W+E +   +  ++K+P  Y    E+C  Y+N N   K I K+ PE++V+ ++ +  L+ A + A   K+E  I  V S     RCS
Sbjct:    1 MAFVTASWNPLGEAFYRKVELYEMCWSI-RDGLRDSLVAAAPYGGPIALLREPLRRSPSSRPQLEIYSASGAAIASFPWKSGPVVQLGWSISDELLCVQEDGSVLIYDLFGSFKRHFSMGQEVVQSQVLEAKVFHSPYGTGIAIVTGSSRFTLATNI--EDLKLRRLPEVPG-LQGRPASWVVLTQ--DRQTKVLLSIGPELYIL--DNTSCTAVCPPGLSPHAGSIVHMSVSFSYKYLSLFTDSGHLWAGLSNLQ--DKLLEFDTKTTERPK-QMLWCRRPKSQQPSVVLMWDRLLLVVGECNDTIQFPVEDPSVLVGEMDGVRIINSTNQELLQEVPLVCQDIFKIASMAPGALLLEAHREYEKSSQKADEYLREI-KEQNVLEEAVRQCVEAAAHEYDPATQKSLMRAASFGKCFLTDFCSDPFVSTCRELRVLNAVRESGVGMPLTHTQFKQMTLQVLIDRLLFRQFYPLAIEICRYLKIPDYQGVSRVLKHWASCKVQQKDLSDEAIARAVCVKVGESPGVSYSHIAAKAYECGRTELAIKLLDFEPRSGEQVPLLLKMKRSHLALSKAVESGDTDLVYMVVTHLKNEMNRGDFFMTLRNQPVALSLYRQ-FCKLQEQETLK---DLYNQDDNHQELANYYVTASYREKKLESSLSLLQNAVDEYNKAKNDFAAKATEEEMRLLRFQRKL--DDEKGAGLLGLSLQV--TMETLLSLGLHKQAEQLYRDFKVPDKRYWWLKLKSLAEKEEWEELEKFSK--SKKSPIGYLAFVEVCMKYNNRNEAKKYICKVTPEQKVKAHLAVGDLESAADAAIEHKSESEIAAVLS-----RCS 814          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Planmine SMEST
Match: SMESG000016337.1 (SMESG000016337.1)

HSP 1 Score: 1073.15 bits (2774), Expect = 0.000e+0
Identity = 519/520 (99.81%), Postives = 520/520 (100.00%), Query Frame = 2
Query:  107 MDVIVENWSLIGDNYYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVISKAHSNQELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAGEDCLVFFHQDYLYLMDTEPQSTYSLYLEDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSDKESLIAERVIKRLENHADFDFAKI 1666
            MDVIVENWSLIGDNYYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVISKAHSNQELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAGEDCLVFFHQDYLYLMDTEPQSTYSLYLEDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVED+HGKLLLLNNLKLPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSDKESLIAERVIKRLENHADFDFAKI
Sbjct:    1 MDVIVENWSLIGDNYYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVISKAHSNQELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAGEDCLVFFHQDYLYLMDTEPQSTYSLYLEDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDIHGKLLLLNNLKLPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSDKESLIAERVIKRLENHADFDFAKI 520          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Planmine SMEST
Match: SMESG000016346.1 (SMESG000016346.1)

HSP 1 Score: 1023.08 bits (2644), Expect = 0.000e+0
Identity = 496/497 (99.80%), Postives = 497/497 (100.00%), Query Frame = 2
Query:  176 MAWSIDNDNFKNYYFAHEIYGGSIAVISKAHSNQELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAGEDCLVFFHQDYLYLMDTEPQSTYSLYLEDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDVHGXXXXXXXXXXPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSDKESLIAERVIKRLENHADFDFAKI 1666
            MAWSIDNDNFKNYYFAHEIYGGSIAVISKAHSNQELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAGEDCLVFFHQDYLYLMDTEPQSTYSLYLEDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVED+HGKLLLLNNLKLPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSDKESLIAERVIKRLENHADFDFAKI
Sbjct:    1 MAWSIDNDNFKNYYFAHEIYGGSIAVISKAHSNQELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVAIHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKTNLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKLKYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDLSVVKSTCQFDFTINDGDNVQLEWAGEDCLVFFHQDYLYLMDTEPQSTYSLYLEDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDAQQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILNAVRLGRSYFPDYRSEKVEDIHGKLLLLNNLKLPYVAMPVTMCQLERIGLTNIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSDKESLIAERVIKRLENHADFDFAKI 497          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Planmine SMEST
Match: SMESG000016488.1 (SMESG000016488.1)

HSP 1 Score: 325.479 bits (833), Expect = 1.115e-106
Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 2
Query: 2117 MDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSMKY 2581
            MDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSMKY
Sbjct:    1 MDDEKIMLQSMSTTIKNGESDISPVGIAMPIHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQATVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNKLQEAEELARMIKNEYLIHYVSSMKY 155          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Planmine SMEST
Match: SMESG000016345.1 (SMESG000016345.1)

HSP 1 Score: 207.994 bits (528), Expect = 1.083e-62
Identity = 104/105 (99.05%), Postives = 104/105 (99.05%), Query Frame = 2
Query: 1727 GRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMYMENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENI 2041
            GRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMYMENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAE I
Sbjct:    5 GRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMYMENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAEVI 109          
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Planmine SMEST
Match: SMESG000016489.1 (SMESG000016489.1)

HSP 1 Score: 207.994 bits (528), Expect = 1.083e-62
Identity = 104/105 (99.05%), Postives = 104/105 (99.05%), Query Frame = 2
Query: 1727 GRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMYMENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENI 2041
            GRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMYMENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAE I
Sbjct:    5 GRIFYQVQMLLKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKAMYMENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAEVI 109          
The following BLAST results are available for this feature:
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
VPS163.650e-8125.41VPS16 core subunit of CORVET and HOPS complexes [S... [more]
VPS161.187e-2926.44VPS16 core subunit of CORVET and HOPS complexes [S... [more]
VPS161.136e-624.24VPS16 core subunit of CORVET and HOPS complexes [S... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vps-168.328e-2322.60Vacuolar protein sorting-associated protein 16 hom... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Vps16A1.048e-6524.42gene:FBgn0285911 transcript:FBtr0081979[more]
back to top
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vps161.075e-8827.07vacuolar protein sorting 16 homolog [Source:ZFIN;A... [more]
vps161.120e-8827.07vacuolar protein sorting 16 homolog [Source:ZFIN;A... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vps162.070e-6924.91VPS16, CORVET/HOPS core subunit [Source:NCBI gene;... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Vps169.638e-8225.70VSP16 CORVET/HOPS core subunit [Source:MGI Symbol;... [more]
Vps169.815e-3325.14VSP16 CORVET/HOPS core subunit [Source:MGI Symbol;... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H269|VPS16_HUMAN1.753e-8025.41Vacuolar protein sorting-associated protein 16 hom... [more]
sp|Q920Q4|VPS16_MOUSE2.898e-8025.70Vacuolar protein sorting-associated protein 16 hom... [more]
sp|Q5E9L7|VPS16_BOVIN3.427e-7925.35Vacuolar protein sorting-associated protein 16 hom... [more]
sp|Q55C58|VPS16_DICDI6.653e-5924.85Vacuolar protein sorting-associated protein 16 hom... [more]
sp|Q9UT38|VPS16_SCHPO8.977e-5524.97Probable vacuolar protein sorting-associated prote... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5A9NVZ84.800e-8827.38Vacuolar protein sorting-associated protein 16 hom... [more]
A0A1S3I6Y61.121e-8726.75Vacuolar protein sorting-associated protein 16 hom... [more]
A5D6T02.406e-8527.07Vacuolar protein sorting-associated protein 16 hom... [more]
A0A2R8QEF22.506e-8527.07Vacuolar protein sorting-associated protein 16 hom... [more]
A0A087TTA12.262e-8327.65Uncharacterized protein (Fragment) OS=Stegodyphus ... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vps164.385e-6827.17vacuolar protein sorting 16 homolog [Source:ZFIN;A... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
VPS168.503e-925.29Subunit of the HOPS and the CORVET complexes; part... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO490383.815e-7926.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vps167.893e-8226.99VPS16 core subunit of CORVET and HOPS complexes [S... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 16 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016337.10.000e+099.81SMESG000016337.1[more]
SMESG000016346.10.000e+099.80SMESG000016346.1[more]
SMESG000016488.11.115e-106100.00SMESG000016488.1[more]
SMESG000016345.11.083e-6299.05SMESG000016345.1[more]
SMESG000016489.11.083e-6299.05SMESG000016489.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016921 ID=SMED30016921|Name=Vacuolar protein sorting-associated protein 16 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=2613bp
TATGTTTTTCAAATTTAACTTTTTATAATTTTATAAAATTTTTTATATTA
AAGATCCATTTCCATTAAATCTTTTGTAAAATAATAATATTATCATCATT
TTCATAATGGATGTAATAGTAGAAAATTGGTCACTCATTGGGGATAATTA
TTACATTAAATATCATTTTTATAACATGGCTTGGAGTATTGACAACGATA
ATTTTAAAAATTATTACTTTGCTCATGAAATTTACGGCGGATCCATCGCC
GTTATTTCAAAAGCCCATTCAAATCAAGAATTAATAGTATTTTCACCGTC
GGGGCGTTTTATTTCAAGAATTATGTGGAAAGATGCTCCAGTGATTGGCT
TAAATTGGAGTGAAGATGAGCACATATTTTTGCTGCAAAAATCTGGCAGA
GTGGCTATTCATAATCTTCATTGCGAGTACATTAAATACGTTCAAATGGG
CGATACTGTCAAACAGCACAATGTGAAATCTTTCCGATTTTTTACATCGC
TACAAGGAACCGGTTTGATGGTTCTCACAGAATGCAATGAATTGTTTTTC
AAAACCAACCTAATGAACACAGATTCCGTGATTAAAACTATCAAAAATTC
CAAGCAGGTAATTGCCGACAATTTCACCGATTGGCTGGCCTTCACTGACC
TCACTGATAAAGAAGTTGTTGCTGTATTTGCTAATAGAAATTCCCTCACG
AAATTAAAATACGACAAAGAGCCCGTAATATTTAGCCAAGGTTCCGGCTG
GTTTAGTGACAGTTCAATGATCTATAAGCTATCGCTGTCAATGACTGAAC
AACGAATAGCTGTCGTTATGAAAAATGGAAAAATATTCATTTTAGAAAGA
GATCTTTCAGTCGTAAAATCAACTTGCCAATTCGATTTCACAATCAATGA
CGGTGACAATGTCCAGTTGGAATGGGCTGGGGAAGACTGTTTGGTGTTCT
TCCATCAGGATTATCTCTATCTGATGGATACAGAGCCGCAGTCGACTTAC
AGTCTTTACTTAGAAGATCCATTGATGTTTCCAGAGATCGACGGTGTCCG
ACTGATAACAGCAACGAAGCATGAATTTATCCAAAAGATCCCCAGCCAGC
TTGAGCAATTATATCAGTTTTCATCCGAGTCACCGGCTATGCTGTTATTT
GATGCCCAACAGCATTTGGATAATAAAATGTCTGAAGCTGTCAACTTTCT
GGAATTGATACTTTCCAAGGAGGGACAAATGCAAGTCGCTATTGACACTT
GCTTGTCAGCGGCAGCAAATTGCTTAGAGCCGAGATGGCAGAAAAGTATT
CTTAACGCGGTTCGTCTAGGAAGAAGTTATTTTCCTGATTATAGATCAGA
AAAAGTTGAAGATGTTCATGGAAAACTTTTGTTACTGAACAATTTGAAAT
TGCCCTACGTAGCGATGCCAGTAACAATGTGTCAGTTGGAAAGAATAGGA
TTGACAAATATTATTTTTCGGCTTATAAATAGGAATTACTATCCGTTTGT
TGAACTGATCTGCACACAGCTGCGAATTCCAAAAGATACAGGAATTAATC
GAATGCTTGAACATTGGGCTGGGAAATACATTAAACGATCCGACAAAGAA
AGTTTAATTGCAGAAAGAGTTATTAAACGGCTAGAAAATCACGCTGATTT
CGATTTTGCCAAAATTGCTCTTCAGGCTTATGAGCTCAAGAAATTGGAAT
TGGCAGAAAAATTGATGGAACGTGAAGGGAGAATTTTCTATCAAGTTCAA
ATGTTGCTAAAACTCAAAAAGCACATTTCTGCACTGTCGCGGTCGATTGA
TTCCGGTGATAGTAACCTAATTTCTTATGTCGTGTCGGAATTACAGAAAT
CGCTATTGTTCGAAGACTTTATAACGATGATTCATAGAAACCCGGTTGCT
AAAGCAATGTACATGGAGAATTTGTTTGATCTCTCCAATCAAGATACAGA
CAGATCTAAGCAATCCCTTGAGGAGTCTGATGAAAATCTAGCAATGAAAA
CTGAAAATCAATTGAAAAAGGCTTTGAGAGCAGAAAATATTCAAGCAGCG
CTCTCGTCGATAAATGCTGTCCAAGATCTCTATAAGAAAGCAAATAATGA
TTTTATGATACAAATTATGGACGATGAGAAGATCATGCTACAAAGCATGT
CAACGACTATAAAAAACGGAGAATCGGATATTTCCCCAGTGGGAATTGCA
ATGCCAATCCATGATTATTTATCGTATTTATTTCAAAATAAATTCTATGA
GAAAGCCGAAAATATTAAACAGAAATTAAAAATGTCTGACAGGCAATTTT
ATTGGCTCAAACTGAACAGTTGTGCAAAAATCAATAATTGGGACGAATTC
CAGGCAACAGTGCAGAAATGGAATCGTAAAACCCCCGACAATTATTATGA
TATAGGAGAGATCTGTGCTGATTATGACAATGAAAATGTTTTGTCAAAAA
TAATCGATAAAATTGAACCTGAGAAGCGGGTCCGTTTATATGTCAAAATG
AACAAATTGCAGGAGGCCGAGGAATTGGCTAGAATGATCAAGAATGAATA
TCTTATTCATTATGTCTCGTCCATGAAATATTGATATCGATGTTCCAATG
TGATTGATTTTTT
back to top

protein sequence of SMED30016921-orf-1

>SMED30016921-orf-1 ID=SMED30016921-orf-1|Name=SMED30016921-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=826bp
MDVIVENWSLIGDNYYIKYHFYNMAWSIDNDNFKNYYFAHEIYGGSIAVI
SKAHSNQELIVFSPSGRFISRIMWKDAPVIGLNWSEDEHIFLLQKSGRVA
IHNLHCEYIKYVQMGDTVKQHNVKSFRFFTSLQGTGLMVLTECNELFFKT
NLMNTDSVIKTIKNSKQVIADNFTDWLAFTDLTDKEVVAVFANRNSLTKL
KYDKEPVIFSQGSGWFSDSSMIYKLSLSMTEQRIAVVMKNGKIFILERDL
SVVKSTCQFDFTINDGDNVQLEWAGEDCLVFFHQDYLYLMDTEPQSTYSL
YLEDPLMFPEIDGVRLITATKHEFIQKIPSQLEQLYQFSSESPAMLLFDA
QQHLDNKMSEAVNFLELILSKEGQMQVAIDTCLSAAANCLEPRWQKSILN
AVRLGRSYFPDYRSEKVEDVHGKLLLLNNLKLPYVAMPVTMCQLERIGLT
NIIFRLINRNYYPFVELICTQLRIPKDTGINRMLEHWAGKYIKRSDKESL
IAERVIKRLENHADFDFAKIALQAYELKKLELAEKLMEREGRIFYQVQML
LKLKKHISALSRSIDSGDSNLISYVVSELQKSLLFEDFITMIHRNPVAKA
MYMENLFDLSNQDTDRSKQSLEESDENLAMKTENQLKKALRAENIQAALS
SINAVQDLYKKANNDFMIQIMDDEKIMLQSMSTTIKNGESDISPVGIAMP
IHDYLSYLFQNKFYEKAENIKQKLKMSDRQFYWLKLNSCAKINNWDEFQA
TVQKWNRKTPDNYYDIGEICADYDNENVLSKIIDKIEPEKRVRLYVKMNK
LQEAEELARMIKNEYLIHYVSSMKY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0033263CORVET complex
GO:0005737cytoplasm
GO:0005764lysosome
GO:0005765lysosomal membrane
GO:0005768endosome
GO:0005769early endosome
GO:0005770late endosome
GO:0005776autophagosome
GO:0016020membrane
GO:0030136clathrin-coated vesicle
GO:0030424axon
GO:0030897HOPS complex
GO:0031410cytoplasmic vesicle
GO:0031902late endosome membrane
GO:0043025neuronal cell body
GO:0055037recycling endosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR038132Vps16_C_sf
IPR016534VPS16
IPR006926Vps16_N
IPR006925Vps16_C
IPR025750Requiem/DPF_N_dom
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0007033vacuole organization
GO:0006810transport
GO:0006914autophagy
GO:0008333endosome to lysosome transport
GO:0015031protein transport
GO:0032889regulation of vacuole fusion, non-autophagic
GO:0035542regulation of SNARE complex assembly
GO:0097352autophagosome maturation
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0005515protein binding
GO:0051015actin filament binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016534Vacuolar protein sorting-associated protein 16PIRSFPIRSF007949Vps16coord: 4..824
e-value: 1.8E-129
score: 431.0
IPR016534Vacuolar protein sorting-associated protein 16PANTHERPTHR12811VACUOLAR PROTEIN SORTING VPS16coord: 3..819
IPR038132Vps16, C-terminal domain superfamilyGENE3DG3DSA:1.10.150.780coord: 531..799
e-value: 1.2E-37
score: 131.8
IPR006925Vps16, C-terminalPFAMPF04840Vps16_Ccoord: 517..815
e-value: 2.4E-33
score: 115.6
IPR006926Vps16, N-terminalPFAMPF04841Vps16_Ncoord: 6..412
e-value: 5.1E-65
score: 219.8
NoneNo IPR availableSUPERFAMILYSSF69322Tricorn protease domain 2coord: 26..291