Tctex1 domain containing 1

Overview
NameTctex1 domain containing 1
Smed IDSMED30016917
Length (bp)693
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tctex1 domain containing 1 (SMED30016917) t-SNE clustered cells

Violin plots show distribution of expression levels for Tctex1 domain containing 1 (SMED30016917) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tctex1 domain containing 1 (SMED30016917) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tctex1 domain containing 1 (SMED30016917) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016917

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30016917h1SMcG0010792 SmedASXL_011762SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30016917h1SMcG0010792 dd_Smed_v4_9321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016917h1SMcG0010792 dd_Smed_v4_9321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016917h1SMcG0010792 dd_Smed_v4_9321_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30016917h1SMcG0010792 dd_Smed_v6_9321_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30016917h1SMcG0010792 dd_Smed_v4_9321_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tctex1 domain containing 1 vs. Ensembl Human
Match: TCTEX1D1 (Tctex1 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26882])

HSP 1 Score: 153.68 bits (387), Expect = 1.640e-46
Identity = 77/190 (40.53%), Postives = 118/190 (62.11%), Query Frame = 1
Query:   97 MANTEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDIVALANRKQSISSVCHIDQP---NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            M  ++ AK RA+   KK+G+   +   +  +   K++ G          K S+S+V ++++P   +  SR TV++ENTYQLGP + FPV  +  I KDV+ SYL  E YEP+ C+ M+KTISEV++ ++K+L I RYK++ I+ +G+         SRCLWDP  D+F+ Y F+N SLFA+A ++ VY E
Sbjct:    1 MMMSDNAKGRAAHSWKKRGSISSLSNHEFWR---KEIHG--------RIKDSMSTVSYMEEPSQRDDISRLTVQMENTYQLGPPKHFPVVTVNHILKDVVTSYLQVEEYEPELCRQMTKTISEVIKAQVKDLMIPRYKLIVIVHIGQLNRQSILIGSRCLWDPKSDTFSSYVFRNSSLFALANVYAVYLE 179          
BLAST of Tctex1 domain containing 1 vs. Ensembl Human
Match: TCTEX1D2 (Tctex1 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28482])

HSP 1 Score: 77.7962 bits (190), Expect = 1.533e-17
Identity = 40/115 (34.78%), Postives = 62/115 (53.91%), Query Frame = 1
Query:  313 ENTYQLGP--EQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVY 651
            ENTY L P  +Q+F    ++     V++  LA   Y P+    ++K +SE +++++KE+   RYK+V  + +GEQ   G    SRC WD   D++    F N SLF V   FG +
Sbjct:   26 ENTYILRPVFQQRFRPSVVKDCIHAVLKEELANAEYSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDADTDNYTHDVFMNDSLFCVVAAFGCF 140          
BLAST of Tctex1 domain containing 1 vs. Ensembl Human
Match: TCTEX1D4 (Tctex1 domain containing 4 [Source:HGNC Symbol;Acc:HGNC:32315])

HSP 1 Score: 62.003 bits (149), Expect = 4.932e-11
Identity = 29/74 (39.19%), Postives = 42/74 (56.76%), Query Frame = 1
Query:  436 MSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            + + + E V  R++EL   RYK+V  + +G +   G    SR LWD + D  A   + N SLFAVAT+ G+Y E
Sbjct:  148 LVRELCEQVHVRLRELSPPRYKLVCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYCE 221          
BLAST of Tctex1 domain containing 1 vs. Ensembl Human
Match: TCTE3 (t-complex-associated-testis-expressed 3 [Source:HGNC Symbol;Acc:HGNC:11695])

HSP 1 Score: 55.8398 bits (133), Expect = 5.318e-9
Identity = 28/133 (21.05%), Postives = 64/133 (48.12%), Query Frame = 1
Query:  259 SVCHIDQPNPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            S+  I +   ++   ++  N+Y++ P +KF    +ET  + ++   L + +Y+ +    +S  +++ +   +KE    RYK +  +   ++        SR +WD + DS+   + +  S  A+  +F +Y E
Sbjct:   66 SIADIGKEWKSALAKLKFANSYRMEPLKKFQAHSVETKVQQILTESLKDVKYDDKVFSHLSLELADRILLAVKEFGYHRYKFIIKVLFIQKTGQAINIASRWIWDIAWDSWVAAKHEAESYVALVLVFALYYE 198          
BLAST of Tctex1 domain containing 1 vs. Ensembl Human
Match: TCTE3 (t-complex-associated-testis-expressed 3 [Source:HGNC Symbol;Acc:HGNC:11695])

HSP 1 Score: 55.8398 bits (133), Expect = 5.318e-9
Identity = 28/133 (21.05%), Postives = 64/133 (48.12%), Query Frame = 1
Query:  259 SVCHIDQPNPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            S+  I +   ++   ++  N+Y++ P +KF    +ET  + ++   L + +Y+ +    +S  +++ +   +KE    RYK +  +   ++        SR +WD + DS+   + +  S  A+  +F +Y E
Sbjct:   66 SIADIGKEWKSALAKLKFANSYRMEPLKKFQAHSVETKVQQILTESLKDVKYDDKVFSHLSLELADRILLAVKEFGYHRYKFIIKVLFIQKTGQAINIASRWIWDIAWDSWVAAKHEAESYVALVLVFALYYE 198          
BLAST of Tctex1 domain containing 1 vs. Ensembl Celegans
Match: dylt-2 (DYnein Light chain (Tctex type) [Source:UniProtKB/TrEMBL;Acc:Q18917])

HSP 1 Score: 59.3066 bits (142), Expect = 3.036e-11
Identity = 31/108 (28.70%), Postives = 55/108 (50.93%), Query Frame = 1
Query:  334 PEQKFPVRKIETIAKDVI-ESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQ 654
            P QKF  + +  + ++++ E   A   Y     + +SK IS  +R R+K L++ RYK V    + EQ  +G TT  +C+WD   D +    +  GS++    +F ++ 
Sbjct:   15 PGQKFRPKAVAGMIQEILGEKLGALTIYNVDEAELVSKDISASIRERLKGLQLPRYKYVIQTMIAEQCGNGATTAVQCVWDEDCDGYLTQRYVTGSIWCEVLVFAIFH 122          
BLAST of Tctex1 domain containing 1 vs. Ensembl Fly
Match: CG14763 (gene:FBgn0033243 transcript:FBtr0088875)

HSP 1 Score: 75.485 bits (184), Expect = 1.439e-16
Identity = 44/127 (34.65%), Postives = 67/127 (52.76%), Query Frame = 1
Query:  286 PASRPTVRVENTYQLGPEQKFPVRK--IETIAKDVIESYLAEE-RYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            PA++PT+R   TY+L  E K P+ K  +E I K V+  +  +E  + P+    M+  +SE ++NRIK     RY+ + ++ VGE    G  +    LWD   D F  Y  +  S FAV T F +Y +
Sbjct:   65 PAAKPTMRFMPTYRL--ESKNPLNKERVENIIKAVMNRHYNDEYMFHPKHSLHMAAQVSEEIKNRIKLDNYDRYRYIVLVTVGEFLMQGLYSMVNFLWDAEKDGFVTYSVERPSYFAVCTTFYLYYD 189          
BLAST of Tctex1 domain containing 1 vs. Ensembl Fly
Match: CG14763 (gene:FBgn0033243 transcript:FBtr0339127)

HSP 1 Score: 75.485 bits (184), Expect = 1.439e-16
Identity = 44/127 (34.65%), Postives = 67/127 (52.76%), Query Frame = 1
Query:  286 PASRPTVRVENTYQLGPEQKFPVRK--IETIAKDVIESYLAEE-RYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            PA++PT+R   TY+L  E K P+ K  +E I K V+  +  +E  + P+    M+  +SE ++NRIK     RY+ + ++ VGE    G  +    LWD   D F  Y  +  S FAV T F +Y +
Sbjct:   65 PAAKPTMRFMPTYRL--ESKNPLNKERVENIIKAVMNRHYNDEYMFHPKHSLHMAAQVSEEIKNRIKLDNYDRYRYIVLVTVGEFLMQGLYSMVNFLWDAEKDGFVTYSVERPSYFAVCTTFYLYYD 189          
BLAST of Tctex1 domain containing 1 vs. Ensembl Fly
Match: CG14763 (gene:FBgn0033243 transcript:FBtr0339126)

HSP 1 Score: 75.485 bits (184), Expect = 1.439e-16
Identity = 44/127 (34.65%), Postives = 67/127 (52.76%), Query Frame = 1
Query:  286 PASRPTVRVENTYQLGPEQKFPVRK--IETIAKDVIESYLAEE-RYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            PA++PT+R   TY+L  E K P+ K  +E I K V+  +  +E  + P+    M+  +SE ++NRIK     RY+ + ++ VGE    G  +    LWD   D F  Y  +  S FAV T F +Y +
Sbjct:   65 PAAKPTMRFMPTYRL--ESKNPLNKERVENIIKAVMNRHYNDEYMFHPKHSLHMAAQVSEEIKNRIKLDNYDRYRYIVLVTVGEFLMQGLYSMVNFLWDAEKDGFVTYSVERPSYFAVCTTFYLYYD 189          
BLAST of Tctex1 domain containing 1 vs. Ensembl Fly
Match: CG5359 (gene:FBgn0037773 transcript:FBtr0306611)

HSP 1 Score: 70.8626 bits (172), Expect = 4.912e-15
Identity = 41/126 (32.54%), Postives = 63/126 (50.00%), Query Frame = 1
Query:  286 PASRPTVRVENTYQLGPE--QKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELR-IKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQ 654
            P  +PT      Y + P   + FP+  I++I  +V+   L ++ Y+    K  +  I++ V  +I     +KRYK V  + +G++   G T  SRC WD   D+     F N SLF V T+FG YQ
Sbjct:   52 PGDQPTA-----YSMRPAFGEMFPLPTIKSIMNNVMAEKLKDKTYDKDVAKKWTSEIADEVNQQIASSSLVKRYKHVVQVMLGQELGAGATYNSRCCWDCDCDTSVSEVFSNTSLFCVCTVFGTYQ 172          
BLAST of Tctex1 domain containing 1 vs. Ensembl Fly
Match: CG5359 (gene:FBgn0037773 transcript:FBtr0082215)

HSP 1 Score: 70.8626 bits (172), Expect = 4.912e-15
Identity = 41/126 (32.54%), Postives = 63/126 (50.00%), Query Frame = 1
Query:  286 PASRPTVRVENTYQLGPE--QKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELR-IKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQ 654
            P  +PT      Y + P   + FP+  I++I  +V+   L ++ Y+    K  +  I++ V  +I     +KRYK V  + +G++   G T  SRC WD   D+     F N SLF V T+FG YQ
Sbjct:   52 PGDQPTA-----YSMRPAFGEMFPLPTIKSIMNNVMAEKLKDKTYDKDVAKKWTSEIADEVNQQIASSSLVKRYKHVVQVMLGQELGAGATYNSRCCWDCDCDTSVSEVFSNTSLFCVCTVFGTYQ 172          
BLAST of Tctex1 domain containing 1 vs. Ensembl Zebrafish
Match: tctex1d1 (Tctex1 domain containing 1 [Source:NCBI gene;Acc:447884])

HSP 1 Score: 159.073 bits (401), Expect = 7.103e-49
Identity = 77/187 (41.18%), Postives = 123/187 (65.78%), Query Frame = 1
Query:  106 TEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDIVALANRKQSISSVCHIDQP---NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            +++AK++A +LLKK+G+                 LG  ++ A+   K SIS++ ++++    +   RPTV++ENTY++ P ++FPV  ++ + KDV+ SYL EE+YE + C+ M+KTI+EVV+ R+K+L I RYK++ +I +G+  D      SRCLWD + D+F+ + FKN SLFA AT+FGVY E
Sbjct:    2 SDLAKEKA-RLLKKRGSLSS--------------LGSHEVRAIGKTKDSISTLSYMEEHGHHDDIQRPTVQMENTYRITPSRRFPVLTVKDLLKDVLTSYLQEEKYETELCRQMTKTITEVVKARVKDLMIPRYKIIVVISIGQIKDQNIRMGSRCLWDDNHDNFSSHIFKNNSLFAAATVFGVYFE 173          
BLAST of Tctex1 domain containing 1 vs. Ensembl Zebrafish
Match: tctex1d1 (Tctex1 domain containing 1 [Source:NCBI gene;Acc:447884])

HSP 1 Score: 159.073 bits (401), Expect = 7.103e-49
Identity = 77/187 (41.18%), Postives = 123/187 (65.78%), Query Frame = 1
Query:  106 TEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDIVALANRKQSISSVCHIDQP---NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            +++AK++A +LLKK+G+                 LG  ++ A+   K SIS++ ++++    +   RPTV++ENTY++ P ++FPV  ++ + KDV+ SYL EE+YE + C+ M+KTI+EVV+ R+K+L I RYK++ +I +G+  D      SRCLWD + D+F+ + FKN SLFA AT+FGVY E
Sbjct:    2 SDLAKEKA-RLLKKRGSLSS--------------LGSHEVRAIGKTKDSISTLSYMEEHGHHDDIQRPTVQMENTYRITPSRRFPVLTVKDLLKDVLTSYLQEEKYETELCRQMTKTITEVVKARVKDLMIPRYKIIVVISIGQIKDQNIRMGSRCLWDDNHDNFSSHIFKNNSLFAAATVFGVYFE 173          
BLAST of Tctex1 domain containing 1 vs. Ensembl Zebrafish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 71.633 bits (174), Expect = 2.644e-15
Identity = 36/116 (31.03%), Postives = 64/116 (55.17%), Query Frame = 1
Query:  316 NTYQLGPEQKFPVRKIETIAKDVIESYLAEE----RYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVY 651
            NTY + P  K   +    +AK+ I   L E+    +Y+P+    +S+++++ +++++K++   RYK +  + +GEQ   G    +RC WD   D++A   + N SLF VA  F VY
Sbjct:   35 NTYLIRPNYKDKFKA--GVAKECIGEILREQLYGVQYDPEEVPTLSRSLADSIKHKLKDMAFDRYKFIVQVVIGEQRGEGVKMAARCFWDADTDNYAQEIYMNDSLFCVAAAFAVY 148          
BLAST of Tctex1 domain containing 1 vs. Ensembl Zebrafish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 57.3806 bits (137), Expect = 4.904e-10
Identity = 27/97 (27.84%), Postives = 54/97 (55.67%), Query Frame = 1
Query:  316 NTYQLGPEQKFPVRKIETIAKDVIESYLAEE----RYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFA 594
            NTY + P  K   +    +AK+ I   L E+    +Y+P+    +S+++++ +++++K++   RYK +  + +GEQ   G    +RC WD   D++A
Sbjct:   35 NTYLIRPNYKDKFK--AGVAKECIGEILREQLYGVQYDPEEVPTLSRSLADSIKHKLKDMAFDRYKFIVQVVIGEQRGEGVKMAARCFWDADTDNYA 129          
BLAST of Tctex1 domain containing 1 vs. Ensembl Zebrafish
Match: DYNLT1 (si:dkey-148f10.4 [Source:ZFIN;Acc:ZDB-GENE-060503-292])

HSP 1 Score: 49.6766 bits (117), Expect = 1.253e-7
Identity = 24/104 (23.08%), Postives = 53/104 (50.96%), Query Frame = 1
Query:  337 EQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGV 648
            E  F V +I TI K+ +E+ +    Y+ +       +I+E+  +++ +L  K +K +    + ++   G  T S C WD + D      ++N +++ + ++FG+
Sbjct:    8 ETTFVVDEITTIIKETVETTIGNNSYQHEKINQWMSSIAELSLSQLTKLG-KPFKYIVTCIILQKNGAGLHTASSCFWDNTTDGSCTVRWENKTIYCIVSVFGL 110          
BLAST of Tctex1 domain containing 1 vs. Ensembl Xenopus
Match: coq10b (coenzyme Q10B [Source:Xenbase;Acc:XB-GENE-5784252])

HSP 1 Score: 175.252 bits (443), Expect = 4.803e-55
Identity = 82/190 (43.16%), Postives = 123/190 (64.74%), Query Frame = 1
Query:  106 TEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDIV---ALANRKQSISSVCHIDQP---NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            ++IAKD+A++LLKK+G+                 LG  D+    + +  K S+S+V +ID+P   +   RP + +ENTYQ GP ++FPV  +  I KDV+ SYL EE+YE + C+ M+KTISEV++ R+K+L I RYK++ +I +G+  D      SRC+WDP+ D+F+ Y FKN SLFA+A ++GVY E
Sbjct:    2 SDIAKDKAARLLKKRGSISS--------------LGSHDVKPRGSFSKTKDSVSTVSYIDEPGHHDDIQRPAILMENTYQTGPTKRFPVASVNNILKDVLTSYLQEEKYEAELCRQMTKTISEVIKARVKDLMIPRYKIIVLIYIGQLNDQSMRVGSRCIWDPANDTFSSYSFKNSSLFALANVYGVYYE 177          
BLAST of Tctex1 domain containing 1 vs. Ensembl Xenopus
Match: txnrd2 (thioredoxin reductase 2 [Source:Xenbase;Acc:XB-GENE-5767949])

HSP 1 Score: 82.4185 bits (202), Expect = 7.098e-19
Identity = 41/108 (37.96%), Postives = 60/108 (55.56%), Query Frame = 1
Query:  349 PVRKIETIA-KDVIESYLAEE----RYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            P  KI+  A K V+ESYL E      Y P    ++ K +SE V+ R+K +   RYK + ++ +GE+G       SRCLWD   DS+  + ++N SLF V  ++ VY E
Sbjct:   90 PSEKIQVTAMKQVLESYLPERLGTITYNPASAPSLVKEVSEEVKGRVKRVLPTRYKALCVVTLGERGQEDIAVVSRCLWDSHSDSYVAHVYENSSLFCVVAVYAVYCE 197          
BLAST of Tctex1 domain containing 1 vs. Ensembl Xenopus
Match: ENSXETT00000022071.1 (lysophosphatidic acid receptor 6-like [Source:Xenbase;Acc:XB-GENE-5721642])

HSP 1 Score: 76.2554 bits (186), Expect = 3.341e-17
Identity = 36/115 (31.30%), Postives = 65/115 (56.52%), Query Frame = 1
Query:  313 ENTYQLGP--EQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVY 651
            ENTY + P  + KF    ++   + V++  L++++Y P+    +++ +SE +++R+K++   RYK+V  + +GEQ   G    +RC WD   D++A   F N  LF V   FG +
Sbjct:    8 ENTYSIRPNFQHKFKSAPVKDCIRSVLKEELSDKQYVPEEVPQLTRFLSETIKDRLKDMGFDRYKMVVQVVIGEQRGEGVKMAARCFWDADTDNYAEDVFMNEYLFCVVAAFGCF 122          
BLAST of Tctex1 domain containing 1 vs. Ensembl Xenopus
Match: ENSXETT00000044463.1 (tctex1 domain-containing protein 1-like [Source:NCBI gene;Acc:100498184])

HSP 1 Score: 73.559 bits (179), Expect = 2.908e-15
Identity = 35/139 (25.18%), Postives = 69/139 (49.64%), Query Frame = 1
Query:  241 RKQSISSVCHIDQPNPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            R Q+ S +  I++  PA+             P  +FP   ++ + ++ + + L  E Y+P  C A++K + E ++  ++ +   RYK++  + +G +       TS+CLWD   D+     ++N +LF V  ++ VY E
Sbjct:   94 RTQNCSPITIINEQTPAN----------SANPAHRFPNAHVKELIEEFLATKLKNESYDPSTCAALTKDLCEDIKKIVRRVTPPRYKLICSMAIGSKDREDIMVTSQCLWDSYSDNVTSCSYQNRTLFCVVLVYAVYFE 222          
BLAST of Tctex1 domain containing 1 vs. Ensembl Xenopus
Match: ENSXETT00000021739.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:98753466:98754165:-1 gene:ENSXETG00000011363.1 transcript:ENSXETT00000021739.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 2.514e-13
Identity = 33/128 (25.78%), Postives = 64/128 (50.00%), Query Frame = 1
Query:  274 DQPNPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            D     +  T  +E+  +L P + F   ++  + K ++E  L +  Y+    +  +  + ++V+  +K L  +RYK+V  I +G          SR +W P+ D++A + F+N SLFA+  ++  Y E
Sbjct:    4 DLNGLGAEETQTMESALELQPRRIFSAEEVSKLIKSILEKQLQDSEYDATGSQQRALELVQLVKEAVKSLGYERYKLVCYIVLGPVSQGALCCCSRSVWSPTSDTYAEFVFRNQSLFALCIVYAGYYE 131          
BLAST of Tctex1 domain containing 1 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 154.451 bits (389), Expect = 6.436e-47
Identity = 67/141 (47.52%), Postives = 100/141 (70.92%), Query Frame = 1
Query:  244 KQSISSVCHIDQP---NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            K S+S+V H D+P   + +SR TVR+ENTYQLGP + FPV  +  I +DV+ +YL E +Y+P+FC+ M+KTISEV++ ++KEL I RYK++ I+ +G++ D      SRCLW+P  D+ + Y FKN + FA+A ++ VY E
Sbjct:   37 KHSLSTVSHADEPSQRDESSRLTVRMENTYQLGPTKPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAVYFE 177          
BLAST of Tctex1 domain containing 1 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 152.91 bits (385), Expect = 1.762e-46
Identity = 66/139 (47.48%), Postives = 99/139 (71.22%), Query Frame = 1
Query:  250 SISSVCHIDQP---NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            S+S+V H D+P   + +SR TVR+ENTYQLGP + FPV  +  I +DV+ +YL E +Y+P+FC+ M+KTISEV++ ++KEL I RYK++ I+ +G++ D      SRCLW+P  D+ + Y FKN + FA+A ++ VY E
Sbjct:   35 SLSTVSHADEPSQRDESSRLTVRMENTYQLGPTKPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAVYFE 173          
BLAST of Tctex1 domain containing 1 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 152.91 bits (385), Expect = 1.762e-46
Identity = 66/139 (47.48%), Postives = 99/139 (71.22%), Query Frame = 1
Query:  250 SISSVCHIDQP---NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            S+S+V H D+P   + +SR TVR+ENTYQLGP + FPV  +  I +DV+ +YL E +Y+P+FC+ M+KTISEV++ ++KEL I RYK++ I+ +G++ D      SRCLW+P  D+ + Y FKN + FA+A ++ VY E
Sbjct:   35 SLSTVSHADEPSQRDESSRLTVRMENTYQLGPTKPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAVYFE 173          
BLAST of Tctex1 domain containing 1 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 152.91 bits (385), Expect = 1.762e-46
Identity = 66/139 (47.48%), Postives = 99/139 (71.22%), Query Frame = 1
Query:  250 SISSVCHIDQP---NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            S+S+V H D+P   + +SR TVR+ENTYQLGP + FPV  +  I +DV+ +YL E +Y+P+FC+ M+KTISEV++ ++KEL I RYK++ I+ +G++ D      SRCLW+P  D+ + Y FKN + FA+A ++ VY E
Sbjct:   35 SLSTVSHADEPSQRDESSRLTVRMENTYQLGPTKPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAVYFE 173          
BLAST of Tctex1 domain containing 1 vs. Ensembl Mouse
Match: Tctex1d1 (Tctex1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1914594])

HSP 1 Score: 134.42 bits (337), Expect = 5.117e-40
Identity = 55/116 (47.41%), Postives = 83/116 (71.55%), Query Frame = 1
Query:  310 VENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            +ENTYQLGP + FPV  +  I +DV+ +YL E +Y+P+FC+ M+KTISEV++ ++KEL I RYK++ I+ +G++ D      SRCLW+P  D+ + Y FKN + FA+A ++ VY E
Sbjct:    1 MENTYQLGPTKPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAVYFE 116          
BLAST of Tctex1 domain containing 1 vs. UniProt/SwissProt
Match: sp|A2VDD2|TC1DB_XENLA (Tctex1 domain-containing protein 1-B (Fragment) OS=Xenopus laevis OX=8355 GN=tctex1d1-b PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 2.442e-56
Identity = 84/190 (44.21%), Postives = 125/190 (65.79%), Query Frame = 1
Query:  106 TEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDI---VALANRKQSISSVCHIDQP---NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            ++IAKD+A++LLKK+G+                 LG  D+    + +  K S+S+V +ID+P   +   RP + VENTYQ+GP ++FPV  +  I KDV+ SYL EE+YE + C+ M+KTISEV++ R+K+L I RYK++ +I +G+  D G    SRC+WDP+ D+F+ Y FKN SLFA+A ++GVY E
Sbjct:    1 SDIAKDKAARLLKKRGSISS--------------LGSHDVKPRGSFSKTKDSVSTVSYIDEPGHHDDIQRPAILVENTYQMGPTKRFPVASVNNILKDVLTSYLQEEKYEAELCRQMTKTISEVIKARVKDLMIPRYKIIVLIYIGQLNDQGMRVGSRCIWDPANDTFSSYSFKNSSLFALANVYGVYYE 176          
BLAST of Tctex1 domain containing 1 vs. UniProt/SwissProt
Match: sp|Q3B8D7|TC1DA_XENLA (Tctex1 domain-containing protein 1-A OS=Xenopus laevis OX=8355 GN=tctex1d1-a PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.542e-54
Identity = 81/190 (42.63%), Postives = 124/190 (65.26%), Query Frame = 1
Query:  106 TEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDIV---ALANRKQSISSVCHIDQP---NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            ++IAKD+A++LLKK+G+ +               LG  D+    + +  K S+S+V +ID+P   +    P + +ENTYQ+GP ++FPV  +  I KDV+ SYL EE+YE + C+ M+KTISEV++ R+K+L I RYK++ +I +G+  D      SRC+WDP+ D+F+ Y FKN SLFA+A ++GVY E
Sbjct:    2 SDIAKDKAARLLKKRGSIIS--------------LGSHDVKPRGSFSKTKDSVSTVSYIDEPGHHDEIQSPAILMENTYQIGPAKRFPVASVNNILKDVLTSYLQEEKYEAELCRQMTKTISEVIKARVKDLMIPRYKIIVLIYIGQLNDQSMRVGSRCIWDPANDTFSSYSFKNSSLFALANVYGVYYE 177          
BLAST of Tctex1 domain containing 1 vs. UniProt/SwissProt
Match: sp|Q66IC8|TC1D1_DANRE (Tctex1 domain-containing protein 1 OS=Danio rerio OX=7955 GN=tctex1d1 PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 5.362e-48
Identity = 77/187 (41.18%), Postives = 123/187 (65.78%), Query Frame = 1
Query:  106 TEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDIVALANRKQSISSVCHIDQP---NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            +++AK++A +LLKK+G+                 LG  ++ A+   K SIS++ ++++    +   RPTV++ENTY++ P ++FPV  ++ + KDV+ SYL EE+YE + C+ M+KTI+EVV+ R+K+L I RYK++ +I +G+  D      SRCLWD + D+F+ + FKN SLFA AT+FGVY E
Sbjct:    2 SDLAKEKA-RLLKKRGSLSS--------------LGSHEVRAIGKTKDSISTLSYMEEHGHHDDIQRPTVQMENTYRITPSRRFPVLTVKDLLKDVLTSYLQEEKYETELCRQMTKTITEVVKARVKDLMIPRYKIIVVISIGQIKDQNIRMGSRCLWDDNHDNFSSHIFKNNSLFAAATVFGVYFE 173          
BLAST of Tctex1 domain containing 1 vs. UniProt/SwissProt
Match: sp|Q8N7M0|TC1D1_HUMAN (Tctex1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TCTEX1D1 PE=1 SV=2)

HSP 1 Score: 153.68 bits (387), Expect = 7.877e-46
Identity = 77/190 (40.53%), Postives = 118/190 (62.11%), Query Frame = 1
Query:   97 MANTEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDIVALANRKQSISSVCHIDQP---NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            M  ++ AK RA+   KK+G+   +   +  +   K++ G          K S+S+V ++++P   +  SR TV++ENTYQLGP + FPV  +  I KDV+ SYL  E YEP+ C+ M+KTISEV++ ++K+L I RYK++ I+ +G+         SRCLWDP  D+F+ Y F+N SLFA+A ++ VY E
Sbjct:    1 MMMSDNAKGRAAHSWKKRGSISSLSNHEFWR---KEIHG--------RIKDSMSTVSYMEEPSQRDDISRLTVQMENTYQLGPPKHFPVVTVNHILKDVVTSYLQVEEYEPELCRQMTKTISEVIKAQVKDLMIPRYKLIVIVHIGQLNRQSILIGSRCLWDPKSDTFSSYVFRNSSLFALANVYAVYLE 179          
BLAST of Tctex1 domain containing 1 vs. UniProt/SwissProt
Match: sp|Q9D5I4|TC1D1_MOUSE (Tctex1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Tctex1d1 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.232e-45
Identity = 66/139 (47.48%), Postives = 99/139 (71.22%), Query Frame = 1
Query:  250 SISSVCHIDQP---NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            S+S+V H D+P   + +SR TVR+ENTYQLGP + FPV  +  I +DV+ +YL E +Y+P+FC+ M+KTISEV++ ++KEL I RYK++ I+ +G++ D      SRCLW+P  D+ + Y FKN + FA+A ++ VY E
Sbjct:   35 SLSTVSHADEPSQRDESSRLTVRMENTYQLGPTKPFPVATVNHILEDVLTTYLQEAQYDPEFCRQMTKTISEVIKTQVKELVIPRYKLIVIVYIGQRDDQSIVIGSRCLWNPKSDTVSSYTFKNSTFFALANVYAVYFE 173          
BLAST of Tctex1 domain containing 1 vs. TrEMBL
Match: A0A2G9RPH0 (Tctex1 domain-containing protein 1-B OS=Lithobates catesbeianus OX=8400 GN=AB205_0067180 PE=4 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 3.400e-54
Identity = 85/187 (45.45%), Postives = 127/187 (67.91%), Query Frame = 1
Query:  106 TEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDIVALANRKQSISSVCHIDQP---NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            +E AKD+A++LLKK+G+        VS   + ++   +++      + S+S+V +ID+P   +   RP V++ENTYQLGP ++FPV  +  I KDV+ SYL EE+YE + C+ M+KTISEVV+ R+K+L I RYK++ +I +G+  D G    SRC+WDP+ D+FA Y FKN SLFA+A ++GVY E
Sbjct:    2 SEAAKDKAARLLKKRGS--------VSSLGSHEVRSRDNLNKPKESRDSMSTVSYIDEPGHHDDVQRPVVQMENTYQLGPGRRFPVATVNNILKDVLTSYLQEEKYEAELCRQMTKTISEVVKARVKDLMIPRYKIIVLIYIGQLNDQGMRVGSRCIWDPANDTFASYTFKNSSLFALANVYGVYYE 180          
BLAST of Tctex1 domain containing 1 vs. TrEMBL
Match: A9ULT6 (Tctex1 domain-containing protein 1-B OS=Xenopus laevis OX=8355 GN=tctex1d1 PE=2 SV=1)

HSP 1 Score: 180.259 bits (456), Expect = 7.470e-54
Identity = 84/190 (44.21%), Postives = 125/190 (65.79%), Query Frame = 1
Query:  106 TEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDI---VALANRKQSISSVCHIDQP---NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            ++IAKD+A++LLKK+G+                 LG  D+    + +  K S+S+V +ID+P   +   RP + VENTYQ+GP ++FPV  +  I KDV+ SYL EE+YE + C+ M+KTISEV++ R+K+L I RYK++ +I +G+  D G    SRC+WDP+ D+F+ Y FKN SLFA+A ++GVY E
Sbjct:    2 SDIAKDKAARLLKKRGSISS--------------LGSHDVKPRGSFSKTKDSVSTVSYIDEPGHHDDIQRPAILVENTYQMGPTKRFPVASVNNILKDVLTSYLQEEKYEAELCRQMTKTISEVIKARVKDLMIPRYKIIVLIYIGQLNDQGMRVGSRCIWDPANDTFSSYSFKNSSLFALANVYGVYYE 177          
BLAST of Tctex1 domain containing 1 vs. TrEMBL
Match: R7TNJ1 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_140076 PE=4 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 2.150e-53
Identity = 86/189 (45.50%), Postives = 131/189 (69.31%), Query Frame = 1
Query:   97 MANTEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDIVALANRKQSISSVCHIDQPN--PASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            M++++IAKD+A++LLKK+G+        VS + T       D    ++RKQS+S++  ID+P+    SRP VR+ENT+Q+ P ++FP  +I  I KDV+E YLAEE+YEP+ CK M+KT+SEVV+ R+KEL I RYK++ I+ +G+         SRCLW+ + D+FA +E++N SLFA+ T++G+Y E
Sbjct:    1 MSSSDIAKDKAARLLKKRGS--------VSGSSTSN-----DYNIRSHRKQSMSTISFIDEPSHEDPSRPPVRMENTFQMAPGKRFPHGQITGIIKDVLEGYLAEEKYEPELCKQMTKTLSEVVKARVKELMIARYKIICIVHIGQLNAQAVRIGSRCLWESNNDTFASFEYRNQSLFALGTVYGIYTE 176          
BLAST of Tctex1 domain containing 1 vs. TrEMBL
Match: A0A1U7SGA5 (tctex1 domain-containing protein 1 isoform X2 OS=Alligator sinensis OX=38654 GN=TCTEX1D1 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 1.148e-52
Identity = 85/187 (45.45%), Postives = 125/187 (66.84%), Query Frame = 1
Query:  106 TEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDIVALANRKQSISSVCHIDQP---NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            +++AK++AS+LLKKQG+   + + +V     K + G          K S+S+V ++DQP   +  SRP V++ENTYQLGP ++FPV  +  I KDV+ +YL EE+YE + C+ M+KTISEV++ R+KEL I RYK++ II +G+  +      SRCLWDP+ D+F+ Y FKN SLFA A ++ VY E
Sbjct:    2 SDLAKEKASRLLKKQGSVSSLSSHEVR---AKDVFG--------RSKDSMSTVSYMDQPGHHDDFSRPAVQMENTYQLGPTRRFPVVTVNNILKDVLTNYLQEEKYEAELCRQMTKTISEVIKARVKELMIPRYKIIVIIHIGQLNEQSMQIGSRCLWDPTSDTFSSYAFKNTSLFAHANVYAVYFE 177          
BLAST of Tctex1 domain containing 1 vs. TrEMBL
Match: A0A452HDE3 (Tctex1 domain containing 1 OS=Gopherus agassizii OX=38772 GN=TCTEX1D1 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 1.231e-52
Identity = 83/192 (43.23%), Postives = 132/192 (68.75%), Query Frame = 1
Query:   88 IRDMAN-TEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDIVALANRKQSISSVCHIDQP-NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            I+D+ + ++IAKD+A++LLKK+G+   + + +V     K++LG          K S+S+V ++D+P +   R  V++ENTYQLGP ++FPV  +  I KDV+ +YL EE+YEP+ C+ M+KTISEV++ R+K+L I RYK++ I+ +G+  +      SRC+WDP+ D+F+ Y FKN SLFA+A ++ VY E
Sbjct:    2 IKDLIDMSDIAKDKAARLLKKRGSVSSLSSHEVR---AKEILG--------KNKDSMSTVSYVDEPGHDIPRLAVQLENTYQLGPAKRFPVVTVNNILKDVLTNYLQEEKYEPELCRQMTKTISEVIKARVKDLMIPRYKIIVIVHIGQLNEQSMRIGSRCIWDPASDTFSSYAFKNTSLFALANVYAVYFE 182          
BLAST of Tctex1 domain containing 1 vs. Ensembl Cavefish
Match: tctex1d1 (Tctex1 domain containing 1 [Source:NCBI gene;Acc:103044040])

HSP 1 Score: 164.466 bits (415), Expect = 5.784e-51
Identity = 81/187 (43.32%), Postives = 123/187 (65.78%), Query Frame = 1
Query:  106 TEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDIVALANRKQSISSVCHIDQP---NPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            +++AK++ ++LLKK+G+   + +  V     K LL       L N K SIS+V ++D P   +  SRP V++ENTYQLGP+++FPV+ ++ I KDV+ SYL E +YE + C+ M+KTISEVV+ R+K++ I RYK++ +I +G+         SRCLWD + D+F    FKN SLFA+A ++ VY E
Sbjct:    2 SDLAKEKVARLLKKRGSVSSLGSHDVR---NKNLL-------LKN-KDSISTVSYMDDPGHHDDVSRPAVQMENTYQLGPKKRFPVQTVKEILKDVLSSYLLEVKYEAELCRQMTKTISEVVKARVKDMMIPRYKIIVVISIGQLTGQNMHVGSRCLWDATSDTFCSNSFKNSSLFAIANVYAVYFE 177          
BLAST of Tctex1 domain containing 1 vs. Ensembl Cavefish
Match: ENSAMXT00000038759.1 (tctex1 domain-containing protein 1-A-like [Source:NCBI gene;Acc:103036543])

HSP 1 Score: 92.0485 bits (227), Expect = 1.195e-22
Identity = 39/112 (34.82%), Postives = 70/112 (62.50%), Query Frame = 1
Query:  322 YQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            YQ  P ++FP  ++ ++ K ++E+ L E +Y  + C A+++ +S+ ++   K L  +RYK+++ + +G+  D   T +SR +W P+ D+F  Y FKN  LFA+  +F VYQE
Sbjct:   88 YQTAPHRRFPREQVRSVMKSIVEARLGEAQYTSR-CSAVARKLSDSIKEAAKSLSYERYKLISYVAIGQLRDSEVTCSSRGVWCPAADTFTEYTFKNDHLFALCVLFAVYQE 198          
BLAST of Tctex1 domain containing 1 vs. Ensembl Cavefish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 74.3294 bits (181), Expect = 1.435e-16
Identity = 34/98 (34.69%), Postives = 56/98 (57.14%), Query Frame = 1
Query:  361 IETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQ 654
            + +  ++++   L  E Y+ +     ++T+S+ + +R+KEL + RYK+V  + +GEQ   G    SRC WD   DS A   + N SLF VA +FG+Y 
Sbjct:   47 VSSCIRELVREQLGGESYDSERSAETAQTLSKRITDRLKELGLDRYKLVVQVVIGEQRGEGVQMASRCFWDADTDSCAKDVYMNDSLFCVAAVFGIYH 144          
BLAST of Tctex1 domain containing 1 vs. Ensembl Cavefish
Match: tctex1d2 (Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-081104-219])

HSP 1 Score: 59.3066 bits (142), Expect = 3.340e-11
Identity = 29/95 (30.53%), Postives = 51/95 (53.68%), Query Frame = 1
Query:  337 EQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSL 621
            + +F    + +  ++++   L  E Y+ +     ++T+S+ + +R+KEL + RYK+V  + +GEQ   G    SRC WD   DS A   + N SL
Sbjct:   15 QHRFRPAVVSSCIRELVREQLGGESYDSERSAETAQTLSKRITDRLKELGLDRYKLVVQVVIGEQRGEGVQMASRCFWDADTDSCAKDVYMNVSL 109          
BLAST of Tctex1 domain containing 1 vs. Ensembl Cavefish
Match: napepld (N-acyl phosphatidylethanolamine phospholipase D [Source:NCBI gene;Acc:103040918])

HSP 1 Score: 54.6842 bits (130), Expect = 1.792e-8
Identity = 37/159 (23.27%), Postives = 71/159 (44.65%), Query Frame = 1
Query:  208 LGPEDIVAL---ANRKQSISSVCHIDQPNPASRPTVRVE---------NTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGV 648
             GP D+ A+   A   + I    H+D P  A +  + V+          T+ L  E  F V ++ TI K+ +E  + E  Y+    K  +  + E   +++ +L  K +K +    + ++   G  T   C WD + D      ++N S++ + ++FG+
Sbjct:  297 FGPFDLAAIPIGAYLPRGIMKSQHVD-PEEAVQIHIDVQAKNSVAIHWGTFALAYETAFVVDEVSTIVKEAVEGAIGENSYQQSRVKQWTNNVVEQCLSQLNKLG-KPFKYIVTCIIMQKNGAGLQTACSCFWDNTTDGSCTVRWENKSMYCIVSVFGL 453          
BLAST of Tctex1 domain containing 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008035.1 (pep scaffold:Pmarinus_7.0:GL476353:419801:420827:1 gene:ENSPMAG00000007269.1 transcript:ENSPMAT00000008035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 1.599e-20
Identity = 38/105 (36.19%), Postives = 61/105 (58.10%), Query Frame = 1
Query:  346 FPVRKIETIAKDVIESYLAE-ERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            FPV ++E + ++ +  +L E E  +   C  ++  +SE ++ R KE    RYK++  + +G          SRCLWDP+ D+FA + ++ G+ F VATIFGVY E
Sbjct:    1 FPVERLERLLEETLTRHLGEGEALDAAACARLAPLLSEEIKARAKEQTPTRYKLIVSVTLGSWEREQVVVASRCLWDPAADAFASHHYRRGARFCVATIFGVYYE 105          
BLAST of Tctex1 domain containing 1 vs. Ensembl Sea Lamprey
Match: si:dkey-148f10.4 (dynein, light chain, Tctex-type 1 [Source:ZFIN;Acc:ZDB-GENE-041210-9])

HSP 1 Score: 56.9954 bits (136), Expect = 5.103e-11
Identity = 28/109 (25.69%), Postives = 53/109 (48.62%), Query Frame = 1
Query:  322 YQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGV 648
            +Q G E  F V ++  I K+ +ES +    Y+       + T+ E   N++ +L  K +K +    + ++   G  T S C WD S D      ++N S++ + ++FG+
Sbjct:    4 FQSGEEAAFVVDEVSNIIKESVESAIGGNAYQHNKVNQWTSTVVEQCLNQLAKLN-KPFKYIVTCVIMQKNGAGLHTASSCFWDNSTDGSCTVRWENKSMYCIVSVFGL 111          
BLAST of Tctex1 domain containing 1 vs. Ensembl Nematostella
Match: EDO45441 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTB6])

HSP 1 Score: 140.198 bits (352), Expect = 5.577e-42
Identity = 75/182 (41.21%), Postives = 109/182 (59.89%), Query Frame = 1
Query:  121 DRASKLLKKQGNTVQIVTKQVSKTPTKQLLG-PEDIVALANRKQSISSVCHIDQPNPASRPTVR--VENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            +RA+K LKK+G            TP K L   P   V++A   QS+++        P SR  +   +ENTYQ  P +KFP   I  I K+V+   LA+  Y+P  C+ ++KTISE ++NR+KEL ++RYK++ ++ +G+ G       SRCLWD + D++  YEFKNGSLF VAT++GVY E
Sbjct:   17 ERAAKTLKKRG----------EPTPVKGLTTRPASSVSIA---QSVAT--------PHSRKGMEPVMENTYQTTPTKKFPEGNIRNIMKEVLIENLADVNYDPNTCRQLTKTISETLKNRVKELSVQRYKIICLVHIGQLGKQAMRIGSRCLWDANFDTYTTYEFKNGSLFGVATVYGVYFE 177          
BLAST of Tctex1 domain containing 1 vs. Ensembl Nematostella
Match: EDO45313 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT02])

HSP 1 Score: 107.071 bits (266), Expect = 7.118e-30
Identity = 43/115 (37.39%), Postives = 75/115 (65.22%), Query Frame = 1
Query:  313 ENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            +NTY++ P  +F  +K++ I ++  + +L E  YE +FCK M+  +SE+++ R+K L   RYK++ I+ +G+  + G    SRCLW+ + D+     ++NG+LFAVAT+FG + E
Sbjct:    1 KNTYRMEPSNRFSHKKVKDIIEEAFQEHLNEHSYEAEFCKHMTTKLSELIKQRVKHLGFTRYKLICIVYIGQVMNQGMRIGSRCLWNTNFDNVVEGSYRNGNLFAVATVFGAFVE 115          
BLAST of Tctex1 domain containing 1 vs. Ensembl Nematostella
Match: EDO44328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW04])

HSP 1 Score: 106.686 bits (265), Expect = 1.319e-29
Identity = 46/120 (38.33%), Postives = 77/120 (64.17%), Query Frame = 1
Query:  298 PTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            P  ++ENTYQ+ P++ FP  +++ I  + +++ LAE +Y+      +S+ +S+ V +++K L ++RYK+V ++ +G + D G    SRCLW    D FA    +NGSLFAV T++GVY E
Sbjct:    1 PIQKLENTYQVEPKRVFPTGEVKQIIHNTLQNALAESKYKEMNSSFVSQLLSQRVLDQVKSLDVQRYKLVCLVSIGSKSDQGMRVASRCLWHSEFDRFASASVENGSLFAVGTVYGVYFE 120          
BLAST of Tctex1 domain containing 1 vs. Ensembl Nematostella
Match: EDO29797 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW04])

HSP 1 Score: 106.686 bits (265), Expect = 1.319e-29
Identity = 46/120 (38.33%), Postives = 77/120 (64.17%), Query Frame = 1
Query:  298 PTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            P  ++ENTYQ+ P++ FP  +++ I  + +++ LAE +Y+      +S+ +S+ V +++K L ++RYK+V ++ +G + D G    SRCLW    D FA    +NGSLFAV T++GVY E
Sbjct:    1 PIQKLENTYQVEPKRVFPTGEVKQIIHNTLQNALAESKYKEMNSSFVSQLLSQRVLDQVKSLDVQRYKLVCLVSIGSKSDQGMRVASRCLWHSEFDRFASASVENGSLFAVGTVYGVYFE 120          
BLAST of Tctex1 domain containing 1 vs. Ensembl Nematostella
Match: EDO46990 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNU7])

HSP 1 Score: 103.605 bits (257), Expect = 1.808e-28
Identity = 44/114 (38.60%), Postives = 72/114 (63.16%), Query Frame = 1
Query:  316 NTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            NTY+LGP+ KF   K+E +A+ V++  LAE  Y+P+ C+  +  I + + +++K L   RYK+V +  +G+  D      SRC WD ++D++A   + N +LFAV  I+G+YQE
Sbjct:    2 NTYKLGPDNKFSPAKVEEVAQSVLQKVLAESVYDPKTCRTQAMEIGDEILSQVKALGFDRYKIVCLTNIGKVNDQTIRIGSRCCWDQNLDNYAEAVYTNSTLFAVTAIYGIYQE 115          
BLAST of Tctex1 domain containing 1 vs. Ensembl Medaka
Match: tctex1d2 (Tctex1 domain containing 2 [Source:NCBI gene;Acc:101160473])

HSP 1 Score: 67.781 bits (164), Expect = 4.534e-14
Identity = 30/97 (30.93%), Postives = 54/97 (55.67%), Query Frame = 1
Query:  361 IETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVY 651
            ++    +++   L+  +YEP+       ++++ +R+++K L I +YK++  + +GEQ   G    SR  WD   D++A   F N SLF VA +FG Y
Sbjct:   45 VKEFVHEIVRERLSGVKYEPEKIPETCSSLADCIRDKVKSLGIDKYKIIVQVMIGEQRGQGVKMCSRFFWDADTDNYAEDVFMNDSLFCVAAVFGCY 141          
BLAST of Tctex1 domain containing 1 vs. Planmine SMEST
Match: SMESG000040148.1 (SMESG000040148.1)

HSP 1 Score: 385.956 bits (990), Expect = 1.806e-138
Identity = 185/187 (98.93%), Postives = 187/187 (100.00%), Query Frame = 1
Query:   97 MANTEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDIVALANRKQSISSVCHIDQPNPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            MANTEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDIVALANRKQSISSVCHIDQPNPASRPTVRVENTYQLGP+QKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFG+YQE
Sbjct:    1 MANTEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDIVALANRKQSISSVCHIDQPNPASRPTVRVENTYQLGPDQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGIYQE 187          
BLAST of Tctex1 domain containing 1 vs. Planmine SMEST
Match: SMESG000040148.1 (SMESG000040148.1)

HSP 1 Score: 353.214 bits (905), Expect = 1.150e-125
Identity = 173/187 (92.51%), Postives = 175/187 (93.58%), Query Frame = 1
Query:   97 MANTEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDIVALANRKQSISSVCHIDQPNPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            MANTEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLG            SISSVCHIDQPNPASRPTVRVENTYQLGP+QKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFG+YQE
Sbjct:    1 MANTEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLG------------SISSVCHIDQPNPASRPTVRVENTYQLGPDQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGIYQE 175          
BLAST of Tctex1 domain containing 1 vs. Planmine SMEST
Match: SMESG000021852.1 (SMESG000021852.1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.046e-20
Identity = 45/147 (30.61%), Postives = 84/147 (57.14%), Query Frame = 1
Query:  232 LANRKQSISSVCHIDQPNPASRPT--VRVENTYQLGPE--QKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLWDP-SIDSFACYEFKNGSLFAVATIFGVYQE 657
            L N ++S  S+  +  P   +  +  ++ ENTY++ PE  +KF ++ I  I +DV+   L+  +Y+ +    +SK I++ ++  +++L   R+K+V I+ +G++        SRCLW+  + D  A   F  GS+FA+ T+FG+Y E
Sbjct:   37 LVNIQRSRGSIWSMQNPGKKTLLSLPIQYENTYRIMPENHEKFTMKTIRQIIQDVLSDCLSGVKYDSKVVPELSKLIADRIKRLVRDLCYNRFKLVCIVLIGDKSGANVCIASRCLWNSENGDDVAQASFDGGSIFAIGTVFGLYFE 183          
BLAST of Tctex1 domain containing 1 vs. Planmine SMEST
Match: SMESG000018052.1 (SMESG000018052.1)

HSP 1 Score: 84.3445 bits (207), Expect = 4.356e-20
Identity = 42/138 (30.43%), Postives = 81/138 (58.70%), Query Frame = 1
Query:  268 HIDQPNPAS-----RPTVRVENTYQLG--PEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLW-DPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            +++QPN  +      P ++ ENTY++   P++ F   K+++I  D ++  L + +Y+P     M++ ++E ++ ++KEL   RYK V I+ +G +        SR LW D S D+F+   + N +++A+AT++G+Y E
Sbjct:   40 YMNQPNLWNLDRKIMPQIQYENTYRMDADPKETFLSHKVKSILTDELKRVLHDYKYDPNSANEMTRILTEKIKFKMKELPSVRYKFVVIVVLGNKNSGAICYGSRALWNDKSGDTFSEVSYTNDNIYAIATVYGIYYE 177          
BLAST of Tctex1 domain containing 1 vs. Planmine SMEST
Match: SMESG000017994.1 (SMESG000017994.1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.281e-19
Identity = 42/138 (30.43%), Postives = 79/138 (57.25%), Query Frame = 1
Query:  268 HIDQPNPAS-----RPTVRVENTYQL--GPEQKFPVRKIETIAKDVIESYLAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGFTTTSRCLW-DPSIDSFACYEFKNGSLFAVATIFGVYQE 657
            +++QPN  +      P ++ ENTY++   P++ F   K ++I  D ++  L   +Y+P     M++ ++E ++ ++KEL   RYK V I+ +G +        SR LW D S D+F+   + N +++A+AT++G+Y E
Sbjct:   40 YMNQPNLWNLDRKIMPQIQYENTYRMDANPKETFLSHKAKSILTDELKRVLHNYKYDPNNANEMTRILTEKIKFKMKELPSVRYKFVVIVVLGNKNSGAICYGSRALWNDKSGDTFSEVSYTNDNIYAIATVYGIYYE 177          
The following BLAST results are available for this feature:
BLAST of Tctex1 domain containing 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TCTEX1D11.640e-4640.53Tctex1 domain containing 1 [Source:HGNC Symbol;Acc... [more]
TCTEX1D21.533e-1734.78Tctex1 domain containing 2 [Source:HGNC Symbol;Acc... [more]
TCTEX1D44.932e-1139.19Tctex1 domain containing 4 [Source:HGNC Symbol;Acc... [more]
TCTE35.318e-921.05t-complex-associated-testis-expressed 3 [Source:HG... [more]
TCTE35.318e-921.05t-complex-associated-testis-expressed 3 [Source:HG... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dylt-23.036e-1128.70DYnein Light chain (Tctex type) [Source:UniProtKB... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG147631.439e-1634.65gene:FBgn0033243 transcript:FBtr0088875[more]
CG147631.439e-1634.65gene:FBgn0033243 transcript:FBtr0339127[more]
CG147631.439e-1634.65gene:FBgn0033243 transcript:FBtr0339126[more]
CG53594.912e-1532.54gene:FBgn0037773 transcript:FBtr0306611[more]
CG53594.912e-1532.54gene:FBgn0037773 transcript:FBtr0082215[more]
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tctex1d17.103e-4941.18Tctex1 domain containing 1 [Source:NCBI gene;Acc:4... [more]
tctex1d17.103e-4941.18Tctex1 domain containing 1 [Source:NCBI gene;Acc:4... [more]
tctex1d22.644e-1531.03Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
tctex1d24.904e-1027.84Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
DYNLT11.253e-723.08si:dkey-148f10.4 [Source:ZFIN;Acc:ZDB-GENE-060503-... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
coq10b4.803e-5543.16coenzyme Q10B [Source:Xenbase;Acc:XB-GENE-5784252][more]
txnrd27.098e-1937.96thioredoxin reductase 2 [Source:Xenbase;Acc:XB-GEN... [more]
ENSXETT00000022071.13.341e-1731.30lysophosphatidic acid receptor 6-like [Source:Xenb... [more]
ENSXETT00000044463.12.908e-1525.18tctex1 domain-containing protein 1-like [Source:NC... [more]
ENSXETT00000021739.12.514e-1325.78pep primary_assembly:Xenopus_tropicalis_v9.1:4:987... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tctex1d16.436e-4747.52Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d11.762e-4647.48Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d11.762e-4647.48Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d11.762e-4647.48Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
Tctex1d15.117e-4047.41Tctex1 domain containing 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A2VDD2|TC1DB_XENLA2.442e-5644.21Tctex1 domain-containing protein 1-B (Fragment) OS... [more]
sp|Q3B8D7|TC1DA_XENLA1.542e-5442.63Tctex1 domain-containing protein 1-A OS=Xenopus la... [more]
sp|Q66IC8|TC1D1_DANRE5.362e-4841.18Tctex1 domain-containing protein 1 OS=Danio rerio ... [more]
sp|Q8N7M0|TC1D1_HUMAN7.877e-4640.53Tctex1 domain-containing protein 1 OS=Homo sapiens... [more]
sp|Q9D5I4|TC1D1_MOUSE1.232e-4547.48Tctex1 domain-containing protein 1 OS=Mus musculus... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2G9RPH03.400e-5445.45Tctex1 domain-containing protein 1-B OS=Lithobates... [more]
A9ULT67.470e-5444.21Tctex1 domain-containing protein 1-B OS=Xenopus la... [more]
R7TNJ12.150e-5345.50Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1U7SGA51.148e-5245.45tctex1 domain-containing protein 1 isoform X2 OS=A... [more]
A0A452HDE31.231e-5243.23Tctex1 domain containing 1 OS=Gopherus agassizii O... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tctex1d15.784e-5143.32Tctex1 domain containing 1 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000038759.11.195e-2234.82tctex1 domain-containing protein 1-A-like [Source:... [more]
tctex1d21.435e-1634.69Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
tctex1d23.340e-1130.53Tctex1 domain containing 2 [Source:ZFIN;Acc:ZDB-GE... [more]
napepld1.792e-823.27N-acyl phosphatidylethanolamine phospholipase D [S... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000008035.11.599e-2036.19pep scaffold:Pmarinus_7.0:GL476353:419801:420827:1... [more]
si:dkey-148f10.45.103e-1125.69dynein, light chain, Tctex-type 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO454415.577e-4241.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453137.118e-3037.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443281.319e-2938.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297971.319e-2938.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469901.808e-2838.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tctex1d24.534e-1430.93Tctex1 domain containing 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Tctex1 domain containing 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040148.11.806e-13898.93SMESG000040148.1[more]
SMESG000040148.11.150e-12592.51SMESG000040148.1[more]
SMESG000021852.12.046e-2030.61SMESG000021852.1[more]
SMESG000018052.14.356e-2030.43SMESG000018052.1[more]
SMESG000017994.12.281e-1930.43SMESG000017994.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016917 ID=SMED30016917|Name=Tctex1 domain containing 1|organism=Schmidtea mediterranea sexual|type=transcript|length=693bp
TTTCATTCCGTAGAAACATTGTAAATTAATTAACTTTTCAAAATAAGTAA
ATTAATATTTTATAAGTTGTAATAAATAAAGATTAATATTCGTGATATGG
CCAACACTGAAATAGCAAAAGACAGAGCGTCTAAGCTTTTGAAGAAACAG
GGCAATACAGTGCAAATAGTTACAAAACAAGTATCAAAAACTCCGACCAA
ACAGTTACTAGGACCAGAAGATATTGTAGCTCTTGCTAACCGAAAACAAT
CTATCAGCAGTGTGTGTCACATTGATCAACCGAATCCAGCTAGTCGGCCA
ACTGTTAGAGTAGAAAACACTTATCAACTGGGCCCAGAGCAAAAATTCCC
CGTAAGAAAAATCGAAACGATTGCTAAGGATGTGATTGAAAGTTATCTGG
CGGAAGAAAGATATGAGCCTCAGTTCTGTAAAGCCATGTCCAAAACAATA
TCAGAGGTTGTTCGTAACAGAATCAAAGAATTGAGAATAAAACGATATAA
AGTTGTCGCCATAATACAGGTTGGAGAGCAAGGGGACCATGGTTTTACAA
CAACTAGCCGTTGTTTGTGGGACCCATCTATCGATTCTTTTGCATGTTAT
GAATTTAAAAACGGTTCGCTTTTTGCTGTTGCTACTATTTTCGGTGTTTA
TCAAGAATGATTTTATCTCAAATAAATGTTTTGGTTGTTTGTC
back to top

protein sequence of SMED30016917-orf-1

>SMED30016917-orf-1 ID=SMED30016917-orf-1|Name=SMED30016917-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=188bp
MANTEIAKDRASKLLKKQGNTVQIVTKQVSKTPTKQLLGPEDIVALANRK
QSISSVCHIDQPNPASRPTVRVENTYQLGPEQKFPVRKIETIAKDVIESY
LAEERYEPQFCKAMSKTISEVVRNRIKELRIKRYKVVAIIQVGEQGDHGF
TTTSRCLWDPSIDSFACYEFKNGSLFAVATIFGVYQE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR038586Tctex-1-like_sf
IPR005334Tctex-1-like
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005334Dynein light chain Tctex-1 likePFAMPF03645Tctex-1coord: 89..185
e-value: 6.2E-23
score: 81.0
IPR005334Dynein light chain Tctex-1 likePANTHERPTHR21255T-COMPLEX-ASSOCIATED-TESTIS-EXPRESSED 1/ DYNEIN LIGHT CHAINcoord: 47..187
IPR038586Tctex-1-like superfamilyGENE3DG3DSA:3.30.1140.40coord: 87..185
e-value: 4.2E-21
score: 76.7
NoneNo IPR availablePANTHERPTHR21255:SF52TCTEX1 DOMAIN-CONTAINING PROTEIN 1coord: 47..187