PBPe domain-containing protein

Overview
NamePBPe domain-containing protein
Smed IDSMED30016909
Length (bp)2349
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PBPe domain-containing protein (SMED30016909) t-SNE clustered cells

Violin plots show distribution of expression levels for PBPe domain-containing protein (SMED30016909) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PBPe domain-containing protein (SMED30016909) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PBPe domain-containing protein (SMED30016909) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 98.5969 bits (244), Expect = 2.019e-20
Identity = 104/460 (22.61%), Postives = 207/460 (45.00%), Query Frame = 1
Query:  964 VFNNNAWLPVTNASCQAIVDMT------TIRLCISLEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKS--------LVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEFSVYYLVKRKVIKNC 2244
            ++N+N+ L +T+++     ++T      T+ +   LEEP++    S        +  GY +++LK + +   I   +Y  +      Y  +N K         L+    D  V     ++ R + I +        I I   KP   +  +++ L PL   +W+  +L+CL  +    ++++++P   +N      D  +V+   + + + W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV +       K S  + ++ M +      +  L +N +  I +VL +T+ A + +++ +     RNC++   I   ID +         +  +  +   I  L E G L     ++W+ G+   +  N +  +S LG+ +IGG FI+ A    L   +   EF +Y   K   I+ C
Sbjct:  405 IWNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSN---ILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVL-TTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWR-GNGCPEEDNKE--ASALGVENIGGIFIVLAAGLVLSVFVAIGEF-IYKSRKNNDIEQC 855          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 98.2117 bits (243), Expect = 2.329e-20
Identity = 104/460 (22.61%), Postives = 207/460 (45.00%), Query Frame = 1
Query:  964 VFNNNAWLPVTNASCQAIVDMT------TIRLCISLEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKS--------LVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEFSVYYLVKRKVIKNC 2244
            ++N+N+ L +T+++     ++T      T+ +   LEEP++    S        +  GY +++LK + +   I   +Y  +      Y  +N K         L+    D  V     ++ R + I +        I I   KP   +  +++ L PL   +W+  +L+CL  +    ++++++P   +N      D  +V+   + + + W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV +       K S  + ++ M +      +  L +N +  I +VL +T+ A + +++ +     RNC++   I   ID +         +  +  +   I  L E G L     ++W+ G+   +  N +  +S LG+ +IGG FI+ A    L   +   EF +Y   K   I+ C
Sbjct:  420 IWNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSN---ILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVL-TTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWR-GNGCPEEDNKE--ASALGVENIGGIFIVLAAGLVLSVFVAIGEF-IYKSRKNNDIEQC 870          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIA1 (glutamate ionotropic receptor AMPA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4571])

HSP 1 Score: 96.2857 bits (238), Expect = 9.692e-20
Identity = 74/321 (23.05%), Postives = 141/321 (43.93%), Query Frame = 1
Query: 1303 SIQIFAHKPENDSK-LWNILRPLHYHVWLLCILSCLISAFTGV-----MLSKYSPLS----AWNLGLDISIVD---EVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS-------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYW-QTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
             I I   KP+     +++ L PL Y +W+     C++ A+ GV     ++S++SP       +  G D +  D   E     +LW  +GA + QG D  P S+S R+V  +WW F L++ + Y+A+L +FLT+   +  + + ++L    +     +E     E  + S    F+ M +        + +    EG I    +    A + +++       R       +   +D +         ++++  +N  +  L E G+LDK  +++W   G+   K   +   +S L L+++ G F +     GL  ++  IEF
Sbjct:  513 GISIMIKKPQKSKPGVFSFLDPLAYEIWM-----CIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEF 828          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIA1 (glutamate ionotropic receptor AMPA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4571])

HSP 1 Score: 96.2857 bits (238), Expect = 9.776e-20
Identity = 74/321 (23.05%), Postives = 141/321 (43.93%), Query Frame = 1
Query: 1303 SIQIFAHKPENDSK-LWNILRPLHYHVWLLCILSCLISAFTGV-----MLSKYSPLS----AWNLGLDISIVD---EVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS-------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYW-QTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
             I I   KP+     +++ L PL Y +W+     C++ A+ GV     ++S++SP       +  G D +  D   E     +LW  +GA + QG D  P S+S R+V  +WW F L++ + Y+A+L +FLT+   +  + + ++L    +     +E     E  + S    F+ M +        + +    EG I    +    A + +++       R       +   +D +         ++++  +N  +  L E G+LDK  +++W   G+   K   +   +S L L+++ G F +     GL  ++  IEF
Sbjct:  523 GISIMIKKPQKSKPGVFSFLDPLAYEIWM-----CIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEF 838          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 96.2857 bits (238), Expect = 1.023e-19
Identity = 100/446 (22.42%), Postives = 201/446 (45.07%), Query Frame = 1
Query:  964 VFNNNAWLPVTNASCQAIVDMT------TIRLCISLEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKS--------LVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            ++N+N+ L +T+++     ++T      T+ +   LEEP++    S        +  GY +++LK + +   I   +Y  +      Y  +N K         L+    D  V     ++ R + I +        I I   KP   +  +++ L PL   +W+  +L+CL  +    ++++++P   +N      D  +V+   + + + W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV +       K S  + ++ M +      +  L +N +  I +VL +T+ A + +++ +     RNC++   I   ID +         +  +  +   I  L E G L     ++W+ G+   +  N +  +S LG+ +IGG FI+ A    L   +   EF
Sbjct:  420 IWNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSN---ILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVL-TTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWR-GNGCPEEDNKE--ASALGVENIGGIFIVLAAGLVLSVFVAIGEF 857          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-7 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q18591])

HSP 1 Score: 95.5153 bits (236), Expect = 5.969e-20
Identity = 121/501 (24.15%), Postives = 216/501 (43.11%), Query Frame = 1
Query:  982 WLPVTNASCQ------AIVDMTTIRLCISLEEPFIYNVTSTDSETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQK---------------SLVAIGRDFG-----VQYNLQSFYRSETIYWE--SIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVML---SKYSPLSAWN----LGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENS-------RVHELLKTS---------NET------------------KFKNM---MSRIILEQNMEGCINKVLNSTNS-ACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPC-NTDLVSSILGLADIGGAFILTAILFGLGTIILCIEFSVYYLVKRKVIKNCDDTISE 2262
            W P++  S         + ++   R+   ++ PF+      D+      GY I+++  I+          V  NF+  +Y++E+                 +LV+   D       V    ++       Y++     I   K + +  L+  ++ L + VWL CI++  +  FT ++L    ++SP S  N       DI    + S  E LW  + +   QG    P +IS R+V A WWLF  ++   Y+A+L +FLT+S   + +S+LD+L    + +   ++ S       R+ E+ +T          NE+                  KF NM   M    L  NM+  +++VLNS +  A IGDA+ +  +A  NC++  +  E+   +P +    +   +K  +++ I ML+    L+    ++W T +P    C ++   S  + + +IGG FI+  IL G+   I+ + F  YY  KRK  K  +    E
Sbjct:  351 WSPISKLSVMYGTLQVDVRNLNIFRVVTLIQPPFVQRTGDPDTPYE---GYCIDLINMIQ----------VEVNFTYTIYEVEDGSFGTMDDNGNWNGLIGALVSGSADIALAPLSVMAERENDVDFTVPYYDLVGTTILMKKADVEYSLFKFMKVLEWPVWL-CIVAAYL--FTSILLWIFDRFSPYSFTNNKERYQNDIE-KRQFSLKECLWFCMTSLTPQGGGEAPKNISGRLVAATWWLFGFIIIASYTANLAAFLTVSRLEQPISSLDDLAKQYKIEYAPIKGSASETYFRRMAEIEETFYNMWKEMSLNESMSPRDRAKLAVWDYPVSDKFTNMWRYMQESKLPVNMDTAVDRVLNSVDGFAFIGDATEIKYAALTNCNLQQVGTEF-SRKPYAIAVQSGHILKDKISSAILMLLNERRLETLKEKWW-TDNPNKVSCPDSSDESDGISIQNIGGVFIV--ILAGIALSIVTLAFE-YYYYKRKARKAAEKEQEE 829          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-7 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q18591])

HSP 1 Score: 95.5153 bits (236), Expect = 6.336e-20
Identity = 121/501 (24.15%), Postives = 216/501 (43.11%), Query Frame = 1
Query:  982 WLPVTNASCQ------AIVDMTTIRLCISLEEPFIYNVTSTDSETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQK---------------SLVAIGRDFG-----VQYNLQSFYRSETIYWE--SIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVML---SKYSPLSAWN----LGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENS-------RVHELLKTS---------NET------------------KFKNM---MSRIILEQNMEGCINKVLNSTNS-ACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPC-NTDLVSSILGLADIGGAFILTAILFGLGTIILCIEFSVYYLVKRKVIKNCDDTISE 2262
            W P++  S         + ++   R+   ++ PF+      D+      GY I+++  I+          V  NF+  +Y++E+                 +LV+   D       V    ++       Y++     I   K + +  L+  ++ L + VWL CI++  +  FT ++L    ++SP S  N       DI    + S  E LW  + +   QG    P +IS R+V A WWLF  ++   Y+A+L +FLT+S   + +S+LD+L    + +   ++ S       R+ E+ +T          NE+                  KF NM   M    L  NM+  +++VLNS +  A IGDA+ +  +A  NC++  +  E+   +P +    +   +K  +++ I ML+    L+    ++W T +P    C ++   S  + + +IGG FI+  IL G+   I+ + F  YY  KRK  K  +    E
Sbjct:  332 WSPISKLSVMYGTLQVDVRNLNIFRVVTLIQPPFVQRTGDPDTPYE---GYCIDLINMIQ----------VEVNFTYTIYEVEDGSFGTMDDNGNWNGLIGALVSGSADIALAPLSVMAERENDVDFTVPYYDLVGTTILMKKADVEYSLFKFMKVLEWPVWL-CIVAAYL--FTSILLWIFDRFSPYSFTNNKERYQNDIE-KRQFSLKECLWFCMTSLTPQGGGEAPKNISGRLVAATWWLFGFIIIASYTANLAAFLTVSRLEQPISSLDDLAKQYKIEYAPIKGSASETYFRRMAEIEETFYNMWKEMSLNESMSPRDRAKLAVWDYPVSDKFTNMWRYMQESKLPVNMDTAVDRVLNSVDGFAFIGDATEIKYAALTNCNLQQVGTEF-SRKPYAIAVQSGHILKDKISSAILMLLNERRLETLKEKWW-TDNPNKVSCPDSSDESDGISIQNIGGVFIV--ILAGIALSIVTLAFE-YYYYKRKARKAAEKEQEE 810          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-7 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q18591])

HSP 1 Score: 95.1301 bits (235), Expect = 6.434e-20
Identity = 100/363 (27.55%), Postives = 170/363 (46.83%), Query Frame = 1
Query: 1312 IFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVML---SKYSPLSAWN----LGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENS-------RVHELLKTS---------NET------------------KFKNM---MSRIILEQNMEGCINKVLNSTNS-ACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPC-NTDLVSSILGLADIGGAFILTAILFGLGTIILCIEFSVYYLVKRKVIKNCDDTISE 2262
            I   K + +  L+  ++ L + VWL CI++  +  FT ++L    ++SP S  N       DI    + S  E LW  + +   QG    P +IS R+V A WWLF  ++   Y+A+L +FLT+S   + +S+LD+L    + +   ++ S       R+ E+ +T          NE+                  KF NM   M    L  NM+  +++VLNS +  A IGDA+ +  +A  NC++  +  E+   +P +    +   +K  +++ I ML+    L+    ++W T +P    C ++   S  + + +IGG FI+  IL G+   I+ + F  YY  KRK  K  +    E
Sbjct:  262 ILMKKADVEYSLFKFMKVLEWPVWL-CIVAAYL--FTSILLWIFDRFSPYSFTNNKERYQNDIE-KRQFSLKECLWFCMTSLTPQGGGEAPKNISGRLVAATWWLFGFIIIASYTANLAAFLTVSRLEQPISSLDDLAKQYKIEYAPIKGSASETYFRRMAEIEETFYNMWKEMSLNESMSPRDRAKLAVWDYPVSDKFTNMWRYMQESKLPVNMDTAVDRVLNSVDGFAFIGDATEIKYAALTNCNLQQVGTEF-SRKPYAIAVQSGHILKDKISSAILMLLNERRLETLKEKWW-TDNPNKVSCPDSSDESDGISIQNIGGVFIV--ILAGIALSIVTLAFE-YYYYKRKARKAAEKEQEE 615          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 80.1073 bits (196), Expect = 3.680e-15
Identity = 91/432 (21.06%), Postives = 178/432 (41.20%), Query Frame = 1
Query: 1033 IRLCISLEEPFIYNVTSTDSETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKS-----LVAIGR---DFGVQYNLQSFYRSETIYWE--------SIQIFAHKPEND-SKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSF------------VENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS-------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQT-------GDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIE 2199
            +R+ + LEEPF+        E     G+ I++L   E  Q +KF  Y         Y IE++       + A+ R   D  +     ++ R+E + +         SI +     E D   LW  L PL   VW+  ++S  I +++  +L+K+SP   +NL      +DE  F            + + W  +G+ + QG D  P + ++R++  +WW+F  ++ + Y+A L +FLT+      + +  +L    + +   +++    +  + S    ++ M S        + +  + EG     + S   A + ++S L     R+C +   I   +D +         + ++ IL+  +  L E  +L+    ++W+        G P  +        +I G+  +    ++ A L   G    CIE
Sbjct:  410 LRVVVYLEEPFVIKTGENQYE-----GFCIDLLN--EMTQVLKFN-YTIIEVQDGTYGIEDESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNL----ERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFFRESKIPMYERMWSVMESSSPGVFVNSSREGIAR--VKSGGYAYMMESSMLEYYLERDCEL-QSIGGLLDSKGYGIALPKGSPLRDILSRTVLQLQERTILEALKNKWWRDRREGPSCGPPPSEKATNSKPQNIFGIFYVLLTGLIVAFLLACGE--YCIE 824          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 78.9518 bits (193), Expect = 8.046e-15
Identity = 90/432 (20.83%), Postives = 179/432 (41.44%), Query Frame = 1
Query: 1033 IRLCISLEEPFIYNVTSTDSETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKS-----LVAIGR---DFGVQYNLQSFYRSETIYWE--------SIQIFAHKPEND-SKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSF------------VENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGC-INKVLNSTNSACIGDASPLIRSA------TRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQT-------GDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIE 2199
            +R+ + LEEPF+          +Q  G+ I++L   E  Q +KF  Y         Y IE++       + A+ R   D  +     ++ R+E + +         SI +     E D   LW  L PL   VW+  ++S  I +++  +L+K+SP   +NL      +DE  F            + + W  +G+ + QG D  P + ++R++  +WW+F  ++ + Y+A L +FLT+      + +  +L    + +   +++    +  + S    ++ M S  ++E +  G  +N           G  + ++ S+       R+C +   I   +D +         + ++ IL+  +  L E  +L+    ++W+        G P  +        +I G+  +    ++ A L   G    CIE
Sbjct:  410 LRVVVYLEEPFVIKTGE-----NQYEGFCIDLLN--EMTQVLKFN-YTIIEVQDGTYGIEDESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNL----ERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFFRESKIPMYERMWS--VMESSSPGVFVNSSREGIARVKSGGYAYMMESSMLEYYLERDCEL-QSIGGLLDSKGYGIALPKGSPLRDILSRTVLQLQERTILEALKNKWWRDRREGPSCGPPPSEKATNSKPQNIFGIFYVLLTGLIVAFLLACGE--YCIE 824          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: KaiR1D (gene:FBgn0038837 transcript:FBtr0083987)

HSP 1 Score: 96.6709 bits (239), Expect = 3.717e-20
Identity = 73/315 (23.17%), Postives = 139/315 (44.13%), Query Frame = 1
Query: 1303 SIQIFAHKP-ENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLS--AWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS-------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSI-----LGLADIGGAFILTAILFGLGTIILCIEF 2202
             + I   KP +    L++ L PL   VW+    + L  +    +L+K++P    A+       +  + + +  +W  IG+ + QG DF P ++S+R+V  IWW F L+M + Y+A+L +FLT+      + + ++L    + +  A++        + S  + ++ M S        +    N EG         + A + +++ +     RNC +   +   +D +        N+  +  +N+ I  L E G L    T++W+      K C  +   S      LGLA++GG F++     G+  +I   EF
Sbjct:  522 GVSILYRKPIKQPPNLFSFLSPLSLDVWIYMATAYLGVSVLLFILAKFTPYEWPAYTDAHGEKVESQFTLLNCMWFAIGSLMQQGCDFLPKALSTRMVAGIWWFFTLIMISSYTANLAAFLTVERMDSPIESAEDLAKQTRIKYGALKGGSTAAFFRDSKISTYQRMWSFMESARPSVFTASNGEGVERVAKGKGSYAFLMESTSIEYVTERNCELT-QVGGMLDTKSYGIATPPNSPYRTAINSVILKLQEEGKLHILKTKWWKEKRGGGK-CRVETSKSSSAANELGLANVGGVFVVLMGGMGVACVIAVCEF 834          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: Grik (gene:FBgn0038840 transcript:FBtr0335016)

HSP 1 Score: 92.8189 bits (229), Expect = 5.443e-19
Identity = 84/330 (25.45%), Postives = 152/330 (46.06%), Query Frame = 1
Query: 1303 SIQIFAHKP-ENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN-----LGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINP-QYQLIAVENSRVHELLKTSNETKFKNMMS------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQT---GDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTI---ILCIEFSVYYLVKRKVI 2235
             I I   KP +   KL++ + P    VWL   L+ +  + +  +L + SP + W+     +     + ++ SF   LW  IGA L QG +  P + S+R V A WW F L++ + Y+A+L +FLT+ S +  ++  D+L  N       A          K SN   ++ M        + +   N EG +++V NS N A + +++ +     R C++   +   +D +        N   +  L+  +  + E GLL K  T++WQ    G    +  ++D  +S LG A++GG +++  +    G+I   + C+  SVY   +   +
Sbjct:  518 GIGILFRKPMKEPPKLFSFMSPFSGEVWLWLGLAYMGVSISMFVLGRLSP-AEWDNPYPCIEEPTELENQFSFANCLWFSIGALLQQGSELAPKAYSTRAVAASWWFFTLILVSSYTANLAAFLTVESLVTPINDADDLSKNKGGVNYGAKIGGATFNFFKESNYPTYQRMYEFMRDNPQYMTNTNQEG-VDRVENS-NYAFLMESTTIEYITERRCTLT-QVGALLDEKGYGIAMRKNWPYRDTLSQAVLEMQEQGLLTKMKTKWWQEKRGGGACSEAPDSD--ASSLGFANLGGVYLVMFVGSCFGSIYGLVNCV-VSVYLRARENKV 840          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: Ir25a (gene:FBgn0031634 transcript:FBtr0336959)

HSP 1 Score: 90.1225 bits (222), Expect = 3.640e-18
Identity = 88/365 (24.11%), Postives = 150/365 (41.10%), Query Frame = 1
Query: 1303 SIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLG---LDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQ-------------------------------------LIAVENSR--VHELLKTSNETKFKNMMSRIILEQNMEGCINKVLNSTNS---ACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEFSVYYLVKRKVIKNCDDTISE 2262
             I I   +P + S L+  L  L  +VWL  + +   ++F   +  ++SP S  N      D     E +  E LW  + +   QG    P ++S R+V A WWLF  ++   Y+A+L +FLT+S     + +LD+L    QY+                                     L AVE S+  V +   +   TK    M    L   ++  + +V NST +   A +GDA+ +      NC +  ++ E    +P +      + +K   NN I  L+    L+K   ++W+  +   K    +  S  + + +IGG FI+  +  G+  I L  E+  Y   K   I +  +  +E
Sbjct:  522 GITIMMQRPSSPSSLFKFLTVLETNVWLCILAAYFFTSFLMWIFDRWSPYSYQNNREKYKDDEEKREFNLKECLWFCMTSLTPQGGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPVESLDDLA--KQYKILYAPLNGSSAMTYFERMSNIEQMFYEIWKDLSLNDSLTAVERSKLAVWDYPVSDKYTKMWQAMQEAKLPATLDEAVARVRNSTAATGFAFLGDATDIRYLQLTNCDL-QVVGEEFSRKPYAIAVQQGSHLKDQFNNAILTLLNKRQLEKLKEKWWKNDEALAKCDKPEDQSDGISIQNIGGVFIVIFVGIGMACITLVFEYWWYRYRKNPRIIDVAEANAE 883          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: Ir25a (gene:FBgn0031634 transcript:FBtr0336960)

HSP 1 Score: 90.1225 bits (222), Expect = 3.653e-18
Identity = 88/365 (24.11%), Postives = 150/365 (41.10%), Query Frame = 1
Query: 1303 SIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLG---LDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQ-------------------------------------LIAVENSR--VHELLKTSNETKFKNMMSRIILEQNMEGCINKVLNSTNS---ACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEFSVYYLVKRKVIKNCDDTISE 2262
             I I   +P + S L+  L  L  +VWL  + +   ++F   +  ++SP S  N      D     E +  E LW  + +   QG    P ++S R+V A WWLF  ++   Y+A+L +FLT+S     + +LD+L    QY+                                     L AVE S+  V +   +   TK    M    L   ++  + +V NST +   A +GDA+ +      NC +  ++ E    +P +      + +K   NN I  L+    L+K   ++W+  +   K    +  S  + + +IGG FI+  +  G+  I L  E+  Y   K   I +  +  +E
Sbjct:  527 GITIMMQRPSSPSSLFKFLTVLETNVWLCILAAYFFTSFLMWIFDRWSPYSYQNNREKYKDDEEKREFNLKECLWFCMTSLTPQGGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPVESLDDLA--KQYKILYAPLNGSSAMTYFERMSNIEQMFYEIWKDLSLNDSLTAVERSKLAVWDYPVSDKYTKMWQAMQEAKLPATLDEAVARVRNSTAATGFAFLGDATDIRYLQLTNCDL-QVVGEEFSRKPYAIAVQQGSHLKDQFNNAILTLLNKRQLEKLKEKWWKNDEALAKCDKPEDQSDGISIQNIGGVFIVIFVGIGMACITLVFEYWWYRYRKNPRIIDVAEANAE 888          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: Ir25a (gene:FBgn0031634 transcript:FBtr0289979)

HSP 1 Score: 90.1225 bits (222), Expect = 3.653e-18
Identity = 88/365 (24.11%), Postives = 150/365 (41.10%), Query Frame = 1
Query: 1303 SIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLG---LDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQ-------------------------------------LIAVENSR--VHELLKTSNETKFKNMMSRIILEQNMEGCINKVLNSTNS---ACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEFSVYYLVKRKVIKNCDDTISE 2262
             I I   +P + S L+  L  L  +VWL  + +   ++F   +  ++SP S  N      D     E +  E LW  + +   QG    P ++S R+V A WWLF  ++   Y+A+L +FLT+S     + +LD+L    QY+                                     L AVE S+  V +   +   TK    M    L   ++  + +V NST +   A +GDA+ +      NC +  ++ E    +P +      + +K   NN I  L+    L+K   ++W+  +   K    +  S  + + +IGG FI+  +  G+  I L  E+  Y   K   I +  +  +E
Sbjct:  527 GITIMMQRPSSPSSLFKFLTVLETNVWLCILAAYFFTSFLMWIFDRWSPYSYQNNREKYKDDEEKREFNLKECLWFCMTSLTPQGGGEAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPVESLDDLA--KQYKILYAPLNGSSAMTYFERMSNIEQMFYEIWKDLSLNDSLTAVERSKLAVWDYPVSDKYTKMWQAMQEAKLPATLDEAVARVRNSTAATGFAFLGDATDIRYLQLTNCDL-QVVGEEFSRKPYAIAVQQGSHLKDQFNNAILTLLNKRQLEKLKEKWWKNDEALAKCDKPEDQSDGISIQNIGGVFIVIFVGIGMACITLVFEYWWYRYRKNPRIIDVAEANAE 888          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: grik1b (glutamate receptor, ionotropic, kainate 1b [Source:ZFIN;Acc:ZDB-GENE-070821-1])

HSP 1 Score: 98.5969 bits (244), Expect = 1.019e-20
Identity = 100/447 (22.37%), Postives = 200/447 (44.74%), Query Frame = 1
Query:  964 VFNNNAWLPVTNASCQAIVDMT------TIRLCISLEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKS--------LVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNM-------MSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            V+N+N  L +T+++     ++T      T+ +   LE P++    S        +  GY +++LK + +     ++V +    +   Y  +N K         L+    D  V     ++ R + I +        I I  HKP   +  +++ L PL   +W+  +L+CL  +    ++++++P   +N      D  +V+   + + ++W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV +       K S  + ++ M        +  +++ N EG I +VL +T+ A + +++ +   + RNC++   I   ID +         +  +  +   I  L E G L     ++W+       P      +S LG+ +IGG FI+ A    L   +   EF
Sbjct:  418 VWNSNTGLNLTDSNKDKNTNVTDSMANRTLIVTTILENPYVMYKKSDKPLYGNDRFEGYCLDLLKELSNILGFSYEVKL---VTDGKYGAQNDKGEWNGMVRELIDHVADLAVAPLTITYVREKVIDFSKPFMTLGISILYHKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLINSVWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDSPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNNREG-IQRVL-TTDYALLMESTSIEYISQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKVTIAILQLQEEGKLHMMKEKWWRGNGC---PEEDSKEASALGVENIGGIFIVLAAGLVLSVFVAIGEF 855          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: grik1b (glutamate receptor, ionotropic, kainate 1b [Source:ZFIN;Acc:ZDB-GENE-070821-1])

HSP 1 Score: 98.5969 bits (244), Expect = 1.123e-20
Identity = 100/447 (22.37%), Postives = 200/447 (44.74%), Query Frame = 1
Query:  964 VFNNNAWLPVTNASCQAIVDMT------TIRLCISLEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKS--------LVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS-------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            V+N+N  L +T+++     ++T      T+ +   LE P++    S        +  GY +++LK + +     ++V +    +   Y  +N K         L+    D  V     ++ R + I +        I I  HKP   +  +++ L PL   +W+  +L+CL  +    ++++++P   +N      D  +V+   + + ++W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV +       K S  + ++ M +         +++ N EG I +VL +T+ A + +++ +   + RNC++   I   ID +         +  +  +   I  L E G L     ++W+       P      +S LG+ +IGG FI+ A    L   +   EF
Sbjct:  379 VWNSNTGLNLTDSNKDKNTNVTDSMANRTLIVTTILENPYVMYKKSDKPLYGNDRFEGYCLDLLKELSNILGFSYEVKL---VTDGKYGAQNDKGEWNGMVRELIDHVADLAVAPLTITYVREKVIDFSKPFMTLGISILYHKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLINSVWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDSPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNNREG-IQRVL-TTDYALLMESTSIEYISQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKVTIAILQLQEEGKLHMMKEKWWRGNGC---PEEDSKEASALGVENIGGIFIVLAAGLVLSVFVAIGEF 816          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: gria4a (glutamate receptor, ionotropic, AMPA 4a [Source:ZFIN;Acc:ZDB-GENE-020125-7])

HSP 1 Score: 94.7449 bits (234), Expect = 1.812e-19
Identity = 91/416 (21.88%), Postives = 172/416 (41.35%), Query Frame = 1
Query: 1102 QLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQ------KSLVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPENDSK-LWNILRPLHYHVWLLCILSCLISAFTGV-----MLSKYSPLSAWNL-----GLDISIVD----EVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS-------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYW-QTGD--PFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEFSVYYLVKRKVIK 2238
            Q  GY +++   I     IK+++ +  +      D E +        LV    +  V     +  R E I +        I I   KP+     +++ L PL Y +W+     C++ A+ GV     ++S++SP   W+      G D    D    E     +LW  +GA + QG DF P S+S R+V  +WW F L++ + Y+A+L +FLT+   +  + + ++L    +     +++    E  + S    ++ M S        +  +   EG      +    A + +++    +  R       +   +D +         + ++  +N  +  L E G+LDK   ++W   G+  P D   + D  S  L L+++ G F +     GL  ++  +EF      + K +K
Sbjct:  436 QFEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWM-----CIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEEGSDGPPSDQPPNEFGIFNSLWFSLGAFMQQGCDFTPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSQLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDS-GSKDKSSQALSLSNVAGVFYILVGGLGLAMLVALVEFCYKSRAEAKKLK 844          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: gria2b (glutamate receptor, ionotropic, AMPA 2b [Source:ZFIN;Acc:ZDB-GENE-020125-4])

HSP 1 Score: 94.3597 bits (233), Expect = 2.098e-19
Identity = 102/457 (22.32%), Postives = 184/457 (40.26%), Query Frame = 1
Query: 1030 TIRLCISLEEPFIYNVTSTD--SETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQ------KSLVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPENDSK-LWNILRPLHYHVWLLCILSCLISAFTGV-----MLSKYSPLSAWNLGL--DISI-----VDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMID----EYI---------------DWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYW-QTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF---SVYYLVKRKVIKNCDD 2250
            T+ +   LE P++    + D   +  +  GY +++   I      K+Q+ +  +      D E +        LV    D  V     +  R E I +        I I   KP+     +++ L PL Y +W+     C++ A+ GV     ++S++SP   W+     D  I      +E     +LW  +GA + QG D  P S+S R+V  +WW F L++ + Y+A+L +FLT+   +  + + ++L    +     +++    E  + S    F  M +       M+G    V   T       A  ++R         Y+++    EYI               D +         +S++  +N  +  L E G LDK   ++W   G+   K   +   +S L L+++ G F +     GL  ++  +EF   S     + KV KN  +
Sbjct:  412 TVIVTTILEAPYVMLKKNADLFMDNERYEGYCVDLAAEIAKHCGFKYQLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWM-----CIVFAYIGVSVVLFLVSRFSPYE-WHTEEYEDGQIQTNESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIALFDKMWTY------MKGAEPSVFVKTT------AEGVMRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRTPVNLAVLKLSEQGTLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALVEFCYKSRAEAKRMKVAKNAQN 850          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: gria2b (glutamate receptor, ionotropic, AMPA 2b [Source:ZFIN;Acc:ZDB-GENE-020125-4])

HSP 1 Score: 93.9745 bits (232), Expect = 2.935e-19
Identity = 102/457 (22.32%), Postives = 185/457 (40.48%), Query Frame = 1
Query: 1030 TIRLCISLEEPFIYNVTSTD--SETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQ------KSLVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPENDSK-LWNILRPLHYHVWLLCILSCLISAFTGV-----MLSKYSPLSAWNLGL--DISI-----VDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMID----EYI---------------DWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYW-QTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF---SVYYLVKRKVIKNCDD 2250
            T+ +   LE P++    + D   +  +  GY +++   I      K+Q+ +  +      D E +        LV    D  V     +  R E I +        I I   KP+     +++ L PL Y +W+     C++ A+ GV     ++S++SP   W+     D  I      +E     +LW  +GA + QG D  P S+S R+V  +WW F L++ + Y+A+L +FLT+   +  + + ++L    +     +++    E  + S    F  M +       M+G    V   T       A  ++R         Y+++    EYI               D +         +S++  +N  +  L E GLLDK   ++W   G+      ++   +S L L+++ G F +     GL  ++  +EF   S     + KV KN  +
Sbjct:  412 TVIVTTILEAPYVMLKKNADLFMDNERYEGYCVDLAAEIAKHCGFKYQLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWM-----CIVFAYIGVSVVLFLVSRFSPYE-WHTEEYEDGQIQTNESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIALFDKMWTY------MKGAEPSVFVKTT------AEGVMRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALVEFCYKSRAEAKRMKVAKNAQN 850          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 100.138 bits (248), Expect = 5.062e-21
Identity = 102/452 (22.57%), Postives = 188/452 (41.59%), Query Frame = 1
Query:  961 KVFNNNAWLPVTNASCQAIVDMTTIRLCISLEEPFIYNVTSTDSETSQLGGYIIEVLKYIESRQPIKFQVYVRQN--FSSCVYDIENQKSLVA---IGR-DFGVQYNLQSFYRSETIYWE------SIQIFAHKPENDSK-LWNILRPLHYHVWLLCILSCLISAFTGV-----MLSKYSPLS----AWNLGLDISIVD---EVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRI------ILEQNMEGCINKVLNSTNSACIGDASPLIRSA------TRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYW-QTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            K    N  L V     + I  + T   CIS    F+ N    +    +  GY +E+   I      K+++ + ++  + +   D++    +V     GR D  V     +  R E I +        I I   KP+     +++ L PL Y +W+     C++ A+ GV     ++S++SP       +  G +    D   E     +LW  +GA + QG D  P S+S R+V  +WW F L++ + Y+A+L +FLT+   +  + + D+L    +     +++    E  K S    F+ M + +      +  +  E  +N+V  S      G  + L+ S        R       +   +D +         + ++  +N  +  L E G+LDK  +++W   G+   K   +   +S L L+++ G F +     GL  ++  IEF
Sbjct:  349 KGRRTNYTLHVLELKHEGIRHVITFSYCIS--HFFLKNADQLEG-NDRFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWM-----CIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPTTDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSK-----GKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSPLRGAVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEF 787          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 98.9821 bits (245), Expect = 1.097e-20
Identity = 95/424 (22.41%), Postives = 180/424 (42.45%), Query Frame = 1
Query: 1051 LEEPFIYNVTSTD--SETSQLGGYIIEVLKYIESRQPIKFQVYVRQN--FSSCVYDIENQKSLVA---IGR-DFGVQYNLQSFYRSETIYWE------SIQIFAHKPENDSK-LWNILRPLHYHVWLLCILSCLISAFTGV-----MLSKYSPLS----AWNLGLDISIVD---EVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRI------ILEQNMEGCINKVLNSTNSACIGDASPLIRSA------TRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYW-QTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            LE P++    + D      +  GY +E+   I      K+++ + ++  + +   D++    +V     GR D  V     +  R E I +        I I   KP+     +++ L PL Y +W+     C++ A+ GV     ++S++SP       +  G +    D   E     +LW  +GA + QG D  P S+S R+V  +WW F L++ + Y+A+L +FLT+   +  + + D+L    +     +++    E  K S    F+ M + +      +  +  E  +N+V  S      G  + L+ S        R       +   +D +         + ++  +N  +  L E G+LDK  +++W   G+   K   +   +S L L+++ G F +     GL  ++  IEF
Sbjct:  415 LEAPYVMLKKNADQLEGNDRFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWM-----CIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPTTDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSK-----GKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSPLRGAVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEF 828          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:100495093])

HSP 1 Score: 97.8265 bits (242), Expect = 2.618e-20
Identity = 96/413 (23.24%), Postives = 184/413 (44.55%), Query Frame = 1
Query: 1051 LEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQ------KSLVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNM------MSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLI----EIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            LEEP++    S       ++  GY I++L+ +      +++V + ++      D   Q      + L+    D  V     ++ R + I +        I I   KP   +  +++ L PL   +W+  +L+ L  +    +++++SP   +N      D  +V+   + + + W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV++       K S    ++ M       S+ +L +N E  I +VL S + A + +++ +     RNC++   I   ID    S  +   T M     ++I + I    E G+L     ++W+       P      +S LG+ +IGG FI+ A    L   +   EF
Sbjct:  401 LEEPYVMFKKSDKPLYGKARFEGYCIDLLEKLSKILGFEYEVRLVEDGKYGAKDDTTQQWNGMVRELMDHKADLAVAPLAITYVREQVIDFTKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVQDGATMTFFKKSRIPTYEKMWAFMNSRSQSVLVKNNEEGIQRVLTS-DYAFLMESTTIEFVTQRNCNLT-QIGGLID----SKGYGVGTPMGSPYRDKITIAILQLQEEGVLHMMKEKWWRGN---GCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEF 804          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 97.8265 bits (242), Expect = 2.659e-20
Identity = 77/326 (23.62%), Postives = 143/326 (43.87%), Query Frame = 1
Query: 1303 SIQIFAHKPENDSK-LWNILRPLHYHVWLLCILSCLISAFTGV-----MLSKYSPLS----AWNLGLDISIVD---EVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRI------ILEQNMEGCINKVLNSTNSACIGDASPLIRSA------TRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYW-QTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
             I I   KP+     +++ L PL Y +W+     C++ A+ GV     ++S++SP       +  G +    D   E     +LW  +GA + QG D  P S+S R+V  +WW F L++ + Y+A+L +FLT+   +  + + D+L    +     +++    E  K S    F+ M + +      +  +  E  +N+V  S      G  + L+ S        R       +   +D +         + ++  +N  +  L E G+LDK  +++W   G+   K   +   +S L L+++ G F +     GL  ++  IEF
Sbjct:  414 GISIMIKKPQKSKPGVFSFLDPLAYEIWM-----CIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPTTDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSK-----GKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSPLRGAVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEF 729          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:100495093])

HSP 1 Score: 97.8265 bits (242), Expect = 2.664e-20
Identity = 96/413 (23.24%), Postives = 184/413 (44.55%), Query Frame = 1
Query: 1051 LEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQ------KSLVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNM------MSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLI----EIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            LEEP++    S       ++  GY I++L+ +      +++V + ++      D   Q      + L+    D  V     ++ R + I +        I I   KP   +  +++ L PL   +W+  +L+ L  +    +++++SP   +N      D  +V+   + + + W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV++       K S    ++ M       S+ +L +N E  I +VL S + A + +++ +     RNC++   I   ID    S  +   T M     ++I + I    E G+L     ++W+       P      +S LG+ +IGG FI+ A    L   +   EF
Sbjct:  439 LEEPYVMFKKSDKPLYGKARFEGYCIDLLEKLSKILGFEYEVRLVEDGKYGAKDDTTQQWNGMVRELMDHKADLAVAPLAITYVREQVIDFTKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVQDGATMTFFKKSRIPTYEKMWAFMNSRSQSVLVKNNEEGIQRVLTS-DYAFLMESTTIEFVTQRNCNLT-QIGGLID----SKGYGVGTPMGSPYRDKITIAILQLQEEGVLHMMKEKWWRGN---GCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEF 842          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Gria1 (glutamate receptor, ionotropic, AMPA1 (alpha 1) [Source:MGI Symbol;Acc:MGI:95808])

HSP 1 Score: 96.2857 bits (238), Expect = 5.473e-20
Identity = 74/321 (23.05%), Postives = 141/321 (43.93%), Query Frame = 1
Query: 1303 SIQIFAHKPENDSK-LWNILRPLHYHVWLLCILSCLISAFTGV-----MLSKYSPLS----AWNLGLDISIVD---EVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS-------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYW-QTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
             I I   KP+     +++ L PL Y +W+     C++ A+ GV     ++S++SP       +  G D +  D   E     +LW  +GA + QG D  P S+S R+V  +WW F L++ + Y+A+L +FLT+   +  + + ++L    +     +E     E  + S    F+ M +        + +    EG I    +    A + +++       R       +   +D +         ++++  +N  +  L E G+LDK  +++W   G+   K   +   +S L L+++ G F +     GL  ++  IEF
Sbjct:  444 GISIMIKKPQKSKPGVFSFLDPLAYEIWM-----CIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEF 759          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Gria1 (glutamate receptor, ionotropic, AMPA1 (alpha 1) [Source:MGI Symbol;Acc:MGI:95808])

HSP 1 Score: 96.2857 bits (238), Expect = 7.013e-20
Identity = 74/321 (23.05%), Postives = 141/321 (43.93%), Query Frame = 1
Query: 1303 SIQIFAHKPENDSK-LWNILRPLHYHVWLLCILSCLISAFTGV-----MLSKYSPLS----AWNLGLDISIVD---EVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS-------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYW-QTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
             I I   KP+     +++ L PL Y +W+     C++ A+ GV     ++S++SP       +  G D +  D   E     +LW  +GA + QG D  P S+S R+V  +WW F L++ + Y+A+L +FLT+   +  + + ++L    +     +E     E  + S    F+ M +        + +    EG I    +    A + +++       R       +   +D +         ++++  +N  +  L E G+LDK  +++W   G+   K   +   +S L L+++ G F +     GL  ++  IEF
Sbjct:  513 GISIMIKKPQKSKPGVFSFLDPLAYEIWM-----CIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEF 828          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 95.9005 bits (237), Expect = 8.245e-20
Identity = 78/325 (24.00%), Postives = 150/325 (46.15%), Query Frame = 1
Query: 1303 SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEFSVYYLVKRKVIKNC 2244
             I I   KP   +  +++ L PL   +W+  +L+CL  +    ++++++P   +N      D  +V+   + + + W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV +       K S  + ++ M +      +  L +N +  I +VL +T+ A + +++ +     RNC++   I   ID +         +  +  +   I  L E G L     ++W+       P      +S LG+ +IGG FI+ A    L   +   EF +Y   K   I+ C
Sbjct:  537 GISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVL-TTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN---GCPEEDSKEASALGVENIGGIFIVLAAGLVLSVFVAIGEF-IYKSRKNNDIEQC 855          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 95.9005 bits (237), Expect = 9.101e-20
Identity = 78/325 (24.00%), Postives = 150/325 (46.15%), Query Frame = 1
Query: 1303 SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEFSVYYLVKRKVIKNC 2244
             I I   KP   +  +++ L PL   +W+  +L+CL  +    ++++++P   +N      D  +V+   + + + W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV +       K S  + ++ M +      +  L +N +  I +VL +T+ A + +++ +     RNC++   I   ID +         +  +  +   I  L E G L     ++W+       P      +S LG+ +IGG FI+ A    L   +   EF +Y   K   I+ C
Sbjct:  552 GISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVL-TTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN---GCPEEDSKEASALGVENIGGIFIVLAAGLVLSVFVAIGEF-IYKSRKNNDIEQC 870          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik2 (glutamate receptor, ionotropic, kainate 2 (beta 2) [Source:MGI Symbol;Acc:MGI:95815])

HSP 1 Score: 94.7449 bits (234), Expect = 1.964e-19
Identity = 95/414 (22.95%), Postives = 183/414 (44.20%), Query Frame = 1
Query: 1051 LEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQ------KSLVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS-------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLI----EIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            LEEP++    S        +  GY I++L+ + +     +++ + ++      D  N       + L+    D  V     ++ R + I +        I I   KP   +  +++ L PL   +W+  +L+ L  +    +++++SP   +N      D  +V+   + + + W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AVE+       K S  + +  M +        ++++ N EG I +VL S + A + +++ +     RNC++   I   ID    S  +   T M     ++I + I    E G L     ++W+       P      +S LG+ +IGG FI+ A    L   +   EF
Sbjct:  439 LEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEG-IQRVLTS-DYAFLMESTTIEFVTQRNCNLT-QIGGLID----SKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN---GCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEF 842          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|Q38PU3|GRIK2_MACFA (Glutamate receptor ionotropic, kainate 2 OS=Macaca fascicularis OX=9541 GN=GRIK2 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 2.715e-20
Identity = 96/414 (23.19%), Postives = 183/414 (44.20%), Query Frame = 1
Query: 1051 LEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQ------KSLVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNM-------MSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLI----EIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            LEEP++    S        +  GY I++L+ + +     +++ + ++      D  N       + L+    D  V     ++ R + I +        I I   KP   +  +++ L PL   +W+  +L+CL  +    +++++SP   +N      D  +V+   + + + W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AVE+       K S  + +  M          ++++ N EG I +VL S + A + +++ +     RNC++   I   ID    S  +   T M     ++I + I    E G L     ++W+       P      +S LG+ +IGG FI+ A    L   +   EF
Sbjct:  439 LEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMRQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEG-IQRVLTS-DYAFLMESTTIEFVTQRNCNLT-QIGGLID----SKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN---GCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEF 842          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|P23818|GRIA1_MOUSE (Glutamate receptor 1 OS=Mus musculus OX=10090 GN=Gria1 PE=1 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 4.906e-19
Identity = 74/321 (23.05%), Postives = 141/321 (43.93%), Query Frame = 1
Query: 1303 SIQIFAHKPENDSK-LWNILRPLHYHVWLLCILSCLISAFTGV-----MLSKYSPLS----AWNLGLDISIVD---EVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS-------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYW-QTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
             I I   KP+     +++ L PL Y +W+     C++ A+ GV     ++S++SP       +  G D +  D   E     +LW  +GA + QG D  P S+S R+V  +WW F L++ + Y+A+L +FLT+   +  + + ++L    +     +E     E  + S    F+ M +        + +    EG I    +    A + +++       R       +   +D +         ++++  +N  +  L E G+LDK  +++W   G+   K   +   +S L L+++ G F +     GL  ++  IEF
Sbjct:  513 GISIMIKKPQKSKPGVFSFLDPLAYEIWM-----CIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEF 828          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|Q38PU4|GRIK1_MACFA (Glutamate receptor ionotropic, kainate 1 OS=Macaca fascicularis OX=9541 GN=GRIK1 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.081e-19
Identity = 100/446 (22.42%), Postives = 201/446 (45.07%), Query Frame = 1
Query:  964 VFNNNAWLPVTNASCQAIVDMT------TIRLCISLEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKS--------LVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            ++N+N+ L +T+++     ++T      T+ +   LEEP++    S        +  GY +++LK + +   I   +Y  +      Y  +N K         L+    D  V     ++ R + I +        I I   KP   +  +++ L PL   +W+  +L+CL  +    ++++++P   +N      D  +V+   + + + W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV +       K S  + ++ M +      +  L +N +  I +VL +T+ A + +++ +     RNC++   I   ID +         +  +  +   I  L E G L     ++W+ G+   +  N +  +S LG+ +IGG FI+ A    L   +   EF
Sbjct:  420 IWNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSN---ILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVL-TTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWR-GNGCPEEDNKE--ASALGVENIGGIFIVLAAGLVLSVFVAIGEF 857          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|P39086|GRIK1_HUMAN (Glutamate receptor ionotropic, kainate 1 OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 5.732e-19
Identity = 100/446 (22.42%), Postives = 201/446 (45.07%), Query Frame = 1
Query:  964 VFNNNAWLPVTNASCQAIVDMT------TIRLCISLEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKS--------LVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            ++N+N+ L +T+++     ++T      T+ +   LEEP++    S        +  GY +++LK + +   I   +Y  +      Y  +N K         L+    D  V     ++ R + I +        I I   KP   +  +++ L PL   +W+  +L+CL  +    ++++++P   +N      D  +V+   + + + W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV +       K S  + ++ M +      +  L +N +  I +VL +T+ A + +++ +     RNC++   I   ID +         +  +  +   I  L E G L     ++W+ G+   +  N +  +S LG+ +IGG FI+ A    L   +   EF
Sbjct:  420 IWNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSN---ILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVL-TTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWR-GNGCPEEDNKE--ASALGVENIGGIFIVLAAGLVLSVFVAIGEF 857          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|Q13002|GRIK2_HUMAN (Glutamate receptor ionotropic, kainate 2 OS=Homo sapiens OX=9606 GN=GRIK2 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 9.693e-19
Identity = 95/414 (22.95%), Postives = 182/414 (43.96%), Query Frame = 1
Query: 1051 LEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQ------KSLVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNM-------MSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLI----EIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            LEEP++    S        +  GY I++L+ + +     +++ + ++      D  N       + L+    D  V     ++ R + I +        I I   KP   +  +++ L PL   +W+  +L+ L  +    +++++SP   +N      D  +V+   + + + W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AVE+       K S  + +  M          ++++ N EG I +VL S + A + +++ +     RNC++   I   ID    S  +   T M     ++I + I    E G L     ++W+       P      +S LG+ +IGG FI+ A    L   +   EF
Sbjct:  439 LEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEG-IQRVLTS-DYAFLMESTTIEFVTQRNCNLT-QIGGLID----SKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN---GCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEF 842          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A267FSX5 (PBPe domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017883g2 PE=4 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 5.592e-50
Identity = 116/404 (28.71%), Postives = 204/404 (50.50%), Query Frame = 1
Query: 1030 TIRLCISLEEPFIYNVTSTDSETSQLGGYIIEVLKYIESRQPIKFQVYVRQN------------FSSCVYDIENQKSLVAIG---------RDFGVQYNLQSFYRSETIYWESIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSI--LGLADIGGAFILTAILFG 2172
            TIR+C +   PF     +  ++T  +GG + +VL  + +R   ++ V V  +            FS CV ++  Q+ +V+IG         RD  V +       S  ++ E+  I   +P  +SKLWN+  P  Y VW+L I+   + A    +L+ +SP SA+NL L+ +I DE+   E +WS +G+ + QGQDFYP+++S R VLA WW+F +++   Y+ DLT+ LTIS     + TL +L+     + +  E + +  LL +S    ++ +  ++++   + GCI +       AC+ D + L+  A  NCS VY+ DE  +   ++FM+  +      ++ + + + E G++ K    YW +    D  C++   +    + L   GG FI+    +G
Sbjct:  156 TIRICSTEILPFTIYRQTFPNKTVIVGGMLKDVLDILAARLDFRYSVKVPDDGQWGGPQAGKSYFSGCVGEV--QRGIVSIGGSTFTKTAIRDSVVDF-------STPLFQEANGILVPRPPPESKLWNVYAPFKYDVWILVIIFIFVCAAVTWVLAYFSPFSAYNLRLEFAIADEIWLQEYIWSIVGSFMQQGQDFYPFAMSPRAVLAFWWMFTVIIYGTYTGDLTAHLTISFTDLPIKTLSDLVAQSAVKPLVPEGTNLDTLLSSSTGGVYRQVADKMLMSDTLPGCIEQTFQG-KEACLTDYTALLYVARANCSKVYIADEIFNTATVAFMYPEDAYFGANIDFQFQKMHETGIMQKLFNTYWSS----DAVCSSGSSTEADSINLEGSGGCFIVALAFYG 545          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A267H134 (PBPe domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017883g1 PE=3 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 1.606e-48
Identity = 115/404 (28.47%), Postives = 204/404 (50.50%), Query Frame = 1
Query: 1030 TIRLCISLEEPFIYNVTSTDSETSQLGGYIIEVLKYIESRQPIKFQVYVRQN------------FSSCVYDIENQKSLVAIG---------RDFGVQYNLQSFYRSETIYWESIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSI--LGLADIGGAFILTAILFG 2172
            TIR+C +   PF     +  ++T  +GG + +VL  + +R   ++ V V  +            FS CV ++  Q+ +V+IG         RD  V +       S  ++ E+  I   +P  +SKLWN+  P  Y VW+L I+   + A    +L+ +SP +A+NL L+ +I DE+   E +WS +G+ + QGQDFYP+++S R VLA WW+F +++   Y+ DLT+ LTIS     + TL +L+     + +  E + +  LL +S    ++ +  ++++   + GCI +       AC+ D + L+  A  NCS VY+ DE  +   ++FM+  +      ++ + + + E G++ K    YW +    D  C++   +    + L   GG FI+    +G
Sbjct:  354 TIRICSTEILPFTIYRQTFPNKTVIVGGMLKDVLDILAARLDFRYSVKVPDDGQWGGPQAGKSYFSGCVGEV--QRGIVSIGGSTFTKTAIRDSVVDF-------STPLFQEANGILVPRPPPESKLWNVYAPFKYDVWILVIIFIFVCAAVTWVLAYFSPFTAYNLRLEFAIADEIWLQEYIWSIVGSFMQQGQDFYPFAMSPRAVLAFWWMFTVIIYGTYTGDLTAHLTISFTDLPIKTLSDLVAQSAVKPLVPEGTNLDTLLSSSTGGVYRQVADKMLMSDTLPGCIEQTFQG-KEACLTDYTALLYVARANCSKVYIADEIFNTATVAFMYPEDAYFGANIDFQFQKMHETGIMQKLFNTYWSS----DAVCSSGSSTEADSINLEGSGGCFIVALAFYG 743          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A1I8HAM9 (CCHC-type domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 6.149e-46
Identity = 110/376 (29.26%), Postives = 191/376 (50.80%), Query Frame = 1
Query: 1096 TSQLGGYIIEVLKYIESRQPIKFQVYV------------RQNFSSCVYDIENQKSLVAIG---------RDFGVQYNLQSFYRSETIYWESIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSI--LGLADIGGAFIL 2154
            T  +GG + +VL  + +R   ++ V V            R  FS CV ++  Q+ +V+IG         RD  V +       S  ++ E+  I   +P  +SKLWN+  P  Y VW+L I+   +SA    +L+ +SP +A+NL L+ +  DE+   E +WS +G+ + QGQDFYP+++S R VLA WW+F +++   Y+ DLT+ LTIS     + TL +L+     + +  E + ++ LL TS    ++ +  ++ +   +  CI +       AC+ D + L+ +A  NCS VY+ DE  +   ++FM+  +      ++ + + + E G++ K    YW +    D  C+T   +    + L   GG FI+
Sbjct:  954 TVLVGGMLKDVLDILAARLDFRYSVKVPDDGQWGGPQAGRSYFSGCVGEV--QRGIVSIGGSTFTKSTTRDGVVDF-------STPLFQEAYGILVPRPPPESKLWNVYAPFKYDVWILVIIFIFVSAAVTWVLAYFSPFTAYNLRLEFAFADEIWLQEYIWSIVGSFMQQGQDFYPFAMSPRAVLAFWWMFTVIIYGTYTGDLTAHLTISFTDLPIKTLSDLVAQSAVKPLVPEGTNLYNLLTTSTGGVYRQVADKLQISDTIPECIEQTFQG-KEACLTDYTALLYAARANCSKVYIADEIFNSATVAFMYPEDAYFGANIDFQFQKMHETGIMQKLFNTYWSS----DAVCSTGSFAEADSINLEGSGGCFIV 1315          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A1I8J1L9 (PBPe domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 1.596e-41
Identity = 97/333 (29.13%), Postives = 165/333 (49.55%), Query Frame = 1
Query: 1186 FSSCVYDIENQKSLVAIG-------RDFGVQYNLQSFYRSETIYWESIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCN--TDLVSSILGLADIGGAFILT 2157
            F+ CV +++  +  VA G       RD  + +++  F        ES  I   +P  +SKLW +  P    VWL  + +  ++ F   +L+ +SP +A+NL L+ +I DEV   E LWS IG+ L QGQDFYP+++SSR  +A WWL  +++   ++ DLT+ LT++     + TLD+L    + +   +  + +H LL  +    +K +   ++     + C     N  N AC+ D + L+  A +NC+  Y+ +E     P++ M   +     + N  ++ L E G L +W   YW +    D  C+  +   +  + L   GG FI T
Sbjct:   37 FNGCVGELQRGEVSVAAGPFTITAARDEVIDFSVPLFE-------ESNAILLPRPAPESKLWRVFSPFTMSVWLSIVAALFVTTFATWVLAYFSPFTAYNLNLEFAIADEVWLQEYLWSAIGSFLQQGQDFYPFAMSSRTAMAFWWLLSVIICGAFNGDLTAHLTVTVTHYPIKTLDDLTGQTEIRPYVIAGTSLHTLLLNAESGVYKKITESMVELGPYDDCPTDPPNP-NQACLTDYTYLLNIARKNCTQFYLAEELFLTAPIALMLPDDAFYAELFNFHMQKLHETGQLQRWFQLYWSS----DSVCSVGSSAETDAISLESAGGCFIAT 357          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A1I8JJ64 (Lig_chan-Glu_bd domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 1.691e-41
Identity = 100/302 (33.11%), Postives = 156/302 (51.66%), Query Frame = 1
Query: 1180 QNFSSCVYDIENQKSLVAIGRDFGVQYNLQSF---YRSETIYWESIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKVLNSTN--SACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQT 2070
            Q FS C+ +++N K+ +A+   F V  NL+     Y  + +Y  S  I    P   SK+WN+  P+   VWLL   S  I  F   +L+ +SP SAWNL L  +  DEV + E LWS IG+ L QGQDFYP+++S R V+  WWL  +++   Y+ DLT+ L  S     + TL++L+  P Y  +    + +H  +  +       + S  +L Q+ E C  K+L STN  + CI D    +  A + C  +Y+ DEY ++  L++    +      +N  I+   E GL+D    +Y+ T
Sbjct:   52 QRFSGCIGELQNGKADLAV--VFAVT-NLRYAVVDYLDDYLY-SSNNILVRIPPPASKIWNVFTPMTLQVWLLLAASIFIVPFIIYLLALFSPFSAWNLKLSFAFADEVWYKEYLWSTIGSFLQQGQDFYPFAMSPRTVMVFWWLLTVIIFGAYTGDLTAHLATSVSSLTIRTLEDLVSMPYYTALVPRGTNIHTAIDMATSGPMFQLKSMTVLVQSHEDCARKLLASTNPYTVCIADQKSNLYFANQFCEKMYVADEYFNFYYLAWPVPKDAFYADAMNLIIRRAKENGLVDMLRLKYFPT 349          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: grik1b (glutamate receptor ionotropic, kainate 1 [Source:NCBI gene;Acc:103021580])

HSP 1 Score: 98.5969 bits (244), Expect = 8.174e-21
Identity = 99/432 (22.92%), Postives = 192/432 (44.44%), Query Frame = 1
Query:  991 VTNASCQAIVDMTTIRLCISLEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKS--------LVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNM-------MSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            VT++     + +TTI     LE P++    S        +  GY +++LK + +     ++V +    S   Y  +N K         L+    D  V     ++ R + I +        I I  HKP   +  +++ L PL   +W+  +L+CL  +    ++++++P   +N      D  +V+   + + ++W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV +       K S  + ++ M        +  +++ N EG I +VL +T+ A + +++ +   + RNC++   I   ID +         +  +  +   I  L E G L     ++W+       P      +S LG+ +IGG FI+ A    L   +   EF
Sbjct:  370 VTDSMANRTLIVTTI-----LENPYVMYKKSDKPLYGNDRFEGYCLDLLKELSNILGFSYEVKL---VSDGKYGAQNDKGEWNGMVRELIDHVADLAVAPLTITYVREKVIDFSKPFMTLGISILYHKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLINSVWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDSPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNNREG-IQRVL-TTDYALLMESTSIEYISQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKVTIAILQLQEEGKLHMMKEKWWRGNGC---PEEDSKEASALGVENIGGIFIVLAAGLVLSVFVAIGEF 787          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: grik1b (glutamate receptor ionotropic, kainate 1 [Source:NCBI gene;Acc:103021580])

HSP 1 Score: 98.5969 bits (244), Expect = 9.303e-21
Identity = 99/432 (22.92%), Postives = 192/432 (44.44%), Query Frame = 1
Query:  991 VTNASCQAIVDMTTIRLCISLEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKS--------LVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS-------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            VT++     + +TTI     LE P++    S        +  GY +++LK + +     ++V +    S   Y  +N K         L+    D  V     ++ R + I +        I I  HKP   +  +++ L PL   +W+  +L+CL  +    ++++++P   +N      D  +V+   + + ++W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV +       K S  + ++ M +         +++ N EG I +VL +T+ A + +++ +   + RNC++   I   ID +         +  +  +   I  L E G L     ++W+       P      +S LG+ +IGG FI+ A    L   +   EF
Sbjct:  410 VTDSMANRTLIVTTI-----LENPYVMYKKSDKPLYGNDRFEGYCLDLLKELSNILGFSYEVKL---VSDGKYGAQNDKGEWNGMVRELIDHVADLAVAPLTITYVREKVIDFSKPFMTLGISILYHKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLINSVWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDSPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNNREG-IQRVL-TTDYALLMESTSIEYISQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKVTIAILQLQEEGKLHMMKEKWWRGN---GCPEEDSKEASALGVENIGGIFIVLAAGLVLSVFVAIGEF 827          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: grik1b (glutamate receptor ionotropic, kainate 1 [Source:NCBI gene;Acc:103021580])

HSP 1 Score: 98.2117 bits (243), Expect = 1.139e-20
Identity = 99/432 (22.92%), Postives = 192/432 (44.44%), Query Frame = 1
Query:  991 VTNASCQAIVDMTTIRLCISLEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKS--------LVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS-------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            VT++     + +TTI     LE P++    S        +  GY +++LK + +     ++V +    S   Y  +N K         L+    D  V     ++ R + I +        I I  HKP   +  +++ L PL   +W+  +L+CL  +    ++++++P   +N      D  +V+   + + ++W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV +       K S  + ++ M +         +++ N EG I +VL +T+ A + +++ +   + RNC++   I   ID +         +  +  +   I  L E G L     ++W+       P      +S LG+ +IGG FI+ A    L   +   EF
Sbjct:  422 VTDSMANRTLIVTTI-----LENPYVMYKKSDKPLYGNDRFEGYCLDLLKELSNILGFSYEVKL---VSDGKYGAQNDKGEWNGMVRELIDHVADLAVAPLTITYVREKVIDFSKPFMTLGISILYHKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLINSVWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDSPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNNREG-IQRVL-TTDYALLMESTSIEYISQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKVTIAILQLQEEGKLHMMKEKWWRGNGC---PEEDSKEASALGVENIGGIFIVLAAGLVLSVFVAIGEF 839          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: grik1b (glutamate receptor ionotropic, kainate 1 [Source:NCBI gene;Acc:103021580])

HSP 1 Score: 98.2117 bits (243), Expect = 1.139e-20
Identity = 99/432 (22.92%), Postives = 192/432 (44.44%), Query Frame = 1
Query:  991 VTNASCQAIVDMTTIRLCISLEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKS--------LVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS-------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            VT++     + +TTI     LE P++    S        +  GY +++LK + +     ++V +    S   Y  +N K         L+    D  V     ++ R + I +        I I  HKP   +  +++ L PL   +W+  +L+CL  +    ++++++P   +N      D  +V+   + + ++W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV +       K S  + ++ M +         +++ N EG I +VL +T+ A + +++ +   + RNC++   I   ID +         +  +  +   I  L E G L     ++W+       P      +S LG+ +IGG FI+ A    L   +   EF
Sbjct:  422 VTDSMANRTLIVTTI-----LENPYVMYKKSDKPLYGNDRFEGYCLDLLKELSNILGFSYEVKL---VSDGKYGAQNDKGEWNGMVRELIDHVADLAVAPLTITYVREKVIDFSKPFMTLGISILYHKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLINSVWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDSPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNNREG-IQRVL-TTDYALLMESTSIEYISQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKVTIAILQLQEEGKLHMMKEKWWRGNGC---PEEDSKEASALGVENIGGIFIVLAAGLVLSVFVAIGEF 839          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: grik1b (glutamate receptor ionotropic, kainate 1 [Source:NCBI gene;Acc:103021580])

HSP 1 Score: 98.2117 bits (243), Expect = 1.147e-20
Identity = 99/432 (22.92%), Postives = 192/432 (44.44%), Query Frame = 1
Query:  991 VTNASCQAIVDMTTIRLCISLEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKS--------LVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS-------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            VT++     + +TTI     LE P++    S        +  GY +++LK + +     ++V +    S   Y  +N K         L+    D  V     ++ R + I +        I I  HKP   +  +++ L PL   +W+  +L+CL  +    ++++++P   +N      D  +V+   + + ++W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV +       K S  + ++ M +         +++ N EG I +VL +T+ A + +++ +   + RNC++   I   ID +         +  +  +   I  L E G L     ++W+       P      +S LG+ +IGG FI+ A    L   +   EF
Sbjct:  354 VTDSMANRTLIVTTI-----LENPYVMYKKSDKPLYGNDRFEGYCLDLLKELSNILGFSYEVKL---VSDGKYGAQNDKGEWNGMVRELIDHVADLAVAPLTITYVREKVIDFSKPFMTLGISILYHKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLINSVWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDSPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNNREG-IQRVL-TTDYALLMESTSIEYISQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKVTIAILQLQEEGKLHMMKEKWWRGN---GCPEEDSKEASALGVENIGGIFIVLAAGLVLSVFVAIGEF 771          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 4.049e-20
Identity = 73/296 (24.66%), Postives = 142/296 (47.97%), Query Frame = 1
Query: 1303 SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS-----RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTA 2160
             I I   KP   +  +++ L PL   +W+  +L+ L  +    +++++SP   +N      D  +V+   + + + W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      +S+ D+L    + +  AV +       K S  + ++ M +     +  L +N E  I +VL +T+ A + +++ +     RNC++   I   ID +         +  +  +   I  L E G L     ++W+     ++  N    +S LG+ +IGG FI+ A
Sbjct:   37 GISILYRKPNGTNPGIFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTMLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADDLAKQTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQTALIKNNEEGIQRVL-TTDYAMLMESTNIEYVTQRNCNLT-QIGGLIDNKGYGIGTPLGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDSNE---ASALGVQNIGGIFIVLA 327          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 84.3445 bits (207), Expect = 2.695e-17
Identity = 78/363 (21.49%), Postives = 148/363 (40.77%), Query Frame = 1
Query: 1303 SIQIFAHKPENDSK-LWNILRPLHYHVWLLCILSCLISAFTGV-----MLSKYSPLSAWNLGLDISI-------------------------------VDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNM-------MSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSAT------RNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYW-QTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEFSVYYLVKRKVIK 2238
             I I   KP+     + + L PL Y +W+     C+I A+ GV     ++S++SP   W    D  +                                +E     +LW  +GA + QG +  P S+S R+V  +WW F L++ + Y+A+L +FLT+   +  + + D+L    +     +++    E  + S    ++ M         ++ +  N +G +++V  S      G  + L+ S T      R       +   +D +         ++++  +N  +  L E GLLDK   ++W   G+      ++   +S L L+++ G F +     GL  ++  IEF      + K +K
Sbjct:  137 GISIMIKKPQKSKPGVISFLDPLAYEIWM-----CIIFAYIGVSVVLFLVSRFSPYE-WQRDDDTDVEPNGNGGAGGGGGGGGSGGGAGGGSGGGGEPPNEFGIFNSLWFSLGAFMQQGCEISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFQRSKIGVYEKMWLFMKDAEPKVFVRTNADG-VSRVRKSK-----GKYAYLLESTTNEYTEQRKPCDTMKVGGNLDSKGYGIATPKGSALRDAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRTEAKRMK 487          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002503.1 (pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:ENSPMAG00000002286.1 transcript:ENSPMAT00000002503.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 1.024e-12
Identity = 37/148 (25.00%), Postives = 77/148 (52.03%), Query Frame = 1
Query: 1498 SFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIV 1923
            + + +LW  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV +       K S  + ++ M +      +  L +N E  I++ L +T+ A + +++ +     R C++ 
Sbjct:   24 TMLNSLWFGVGALMQQGSELMPRALSTRIVGGIWWFFTLILISSYTANLAAFLTVERMESPIGSADDLAKQTKIEYGAVRDGSTMTFFKKSRISTYEKMWAFMSSRHQTALVKNNEEGIHRAL-TTDFAMLMESTTIEHVTQRYCNLT 170          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007790.1 (pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-1 gene:ENSPMAG00000007047.1 transcript:ENSPMAT00000007790.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 1.868e-12
Identity = 55/258 (21.32%), Postives = 111/258 (43.02%), Query Frame = 1
Query: 1312 IFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDE----VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKVLNSTNSAC---IGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYW 2064
            I   K  N+ +++  L PL+  +W+  + +C   +    +LS   P   ++L     +  E     + V + W    A + QG D  P S++ ++++  WW F+LV+ + Y+A+L +FLT + G   + +L +L      +       R+   L +S    +  +   I   + M     K L     A    IG+AS +  +   +C ++ + D       L+  F   + +   ++  +  L + G L +   Q++
Sbjct:   18 IMKGKEVNEPRIFQFLEPLNTLLWISMLSACAGISVVLFVLSLLHPDEWYHLAKRKLVSREQGQSFNLVNSFWFVFSAMVKQGSDPLPLSMAGKIIVYTWWCFVLVVCSTYTANLAAFLT-AEGQTSIRSLKDLTRQMDARYGTYSGYRIVGFLNSSARDPYMTVWRHIRDNRTMVASPKKGLEQAEKAGYIFIGEASAVFTAKKDHCDLI-ISDRRFFRHRLALPFPPGSRLAAEVSRAVTELEDSGQLAELERQWF 273          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000621.1 (pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 gene:ENSPMAG00000000562.1 transcript:ENSPMAT00000000621.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.4546 bits (132), Expect = 7.805e-9
Identity = 45/215 (20.93%), Postives = 97/215 (45.12%), Query Frame = 1
Query: 1054 EEPFIYNVTSTDSETSQLGGYIIEVLKYIESRQPIKFQVYVRQN-----------FSSCVYDIENQKSLVAIGRDFGVQYNLQSFYRSETIYWE-SIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTI 1662
            EEPF+    +   +  +  G+ ++V+  +       +++++  +           +S  + ++ N+++ VAI     +    +S       Y + S+ + A +P + + L+ +L PL    W    L+  +      +L++ +P                S   +LW   G+ + QG +    S+S+R+V+ +WWLF  ++ + Y+A LT+ LTI
Sbjct:    3 EEPFVMLAENVLGKPKKFQGFSVDVMDALSKSLGFSYEIFMPADLSYGLPQADGTWSGMIGELLNKRADVAISA-LTITPERESVVDFTKRYMDYSVGVAARRPADSAGLFALLSPLEPATWACLGLAVGLVGLLVYLLNRVTPRR--------EPRHSPSLPASLWLVYGSFMQQGPELSSSSLSARLVMGVWWLFAFIVVSSYTASLTALLTI 208          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 90.1225 bits (222), Expect = 1.531e-18
Identity = 95/431 (22.04%), Postives = 183/431 (42.46%), Query Frame = 1
Query: 1015 IVDMTTIRLCISLEEPFIYNVTSTDSETSQ---LGGYIIEVLKYIESRQPIKFQVY------------VRQNFSSCVYDIENQKSLVAIGRDFGVQYNLQSFYRSETIYWES--IQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLD----------ISIVDEVSFVENLWSYIGASLMQGQD-FYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNM-----MSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMF--ATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
            I++  T+++    E PFI+  T T+ +      + GY IE+L+ +      KF+VY            V + ++  V ++ N ++ +A+     +    Q        Y +     +    P  +   + ILRP  Y +W+    + +I  F   + S +SP   +   +           + + D +S V  LWS +   + Q  D  +P S S R+ +A++W  +L++ + Y+A+L +FLTI      +S++D+L          V NS+     ++++   F  M          +  + EG I KV+N  N A I D++ L   A    S   +I     +  + + F  A ++     L+N I  L   G ++  + ++ +  D   +        + L   D+ G FI+     G+  ++L +E+
Sbjct:  440 ILENRTLKVVTIAEAPFIFAQTQTNGQGETRVIIEGYCIELLRKLSEMLRFKFEVYLVPDNNFGAQDPVTKEWNGVVREVLNGRADLAV-TSLTISPERQKVIDFTQPYMDLGLTVLIKPDPTEEKNPFAILRPFRYDLWMAIGGTMIIVGFFLWLFSTFSPFGFYGRCVQKCHTKIEPRYLKLHDTLSLVRALWSTVVYYVGQSSDHLHPVSSSGRITVAVYWFAMLIVMSTYTANLAAFLTIKRFTSPISSVDDLARQKDISYGTVLNSQPQAFFESASVPSFVTMWQYMRYHHTFVNNSAEG-IEKVMNE-NYAFIWDSAVLEFVAHNQISCGTLITSGSVFGRIGYGFGLAKDSPYTKQLSNAILQLRHAGYMEFLDRKWLKANDKCAEAAEKAKSENQLTFEDLSGVFIVLIAGIGVSCVVLVLEW 867          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 76.2554 bits (186), Expect = 3.198e-14
Identity = 78/302 (25.83%), Postives = 132/302 (43.71%), Query Frame = 1
Query: 1282 SETIYWESIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSFVENLWSYIGASLMQG-QDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDEL-LINPQYQLI--AVENSRVHELLKTSNE-TKFKNMMSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSI-----VYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVS-SILGLADIGGAFIL 2154
            S+   ++ + I   K E  + L + LRP   H+WLL +LS  I A    +L ++SP   + L         ++    +W   G  L  G  +  P S S+RV+  +W  F +++   Y+A+L +FL +      +S +D+  L NP  Q I   V NS V    +   E +     M    ++   EG I KV N    A I D+  L   A+++C++     ++    Y    P    ++   S+ I+         E G++++  T +          CNT+  S + LGL  + G FI+
Sbjct:  514 SKPFKYQGLTILVKKNEQSNSLDSFLRPFQIHLWLLVLLSVHIVAVILYLLDRFSPFGRFKLARKEKEETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPKAVVSGIDDPNLRNPSKQFIYATVANSSVDAYFRRQVELSSMYTFMEGYNVKTAKEG-IEKVKNGELKAFIWDSPVLYYEASKDCTLTTAGELFGRSGYGIGMPKGSPWSNAISLAIL------NFHESGVMEELETTWIDASK-----CNTENTSPATLGLQHMLGVFIM 803          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO46633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU4])

HSP 1 Score: 74.7146 bits (182), Expect = 8.137e-14
Identity = 92/461 (19.96%), Postives = 185/461 (40.13%), Query Frame = 1
Query:  988 PVTNASCQAIVDMTTIRLCISLEEPFIYNVTSTDSETSQLGGYIIEVLKYIESRQPIKFQVY------------VRQNFSSCVYDIENQKSLVAIGRDFGVQYNLQSFYRSETIYWESIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAW-------NLGLDISIVDE---VSFVENLWSYIGASLMQGQDF-YPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEG----CINKVLNSTNSACIGDASPLIRSATRN--CSIVYMIDEYIDWQPL-----SFMFATNTSMKIILNNEIKMLIEIG----LLDKWNTQYWQTGDPFDKPCNTDLVS---SILGLADIGGAFILTAILFGLGTIILCIEF--SVYYLVKRKVIKN 2241
            P T    + ++   TIR+      PF   V +  S   +  G +I++L  +       + +Y            V  N+   + ++  +++ +A+G      +  +    ++      I +      +    +  L P    +W+    + L       + S  SP   +       N  +  S + +   +SF+ ++WS     L QG D  +P S S R  +A+WW  I ++   Y+A++ +FLT +     +  +++L    +     VENS      ++S+  +++ M   + L ++++      I + L     A I DA P++    R   C  + +I  Y D +        F     +    +L+ EI  L++ G    ++++W  +      P D+    D  S   S +G+ ++ G FI       +G ++L +E+  + Y  VKR   K 
Sbjct:  367 PGTPRDSENVLADRTIRVVSFKGSPFTMPVGNVSSSVDRFEGAVIDLLDRLSEILHFNYTIYMSPDGRVGVENPVTGNWDGVINELIQERADLAVGPITITSHRWKVIDFTQPFMTSGIGVVMGTENSPKPYFRFLEPFKSDLWITIFGAVLGMGVVNWLFSVVSPFGFYGRCVQSINKRVKKSYLKQKYSLSFLNSIWSSAAYYLGQGPDGNHPVSASGRAAVAVWWFVITILGATYTANMAAFLTTTRMQTPIRRIEDLSSQTEIAYGCVENSLTQNFFQSSSVQRYQMMWEYMKLRRSLQPDTYTAIERTLKG-KYAFIHDA-PILEYLARKTYCGRIKLIGGY-DTRTFGNAHYGFALPKKSPYTNLLSVEILKLVQSGIAKTMIEEWMIERTPCA-PLDEAEEQDAKSSDTSKMGINNMLGVFIFMVAGIAIGGVLLLLEWFVAAYSDVKRDKRKR 823          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO41293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J7])

HSP 1 Score: 70.0922 bits (170), Expect = 4.107e-13
Identity = 75/299 (25.08%), Postives = 130/299 (43.48%), Query Frame = 1
Query: 1345 LWNILRPLHYHVWLLCILSCLISAFTGVM--LSKYSPLS----AWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRI-ILEQNMEGCINKVLNSTNS--ACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCN-TDLVSS----ILGLADIGGAFILTAILFGLGTIILCIE 2199
            L+  L P    +W  C L  ++ A T +M  L ++SP      A N G      DE S   +LW   G+ L QG D  P S S RV+ A +WLF L++ + Y+A+L +F T  +    +++L++L+    ++    +   +    + S    +K M  ++  L   ++G    V  S  +  A + D   L     R      ++   +D +  +     N+     ++  I  L E G +++   ++W   D   + CN  D V S     L L  + G FI+     G+  +IL +E
Sbjct:    1 LFAFLMPFQKDLWACCCL--VVGAVTILMWILDRFSPYGFRAEAKNTGEGEG--DEFSLPNSLWFATGSILQQGGDNTPRSGSGRVLAASFWLFTLILISTYTANLAAFFTAQNSKSTINSLEDLVAQDVFKYGVQQGGSLFSFFEKSKVRIYKKMFGKMSTLNTFVKGTDEGVNRSRTTPFAYLTDQPSLDYYNQRKPCNTMLVKNLLDAKSYALGLQRNSEWTDGISVAILQLREEGEVERIRYKWW---DAMSE-CNLKDAVVSNQPMSLELHHLAGVFIILGGGAGISLVILLME 291          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 66.2402 bits (160), Expect = 1.831e-11
Identity = 73/308 (23.70%), Postives = 128/308 (41.56%), Query Frame = 1
Query: 1306 IQIFAHKPENDS-KLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIV---DEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMK-KLSTLDELLINPQYQLIAVENSRVHELLKTSN----ETKFKNMMSRIILEQNMEGCINKVLNSTNS--ACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCI 2196
            I +   +P  +   L+  L P    +WL  +    + +     L ++SP   +    + S     DE S   +LW  + + L QG D  P S S RV+ A +WLF L++ + Y+A+L ++ T   G++ K+++L++L+     +    E   +      S      T F+ M S+   E  + G    VL +     A + D   L     R      ++   +D +  +     N+    +++  I  L E G ++K   ++W          +TD     L L  + G FI   IL G  TI L +
Sbjct:  104 IAMILQQPTGEEVNLFAFLLPFDEKLWLTTLGVVGLVSLIVWFLDRFSP-QGYKTQAEKSGEGEGDEFSLSNSLWFAVASILQQGGDNTPRSTSGRVLAAAFWLFTLILISTYTANLAAYFTGERGIRSKINSLEDLVSQSTVKYGVQEGGSLFTFFSESKVDIYATMFQQMKSQ---ETFVNGTQYGVLKARTQPFAYLTDQPSLDYYNMRKPCNTMLVKNLLDAKSYALAMRRNSEWTNLISVAILELREEGEIEKSRLRWWDDSSECPTGPSTDSSPQRLELHSLAGVFI---ILGGGATISLVL 404          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: grik1b (glutamate ionotropic receptor kainate type subunit 1 [Source:NCBI gene;Acc:101173645])

HSP 1 Score: 98.2117 bits (243), Expect = 1.429e-20
Identity = 76/312 (24.36%), Postives = 149/312 (47.76%), Query Frame = 1
Query: 1303 SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRI-------ILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF 2202
             I I  HKP   +  +++ L PL   +W+  +L+CL  +    ++++++P   +N      D  +V+   + + ++W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV +       K S  + ++ M + +       +++ N EG I +VL +T+ A + +++ +   + RNC++   I   ID +         +  +  +   I  L E G L     ++W+       P      +S LG+ +IGG FI+ A    L   +   EF
Sbjct:  526 GISILYHKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLINSVWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDSPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNNREG-IQRVL-TTDYALLMESTSIEYISQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKVTIAILQLQEEGKLHMMKEKWWRGNGC---PEEDSKEASALGVENIGGIFIVLAAGLVLSVFVAIGEF 831          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:101173029])

HSP 1 Score: 95.9005 bits (237), Expect = 7.360e-20
Identity = 91/406 (22.41%), Postives = 181/406 (44.58%), Query Frame = 1
Query: 1030 TIRLCISLEEPFIYNVTSTDS--ETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQ------KSLVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWN---LGLDISIVDE-VSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNET------KFKNMMSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLI----EIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTA 2160
            ++R+   LEEP++    S        +  GY I++L+ +      ++++ + ++      D          + L+    D  V     ++ R + I +        I I   KP   +  +++ L PL   +W+  +L+CL  +    +++++SP   +N      D  +V+   + + + W  +GA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    +     VE+       K +  +      +F N   + ++ +N+E  I +VL S + A + +++ +     RNC++   I   ID    S  +   T M     ++I + I    E G L     ++W+       P      +S LG+ +IGG FI+ A
Sbjct:  435 SLRVSTILEEPYVMFKKSDKPLYGNDRFEGYCIDLLRELSGILGFRYELRLVEDGKYGALDESTGQWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLACLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIPYGVVEDGATMTFFKKTKISTYDKMWEFMNSRRQSVMVKNVEEGIQRVLTS-DYAFLMESTTIEFVTQRNCNLT-QIGGLID----SRAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN---GCPEEESKEASALGVQNIGGIFIVLA 831          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: grik1a (glutamate receptor ionotropic, kainate 1 [Source:NCBI gene;Acc:101173326])

HSP 1 Score: 94.7449 bits (234), Expect = 1.626e-19
Identity = 101/447 (22.60%), Postives = 199/447 (44.52%), Query Frame = 1
Query:  991 VTNASCQAIVDMTTIRLCISLEEPFIYNVTSTDSE---TSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKS--------LVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPEN-DSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGL----DISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNM-------MSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEFSVYYLVKRKVIKNC 2244
            VT++     + +TTI     LE P++  V  +D E     +  GY +++LK + +     ++V +        Y  +N K         L+    D  V     ++ R + I +        I I   KP   +  +++ L PL   +W+  +L+C   +    ++++++P   +N          + +  + + + W  IGA + QG +  P ++S+R+V  IWW F L++ + Y+A+L +FLT+      + + D+L    + +  AV +       K S  + ++ M        +  +++ N EG I +VL +T+ A + +++ +   + RNC++   I   ID +         +  +  +   I  L E G L     ++W+ G+   +  N +  +S LG+ +IGG FI+ A    L   +   EF +Y   +   I+ C
Sbjct:  372 VTDSLANRTLIVTTI-----LENPYVM-VRKSDKELVGNDRYEGYCMDLLKELSNILGFTYEVRL---VGDGKYGAQNDKGEWNGMVRELIEHVADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACTGVSCVLFVIARFTPYEWYNPHPCNPSSTLVQNNFTLLNSFWFGIGALMRQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMDAPIDSADDLAKQSRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNNKEG-ITRVL-TTDYAMLMESTSIEYISQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKVTIAILQLQEEGKLHMMKEKWWR-GNGCPEEDNKE--ASALGVENIGGIFIVLAAGLVLSVFVAIGEF-IYKARRNADIEEC 802          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: gria2b (glutamate ionotropic receptor AMPA type subunit 2 [Source:NCBI gene;Acc:101168274])

HSP 1 Score: 94.3597 bits (233), Expect = 2.345e-19
Identity = 98/444 (22.07%), Postives = 183/444 (41.22%), Query Frame = 1
Query: 1030 TIRLCISLEEPFIYNVTSTD--SETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQ------KSLVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPENDSK-LWNILRPLHYHVWLLCILSCLISAFTGV-----MLSKYSPLSAWNLGL--DISI-----VDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS-------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSA------TRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYW-QTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEFSVYYLVKRKVIK 2238
            T+ +   LE P++    + D   +  +  GY +++   I      K+Q+ +  +      D E +        LV    D  V     +  R E I +        I I   KP+     +++ L PL Y +W+     C++ A+ GV     ++S++SP   W+     D  I      +E     +LW  +GA + QG D  P S+S R+V  +WW F L++ + Y+A+L +FLT+   +  + + ++L    +     +++    E  + S    F  M +        + ++   EG + +V  S      G  + L+ S        R       +   +D +         +S++  +N  +  L E G+LDK   ++W   G+   K   +   +S L L+++ G F +     GL  ++  IEF      + K +K
Sbjct:  412 TVIVTTILEAPYVMLKKNADLFVDNERYEGYCVDLAAEIAKHCGFKYQLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWM-----CIVFAYIGVSVVLFLVSRFSPYE-WHTEEYEDGQIQTNESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIALFDKMWTYMRSAEPSVFVKTTAEG-VQRVRKSK-----GKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRTPVNLAVLKLSEQGVLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMK 843          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: gria2b (glutamate ionotropic receptor AMPA type subunit 2 [Source:NCBI gene;Acc:101168274])

HSP 1 Score: 93.5893 bits (231), Expect = 3.770e-19
Identity = 101/451 (22.39%), Postives = 186/451 (41.24%), Query Frame = 1
Query: 1030 TIRLCISLEEPFIYNVTSTD--SETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQ------KSLVAIGRDFGVQYNLQSFYRSETIYWE------SIQIFAHKPENDSK-LWNILRPLHYHVWLLCILSCLISAFTGV-----MLSKYSPLSAWNLGL--DISI-----VDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMS-------RIILEQNMEGCINKVLNSTNSACIGDASPLIRSA------TRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYW-QTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEF---SVYYLVKRKVIKNCDD 2250
            T+ +   LE P++    + D   +  +  GY +++   I      K+Q+ +  +      D E +        LV    D  V     +  R E I +        I I   KP+     +++ L PL Y +W+     C++ A+ GV     ++S++SP   W+     D  I      +E     +LW  +GA + QG D  P S+S R+V  +WW F L++ + Y+A+L +FLT+   +  + + ++L    +     +++    E  + S    F  M +        + ++   EG + +V  S      G  + L+ S        R       +   +D +         +S++  +N  +  L E GLLDK   ++W   G+      ++   +S L L+++ G F +     GL  ++  IEF   S     + KV KN  +
Sbjct:  412 TVIVTTILEAPYVMLKKNADLFVDNERYEGYCVDLAAEIAKHCGFKYQLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWM-----CIVFAYIGVSVVLFLVSRFSPYE-WHTEEYEDGQIQTNESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIALFDKMWTYMRSAEPSVFVKTTAEG-VQRVRKSK-----GKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKNAQN 850          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000081862.1 (SMESG000081862.1)

HSP 1 Score: 1408.66 bits (3645), Expect = 0.000e+0
Identity = 699/728 (96.02%), Postives = 699/728 (96.02%), Query Frame = 1
Query:   82 MFAKCGFILWIISSFRCSAINIGVLVNEAKFNSALIEERLQYQFKEANLTDQISAQIYAVNKLGCDCSLRLTIGNGLFNNSLIFAIVSDMKLSIYVSNLKQNQPLIIPINVSSKGFINQQLLMSVSQLILSNNDWIILVTNQTLSFCLDLHRIILKILCVDVTEISSNFDKIDEFMMQTVKGKLYKIMLVTDSKNVSTQLFLSAKKNDLMTSLYQWILIGKSCDVWNHQQSMNLSVICNAENLISELSLANDIFQNTQRYLQNMDANFEFISTSSLVLLQYGKCFNQSSFYLSKVFNNNAWLPVTNASCQAIVDMTTIRLCISLEEPFIYNVTSTDSETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKSLVAIGRDFGVQYNLQSFYRSETIYWESIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEFSVYYLVKRKVIKNCDDTISES 2265
            MFAKCGFILWIISSFRCSAINIGVLVNEAKFNSALIEERLQYQFKEANLTDQISAQIYAVNKLGCDCSLRLTIGNGLFNNSLIFAIVSDMKLSIYVSNLKQNQPLIIPINVSSK                             LSFCLDLHRIILKILCVDVTEISSNFDKIDEFMMQTVKGKLYKIMLVTDSKNVSTQLFLSAKKNDLMTSLYQWILIGKSCDVWNHQQSMNLSVICNAENLISELSLANDIFQNTQRYLQNMDANFEFISTSSLVLLQYGKCFNQSSFYLSKVFNNNAWLPVTNASCQAIVDMTTIRLCISLEEPFIYNVTSTDSETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKSLVAIGRDFGVQYNLQSFYRSETIYWESIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEFSVYYLVKRKVIKNCDDTISES
Sbjct:    1 MFAKCGFILWIISSFRCSAINIGVLVNEAKFNSALIEERLQYQFKEANLTDQISAQIYAVNKLGCDCSLRLTIGNGLFNNSLIFAIVSDMKLSIYVSNLKQNQPLIIPINVSSKA----------------------------LSFCLDLHRIILKILCVDVTEISSNFDKIDEFMMQTVKGKLYKIMLVTDSKNVSTQLFLSAKKNDLMTSLYQWILIGKSCDVWNHQQSMNLSVICNAENLISELSLANDIFQNTQRYLQNMDANFEFISTSSLVLLQYGKCFNQSSFYLSKVFNNNAWLPVTNASCQAIVDMTTIRLCISLEEPFIYNVTSTDSETSQLGGYIIEVLKYIESRQPIKFQVYVRQNFSSCVYDIENQKSLVAIGRDFGVQYNLQSFYRSETIYWESIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKVLNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGTIILCIEFSVYYLVKRKVIKNCDDTISES 700          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000018611.1 (SMESG000018611.1)

HSP 1 Score: 209.534 bits (532), Expect = 3.287e-60
Identity = 125/385 (32.47%), Postives = 204/385 (52.99%), Query Frame = 1
Query: 1090 SETSQLGGYIIEVLKYIESRQPIKFQVYVRQ---------NFSSCVYDIENQKSLVAIGRDFGVQYNLQSFYRSETIYWESIQI-FAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKVL--NSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCN---TDLVSSILGLADIGGAFILTAILFGLGTIILCIE 2199
            +ET+ L   I++ L+   S + + ++   +Q          F+ C+ ++  +K++ + G  + +      F      Y E   +    KP   SK+W++LRPL + VW+L ++S    +      SK+SPLSAWNL L+ +I+DEV   EN W+ IG+  MQGQDFYP+ ISSR+VLAIWW+  L++ + YSADLTSFLT+      +S ++EL       +I  + + +   L  S+   ++ +  R I   N++ C  K+L  +STN  CI D S +      NC  VYM+ E  +   L F+   ++  K ++++ I++L+E GL+ KW  +YW+  +   + C+    D  +  +    I G  ILT  LF  G +   IE
Sbjct:    5 NETTGLVPMILQGLEKFLSFKALIYEAPDKQFGTKIGNSSKFTGCIGEVLEKKTVFSAGM-YTLTSQRNEFVDFSNPYMEESNVPLLRKPLRSSKIWHVLRPLQFSVWMLILVSVAFVSLCCFSFSKFSPLSAWNLNLNFAIIDEVKLKENTWNVIGSLFMQGQDFYPFCISSRIVLAIWWIHALIIFSAYSADLTSFLTVQEKNNFISDINELANRKDLYIIVPKGTNIDSSLAESHNAVYQELNRRKITIDNVDDCPKKILLPSSTNLVCISDRSGMRYVTNMNCKDVYMVPEIFNIAALGFVLEKDSPYKNMIDSYIQILVENGLITKWVRKYWEDDEVTSRNCDGTEGDNSAEPIDFEGIFGICILTCSLFVCGLLFFIIE 388          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000018611.1 (SMESG000018611.1)

HSP 1 Score: 218.009 bits (554), Expect = 1.025e-58
Identity = 120/342 (35.09%), Postives = 196/342 (57.31%), Query Frame = 1
Query: 1183 NFSSCVYDIENQKSLVAIGRDFGVQYNLQSFYR-SETIYWESIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKV--LNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNT---DLVSSILGLADIGGAFILTAILFGLGTIIL 2190
            NF+ CV ++ N+K+  A G  F      Q F   S  I  ES      KP+  +K+W+I RP ++ VWLL I +  + ++   + SKY+PLSA+NL L+ +IVDE+   E+LW+ IG  ++QGQDFYPY++S+R+VLAIWWLF L++ + Y+ADLTSFLT+S G   LS+LD L      +++  + + +  LL  S    ++ + SR I    ++ C  K+  L+ST+  CI D S ++ +  + CS++Y + E  +  PL F+   +   K  ++  I+ L+E G++ +W   YW+T     + C     +  +  + L  + GA+I+T I   L  ++ 
Sbjct:  604 NFTGCVGELLNKKATFAAGA-FTFTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNSLLSSLDALAARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVVF 944          

HSP 2 Score: 203.371 bits (516), Expect = 5.786e-54
Identity = 111/330 (33.64%), Postives = 180/330 (54.55%), Query Frame = 1
Query: 1186 FSSCVYDIENQKSLVAIGRDFGVQYNLQSFYRSETIYWESIQI-FAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKVL--NSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAIL 2166
            F+ C+ ++  +K++ + G  + +      F      Y E   +    KP   SK+W++LRPL + VW+L ++S    +      SK+SPLSAWNL L+ +I+DEV   EN W+ IG+  MQGQDFYP+ ISSR+VLAIWW+  L++ + YSADLTSFLT+      +S ++EL       +I  + + +   L  S+   ++ +  R I   N++ C  K+L  +STN  CI D S +      NC  VYM+ E  +   L F+   ++  K ++++ I++L+E GL+ KW  +YW+  +   + C+     +     D  G F +  I+
Sbjct:   46 FTGCIGEVLEKKTVFSAGM-YTLTSQRNEFVDFSNPYMEESNVPLLRKPLRSSKIWHVLRPLQFSVWMLILVSVAFVSLCCFSFSKFSPLSAWNLNLNFAIIDEVKLKENTWNVIGSLFMQGQDFYPFCISSRIVLAIWWIHALIIFSAYSADLTSFLTVQEKNNFISDINELANRKDLYIIVPKGTNIDSSLAESHNAVYQELNRRKITIDNVDDCPKKILLPSSTNLVCISDRSGMRYVTNMNCKDVYMVPEIFNIAALGFVLEKDSPYKNMIDSYIQILVENGLITKWVRKYWEDDEVTSRNCDGTEGDNSAEPIDFEGIFGICVII 374          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000018611.1 (SMESG000018611.1)

HSP 1 Score: 213.772 bits (543), Expect = 2.406e-57
Identity = 113/310 (36.45%), Postives = 182/310 (58.71%), Query Frame = 1
Query: 1183 NFSSCVYDIENQKSLVAIGRDFGVQYNLQSFYR-SETIYWESIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKV--LNSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTD 2103
            NF+ CV ++ N+K+  A G  F      Q F   S  I  ES      KP+  +K+W+I RP ++ VWLL I +  + ++   + SKY+PLSA+NL L+ +IVDE+   E+LW+ IG  ++QGQDFYPY++S+R+VLAIWWLF L++ + Y+ADLTSFLT+S G   LS+LD L      +++  + + +  LL  S    ++ + SR I    ++ C  K+  L+ST+  CI D S ++ +  + CS++Y + E  +  PL F+   +   K  ++  I+ L+E G++ +W   YW+T     + C  +
Sbjct:  604 NFTGCVGELLNKKATFAAGA-FTFTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNSLLSSLDALAARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAE 912          

HSP 2 Score: 203.371 bits (516), Expect = 6.142e-54
Identity = 111/330 (33.64%), Postives = 180/330 (54.55%), Query Frame = 1
Query: 1186 FSSCVYDIENQKSLVAIGRDFGVQYNLQSFYRSETIYWESIQI-FAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKVL--NSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEIGLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAIL 2166
            F+ C+ ++  +K++ + G  + +      F      Y E   +    KP   SK+W++LRPL + VW+L ++S    +      SK+SPLSAWNL L+ +I+DEV   EN W+ IG+  MQGQDFYP+ ISSR+VLAIWW+  L++ + YSADLTSFLT+      +S ++EL       +I  + + +   L  S+   ++ +  R I   N++ C  K+L  +STN  CI D S +      NC  VYM+ E  +   L F+   ++  K ++++ I++L+E GL+ KW  +YW+  +   + C+     +     D  G F +  I+
Sbjct:   46 FTGCIGEVLEKKTVFSAGM-YTLTSQRNEFVDFSNPYMEESNVPLLRKPLRSSKIWHVLRPLQFSVWMLILVSVAFVSLCCFSFSKFSPLSAWNLNLNFAIIDEVKLKENTWNVIGSLFMQGQDFYPFCISSRIVLAIWWIHALIIFSAYSADLTSFLTVQEKNNFISDINELANRKDLYIIVPKGTNIDSSLAESHNAVYQELNRRKITIDNVDDCPKKILLPSSTNLVCISDRSGMRYVTNMNCKDVYMVPEIFNIAALGFVLEKDSPYKNMIDSYIQILVENGLITKWVRKYWEDDEVTSRNCDGTEGDNSAEPIDFEGIFGICVII 374          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000069533.1 (SMESG000069533.1)

HSP 1 Score: 191.43 bits (485), Expect = 4.034e-52
Identity = 101/283 (35.69%), Postives = 163/283 (57.60%), Query Frame = 1
Query: 1183 NFSSCVYDIENQKSLVAIG-------RDFGVQYNLQSFYRSETIYWESIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVMLSKYSPLSAWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSRVVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIAVENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKVL--NSTNSACIGDASPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILN 2004
            NF+ C+ DI N+K+L           R+ GV +       +   + ES         ++SK+WN+ RPLH+  WL+ ++S + +++   +LS YSPLSAWNL L  +++DE+   E++W+ +G+ LMQGQDFYPYS+SSR VLAIWW+F +V+ + Y+ADLTSFLT+ +    + +L+EL      ++I  + +     L+ SN T FK + SRI   + ++ C   ++  NST+  CI D S L     + CS +Y++ E  D   + F    +   K +++
Sbjct:  297 NFTGCIGDIFNKKTLFGASLFTINAMRNEGVDF-------TAPFFEESNSALLRFSTSNSKIWNVFRPLHWSTWLMILVSTIFASYVSYILSCYSPLSAWNLKLSFTVLDEIRLREHIWNIVGSFLMQGQDFYPYSMSSRTVLAIWWIFTVVIFSTYTADLTSFLTVKTDEHYIHSLEELASRKDLKIIVEDGTSTAIFLQNSNYTVFKELYSRIQYIRAIDECPKLIMEGNSTHLVCIADTSSLTYVIRQFCSQIYIVPETFDSGNIGFPVQNDAPFKPLMD 572          
The following BLAST results are available for this feature:
BLAST of PBPe domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK12.019e-2022.61glutamate ionotropic receptor kainate type subunit... [more]
GRIK12.329e-2022.61glutamate ionotropic receptor kainate type subunit... [more]
GRIA19.692e-2023.05glutamate ionotropic receptor AMPA type subunit 1 ... [more]
GRIA19.776e-2023.05glutamate ionotropic receptor AMPA type subunit 1 ... [more]
GRIK11.023e-1922.42glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glr-75.969e-2024.15GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-76.336e-2024.15GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-76.434e-2027.55GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-43.680e-1521.06GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-48.046e-1520.83GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KaiR1D3.717e-2023.17gene:FBgn0038837 transcript:FBtr0083987[more]
Grik5.443e-1925.45gene:FBgn0038840 transcript:FBtr0335016[more]
Ir25a3.640e-1824.11gene:FBgn0031634 transcript:FBtr0336959[more]
Ir25a3.653e-1824.11gene:FBgn0031634 transcript:FBtr0336960[more]
Ir25a3.653e-1824.11gene:FBgn0031634 transcript:FBtr0289979[more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grik1b1.019e-2022.37glutamate receptor, ionotropic, kainate 1b [Source... [more]
grik1b1.123e-2022.37glutamate receptor, ionotropic, kainate 1b [Source... [more]
gria4a1.812e-1921.88glutamate receptor, ionotropic, AMPA 4a [Source:ZF... [more]
gria2b2.098e-1922.32glutamate receptor, ionotropic, AMPA 2b [Source:ZF... [more]
gria2b2.935e-1922.32glutamate receptor, ionotropic, AMPA 2b [Source:ZF... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf3ip25.062e-2122.57TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
traf3ip21.097e-2022.41TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
GRIK22.618e-2023.24glutamate receptor, ionotropic, kainate 2 [Source:... [more]
traf3ip22.659e-2023.62TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
GRIK22.664e-2023.24glutamate receptor, ionotropic, kainate 2 [Source:... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gria15.473e-2023.05glutamate receptor, ionotropic, AMPA1 (alpha 1) [S... [more]
Gria17.013e-2023.05glutamate receptor, ionotropic, AMPA1 (alpha 1) [S... [more]
Grik18.245e-2024.00glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik19.101e-2024.00glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik21.964e-1922.95glutamate receptor, ionotropic, kainate 2 (beta 2)... [more]
back to top
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q38PU3|GRIK2_MACFA2.715e-2023.19Glutamate receptor ionotropic, kainate 2 OS=Macaca... [more]
sp|P23818|GRIA1_MOUSE4.906e-1923.05Glutamate receptor 1 OS=Mus musculus OX=10090 GN=G... [more]
sp|Q38PU4|GRIK1_MACFA5.081e-1922.42Glutamate receptor ionotropic, kainate 1 OS=Macaca... [more]
sp|P39086|GRIK1_HUMAN5.732e-1922.42Glutamate receptor ionotropic, kainate 1 OS=Homo s... [more]
sp|Q13002|GRIK2_HUMAN9.693e-1922.95Glutamate receptor ionotropic, kainate 2 OS=Homo s... [more]
back to top
BLAST of PBPe domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FSX55.592e-5028.71PBPe domain-containing protein (Fragment) OS=Macro... [more]
A0A267H1341.606e-4828.47PBPe domain-containing protein (Fragment) OS=Macro... [more]
A0A1I8HAM96.149e-4629.26CCHC-type domain-containing protein OS=Macrostomum... [more]
A0A1I8J1L91.596e-4129.13PBPe domain-containing protein OS=Macrostomum lign... [more]
A0A1I8JJ641.691e-4133.11Lig_chan-Glu_bd domain-containing protein OS=Macro... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grik1b8.174e-2122.92glutamate receptor ionotropic, kainate 1 [Source:N... [more]
grik1b9.303e-2122.92glutamate receptor ionotropic, kainate 1 [Source:N... [more]
grik1b1.139e-2022.92glutamate receptor ionotropic, kainate 1 [Source:N... [more]
grik1b1.139e-2022.92glutamate receptor ionotropic, kainate 1 [Source:N... [more]
grik1b1.147e-2022.92glutamate receptor ionotropic, kainate 1 [Source:N... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005084.14.049e-2024.66pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
gria1b2.695e-1721.49glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
ENSPMAT00000002503.11.024e-1225.00pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:E... [more]
ENSPMAT00000007790.11.868e-1221.32pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-... [more]
ENSPMAT00000000621.17.805e-920.93pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 ... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO302031.531e-1822.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355453.198e-1425.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466338.137e-1419.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412934.107e-1325.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412911.831e-1123.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grik1b1.429e-2024.36glutamate ionotropic receptor kainate type subunit... [more]
GRIK27.360e-2022.41glutamate receptor ionotropic, kainate 2 [Source:N... [more]
grik1a1.626e-1922.60glutamate receptor ionotropic, kainate 1 [Source:N... [more]
gria2b2.345e-1922.07glutamate ionotropic receptor AMPA type subunit 2 ... [more]
gria2b3.770e-1922.39glutamate ionotropic receptor AMPA type subunit 2 ... [more]
back to top
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081862.10.000e+096.02SMESG000081862.1[more]
SMESG000018611.13.287e-6032.47SMESG000018611.1[more]
SMESG000018611.11.025e-5835.09SMESG000018611.1[more]
SMESG000018611.12.406e-5736.45SMESG000018611.1[more]
SMESG000069533.14.034e-5235.69SMESG000069533.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016909 ID=SMED30016909|Name=PBPe domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2349bp
GTAAATGATTCAATAAAATATTCATTCTGATTGGTTAAAAAGTACATAAG
AAGAAAATGCAAGAAATTAATTCATTAAATTATGTTTGCAAAATGTGGCT
TTATTCTATGGATAATTTCCAGTTTCCGATGCTCAGCAATAAATATCGGG
GTTTTGGTCAATGAGGCTAAGTTCAATTCTGCTCTTATCGAAGAAAGGTT
ACAATACCAATTCAAAGAAGCAAATCTCACAGATCAAATTTCTGCTCAAA
TTTATGCAGTGAATAAATTGGGTTGCGATTGTTCGTTGCGCTTGACAATT
GGTAATGGTCTTTTCAACAATTCTCTCATTTTTGCAATCGTATCTGACAT
GAAACTTTCCATATATGTCAGTAATTTAAAACAAAACCAACCGTTGATAA
TTCCAATCAATGTCAGTTCAAAGGGGTTCATAAACCAACAATTGCTCATG
AGCGTATCCCAGCTGATTCTCTCAAATAATGATTGGATCATATTAGTGAC
CAATCAAACACTGTCATTTTGCCTTGATTTACACAGAATTATTTTGAAAA
TTCTCTGCGTTGATGTGACAGAAATCTCATCAAATTTCGACAAAATAGAT
GAATTTATGATGCAGACCGTGAAGGGGAAATTGTACAAAATTATGTTGGT
AACCGATTCCAAAAATGTCTCCACTCAGTTGTTTTTGTCGGCTAAGAAAA
ACGATCTCATGACTTCATTGTATCAGTGGATTTTGATAGGAAAATCTTGT
GATGTTTGGAATCACCAACAGTCTATGAATCTCTCAGTTATCTGCAATGC
TGAAAATCTAATTTCCGAATTAAGTTTAGCCAACGATATTTTTCAAAATA
CACAAAGGTATCTGCAAAATATGGACGCCAACTTCGAATTTATATCAACG
AGTTCATTAGTATTATTGCAATATGGAAAATGTTTTAATCAGTCCTCGTT
TTATCTCTCAAAAGTCTTCAATAACAATGCATGGCTTCCAGTAACAAATG
CATCCTGCCAAGCAATCGTAGATATGACAACTATTAGATTATGTATTTCA
TTGGAAGAGCCATTCATTTACAATGTTACTAGTACTGATTCAGAAACATC
CCAACTCGGAGGATACATAATTGAAGTTCTGAAATACATTGAGTCTCGAC
AACCAATAAAATTCCAGGTGTATGTTCGGCAAAACTTTTCCTCTTGTGTT
TATGATATTGAGAATCAAAAATCTCTCGTTGCAATAGGAAGAGATTTTGG
TGTACAATATAATCTGCAAAGTTTCTACCGCTCTGAAACAATTTACTGGG
AATCTATTCAGATATTTGCTCATAAACCAGAAAACGATTCCAAATTATGG
AACATCCTTAGACCTTTGCATTATCATGTTTGGTTGTTGTGCATTTTGAG
CTGCTTGATTTCGGCCTTCACAGGTGTAATGTTATCAAAATACAGTCCTT
TATCTGCTTGGAATTTAGGTTTGGATATTTCGATAGTTGATGAGGTGTCG
TTTGTGGAGAATCTTTGGAGTTACATTGGCGCCTCTTTGATGCAAGGTCA
AGATTTTTATCCATACTCAATTTCATCGAGAGTTGTATTAGCAATATGGT
GGCTTTTTATTTTAGTTATGTCAAATGTGTATTCAGCTGATTTAACTTCA
TTTCTAACCATTTCTAGTGGCATGAAAAAATTATCAACTTTGGATGAATT
ATTAATTAATCCTCAATACCAATTAATTGCTGTAGAAAATTCAAGAGTTC
ATGAATTACTGAAAACATCAAATGAAACGAAATTCAAAAATATGATGTCT
AGAATAATATTGGAACAAAACATGGAAGGTTGCATTAATAAAGTTCTAAA
TTCAACAAATTCTGCTTGCATTGGAGATGCGAGTCCTCTCATCAGATCTG
CCACCAGAAATTGTTCTATTGTTTATATGATAGATGAATATATAGATTGG
CAACCTCTTTCATTCATGTTTGCAACGAATACTTCAATGAAAATCATATT
AAATAATGAGATCAAAATGCTAATAGAAATAGGATTATTAGACAAATGGA
ACACCCAATATTGGCAGACTGGAGATCCATTTGACAAACCATGTAACACT
GATTTGGTTTCTTCAATTCTCGGATTGGCCGATATAGGGGGAGCATTTAT
TTTAACTGCTATTCTATTTGGCTTGGGAACTATTATTTTGTGTATAGAAT
TTTCCGTTTATTATTTAGTGAAAAGAAAAGTGATCAAAAATTGTGATGAT
ACCATTAGTGAATCTTGACTAAGATAAATTTTACACTGAGGTTCTGTTAT
TTGCACATTGTTTATAATTGATTATAAATAAAGAGTTTATGTTTTCTTT
back to top

protein sequence of SMED30016909-orf-1

>SMED30016909-orf-1 ID=SMED30016909-orf-1|Name=SMED30016909-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=729bp
MFAKCGFILWIISSFRCSAINIGVLVNEAKFNSALIEERLQYQFKEANLT
DQISAQIYAVNKLGCDCSLRLTIGNGLFNNSLIFAIVSDMKLSIYVSNLK
QNQPLIIPINVSSKGFINQQLLMSVSQLILSNNDWIILVTNQTLSFCLDL
HRIILKILCVDVTEISSNFDKIDEFMMQTVKGKLYKIMLVTDSKNVSTQL
FLSAKKNDLMTSLYQWILIGKSCDVWNHQQSMNLSVICNAENLISELSLA
NDIFQNTQRYLQNMDANFEFISTSSLVLLQYGKCFNQSSFYLSKVFNNNA
WLPVTNASCQAIVDMTTIRLCISLEEPFIYNVTSTDSETSQLGGYIIEVL
KYIESRQPIKFQVYVRQNFSSCVYDIENQKSLVAIGRDFGVQYNLQSFYR
SETIYWESIQIFAHKPENDSKLWNILRPLHYHVWLLCILSCLISAFTGVM
LSKYSPLSAWNLGLDISIVDEVSFVENLWSYIGASLMQGQDFYPYSISSR
VVLAIWWLFILVMSNVYSADLTSFLTISSGMKKLSTLDELLINPQYQLIA
VENSRVHELLKTSNETKFKNMMSRIILEQNMEGCINKVLNSTNSACIGDA
SPLIRSATRNCSIVYMIDEYIDWQPLSFMFATNTSMKIILNNEIKMLIEI
GLLDKWNTQYWQTGDPFDKPCNTDLVSSILGLADIGGAFILTAILFGLGT
IILCIEFSVYYLVKRKVIKNCDDTISES*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0005216ion channel activity
GO:0004872receptor activity
GO:0004970ionotropic glutamate receptor activity
GO:0099583neurotransmitter receptor activity involved in regulation of postsynaptic cytosolic calcium ion concentration
GO:1904315transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential
GO:0004971AMPA glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR001508Iono_rcpt_met
IPR001320Iontro_rcpt
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0099566regulation of postsynaptic cytosolic calcium ion concentration
GO:0006810transport
GO:0007268chemical synaptic transmission
GO:0007616long-term memory
GO:0031623receptor internalization
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0060078regulation of postsynaptic membrane potential
GO:0060079excitatory postsynaptic potential
GO:0060292long term synaptic depression
GO:0099565chemical synaptic transmission, postsynaptic
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005886plasma membrane
GO:0008021synaptic vesicle
GO:0008328ionotropic glutamate receptor complex
GO:0009986cell surface
GO:0014069postsynaptic density
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0030425dendrite
GO:0032281AMPA glutamate receptor complex
GO:0032590dendrite membrane
GO:0032591dendritic spine membrane
GO:0042995cell projection
GO:0043005neuron projection
GO:0043025neuronal cell body
GO:0043197dendritic spine
GO:0044308axonal spine
GO:0044309neuron spine
GO:0045202synapse
GO:0045211postsynaptic membrane
GO:0055037recycling endosome
GO:0098794postsynapse
GO:0098839postsynaptic density membrane
GO:0099061integral component of postsynaptic density membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001508Ionotropic glutamate receptor, metazoaPRINTSPR00177NMDARECEPTORcoord: 433..458
score: 33.85
coord: 501..528
score: 25.36
coord: 685..709
score: 28.0
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 408..626
e-value: 1.1E-46
score: 161.3
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 343..678
e-value: 1.1E-46
score: 161.3
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 418..706
e-value: 1.1E-46
score: 161.3
NoneNo IPR availablePANTHERPTHR42643FAMILY NOT NAMEDcoord: 317..725
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.677
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 317..662
NoneNo IPR availableTMHMMTMhelixcoord: 502..524
NoneNo IPR availableTMHMMTMhelixcoord: 430..452
NoneNo IPR availableTMHMMTMhelixcoord: 690..712
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 432..693
e-value: 1.4E-18
score: 67.2