PROX-1

Overview
NamePROX-1 (AFD29617.1)
Smed IDSMED30016901
Length (bp)1564
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PROX-1 (SMED30016901) t-SNE clustered cells

Violin plots show distribution of expression levels for PROX-1 (SMED30016901) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PROX-1 (SMED30016901) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PROX-1 (SMED30016901) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016901

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30016901SMESG000068287.1 SmedASXL_010375SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30016901SMESG000068287.1 SmedASXL_010375SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30016901SMESG000068287.1 dd_Smed_v4_13772_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016901SMESG000068287.1 dd_Smed_v4_13772_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30016901SMESG000068287.1 dd_Smed_v4_13772_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30016901SMESG000068287.1 dd_Smed_v4_13772_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016901SMESG000068287.1 dd_Smed_v4_13772_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30016901SMESG000068287.1 dd_Smed_v4_13772_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30016901SMESG000068287.1 JQ425149.1smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016901SMESG000068287.1 SmWIOct06_019613GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PROX-1 vs. Ensembl Human
Match: PROX1 (prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9459])

HSP 1 Score: 184.111 bits (466), Expect = 6.781e-50
Identity = 85/162 (52.47%), Postives = 113/162 (69.75%), Query Frame = 3
Query:  972 GDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            G   +  L+P HL+KAKLMF YTRYP+S MLK+YF D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++G+   +++ +T + EL++ L  H+NK     VP  FL   QITLREFF AI AGK++  SWKK IYK I KLD  +PE FK  N + EL
Sbjct:  573 GSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQEL 734          
BLAST of PROX-1 vs. Ensembl Human
Match: PROX1 (prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9459])

HSP 1 Score: 184.111 bits (466), Expect = 6.781e-50
Identity = 85/162 (52.47%), Postives = 113/162 (69.75%), Query Frame = 3
Query:  972 GDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            G   +  L+P HL+KAKLMF YTRYP+S MLK+YF D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++G+   +++ +T + EL++ L  H+NK     VP  FL   QITLREFF AI AGK++  SWKK IYK I KLD  +PE FK  N + EL
Sbjct:  573 GSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQEL 734          
BLAST of PROX-1 vs. Ensembl Human
Match: PROX1 (prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9459])

HSP 1 Score: 184.111 bits (466), Expect = 6.781e-50
Identity = 85/162 (52.47%), Postives = 113/162 (69.75%), Query Frame = 3
Query:  972 GDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            G   +  L+P HL+KAKLMF YTRYP+S MLK+YF D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++G+   +++ +T + EL++ L  H+NK     VP  FL   QITLREFF AI AGK++  SWKK IYK I KLD  +PE FK  N + EL
Sbjct:  573 GSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQEL 734          
BLAST of PROX-1 vs. Ensembl Human
Match: PROX1 (prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9459])

HSP 1 Score: 184.111 bits (466), Expect = 6.781e-50
Identity = 85/162 (52.47%), Postives = 113/162 (69.75%), Query Frame = 3
Query:  972 GDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            G   +  L+P HL+KAKLMF YTRYP+S MLK+YF D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++G+   +++ +T + EL++ L  H+NK     VP  FL   QITLREFF AI AGK++  SWKK IYK I KLD  +PE FK  N + EL
Sbjct:  573 GSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQEL 734          
BLAST of PROX-1 vs. Ensembl Human
Match: PROX2 (prospero homeobox 2 [Source:HGNC Symbol;Acc:HGNC:26715])

HSP 1 Score: 171.4 bits (433), Expect = 4.565e-46
Identity = 80/151 (52.98%), Postives = 108/151 (71.52%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNW 1445
            L P HL+KAKLMF +TRYP+S +LK YFPD+ F +  T+Q++KWFSNFREFYY +MEK+ ++A+S+G+   K + V   SELF+ L  H+NK     VP  FL    +TL+EFF A+SAG++   SWKKPIYK I+KLD  +PE FK  ++
Sbjct:  440 LNPGHLKKAKLMFFFTRYPSSNLLKVYFPDVQFNRCITSQMIKWFSNFREFYYIQMEKSARQAISDGVTNPKMLVVLRNSELFQALNMHYNKGNDFEVPDCFLEIASLTLQEFFRAVSAGRDSDPSWKKPIYKIISKLDSDIPEIFKSSSY 590          
BLAST of PROX-1 vs. Ensembl Celegans
Match: pros-1 (Homeobox protein prospero homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:P34522])

HSP 1 Score: 194.512 bits (493), Expect = 6.579e-55
Identity = 94/162 (58.02%), Postives = 116/162 (71.60%), Query Frame = 3
Query:  972 GDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            G      LTP+HLRKAKLMF YTRYPNS +LKSYFPDI F K NTAQLVKWFSNFREFYYN+MEK  ++A++ GI    DI V+ +SELFK L TH+N+   I  P   +  VQ TLREF +AI  GK++  SWKK IYK I +L+  +P+FFK+ N++  L
Sbjct:  431 GGGSSSMLTPMHLRKAKLMFFYTRYPNSNLLKSYFPDIRFNKNNTAQLVKWFSNFREFYYNQMEKFARQALAEGITDRNDIFVSKDSELFKVLNTHYNRNNHIKAPDRLVFVVQETLREFHDAIKQGKDIEPSWKKTIYKVINRLEDQIPDFFKEPNFLERL 592          
BLAST of PROX-1 vs. Ensembl Fly
Match: pros (gene:FBgn0004595 transcript:FBtr0304606)

HSP 1 Score: 191.43 bits (485), Expect = 7.374e-52
Identity = 89/160 (55.62%), Postives = 115/160 (71.88%), Query Frame = 3
Query:  978 PKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            P   TLTP+HLRKAKLMF + RYP+S +LK YFPDI F K NTAQLVKWFSNFREFYY +MEK  ++AV+ GI+   D+ +  +SEL++ L  H+N+   I VP  F   V+ TLREFF AI  GK+  QSWKK IYK I+++D  +PE+FK  N++ +L
Sbjct: 1375 PTSSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQL 1534          
BLAST of PROX-1 vs. Ensembl Fly
Match: pros (gene:FBgn0004595 transcript:FBtr0304604)

HSP 1 Score: 191.045 bits (484), Expect = 9.111e-52
Identity = 89/160 (55.62%), Postives = 115/160 (71.88%), Query Frame = 3
Query:  978 PKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            P   TLTP+HLRKAKLMF + RYP+S +LK YFPDI F K NTAQLVKWFSNFREFYY +MEK  ++AV+ GI+   D+ +  +SEL++ L  H+N+   I VP  F   V+ TLREFF AI  GK+  QSWKK IYK I+++D  +PE+FK  N++ +L
Sbjct: 1675 PTSSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQL 1834          
BLAST of PROX-1 vs. Ensembl Fly
Match: pros (gene:FBgn0004595 transcript:FBtr0304603)

HSP 1 Score: 190.66 bits (483), Expect = 1.194e-51
Identity = 89/160 (55.62%), Postives = 115/160 (71.88%), Query Frame = 3
Query:  978 PKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            P   TLTP+HLRKAKLMF + RYP+S +LK YFPDI F K NTAQLVKWFSNFREFYY +MEK  ++AV+ GI+   D+ +  +SEL++ L  H+N+   I VP  F   V+ TLREFF AI  GK+  QSWKK IYK I+++D  +PE+FK  N++ +L
Sbjct: 1514 PTSSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQL 1673          
BLAST of PROX-1 vs. Ensembl Fly
Match: pros (gene:FBgn0004595 transcript:FBtr0304607)

HSP 1 Score: 190.274 bits (482), Expect = 1.333e-51
Identity = 89/160 (55.62%), Postives = 115/160 (71.88%), Query Frame = 3
Query:  978 PKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            P   TLTP+HLRKAKLMF + RYP+S +LK YFPDI F K NTAQLVKWFSNFREFYY +MEK  ++AV+ GI+   D+ +  +SEL++ L  H+N+   I VP  F   V+ TLREFF AI  GK+  QSWKK IYK I+++D  +PE+FK  N++ +L
Sbjct: 1214 PTSSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQL 1373          
BLAST of PROX-1 vs. Ensembl Fly
Match: pros (gene:FBgn0004595 transcript:FBtr0304608)

HSP 1 Score: 188.734 bits (478), Expect = 5.292e-51
Identity = 88/156 (56.41%), Postives = 114/156 (73.08%), Query Frame = 3
Query:  990 TLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            TLTP+HLRKAKLMF + RYP+S +LK YFPDI F K NTAQLVKWFSNFREFYY +MEK  ++AV+ GI+   D+ +  +SEL++ L  H+N+   I VP  F   V+ TLREFF AI  GK+  QSWKK IYK I+++D  +PE+FK  N++ +L
Sbjct: 1547 TLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQL 1702          
BLAST of PROX-1 vs. Ensembl Zebrafish
Match: prox1a (prospero homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-980526-397])

HSP 1 Score: 181.415 bits (459), Expect = 4.133e-49
Identity = 84/155 (54.19%), Postives = 111/155 (71.61%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            L+P HL+KAKLMF YTRYP+S MLK +F D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++G+  ++++ V+ + ELF+ L  H+NK     VP  FL   QITLREFF AI AGK++  SWKK IYK I KLD  +PE FK  N + EL
Sbjct:  582 LSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGSEELSVSRDCELFRALNMHYNKANDFEVPERFLEVAQITLREFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQEL 736          
BLAST of PROX-1 vs. Ensembl Zebrafish
Match: prox1a (prospero homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-980526-397])

HSP 1 Score: 181.415 bits (459), Expect = 4.133e-49
Identity = 84/155 (54.19%), Postives = 111/155 (71.61%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            L+P HL+KAKLMF YTRYP+S MLK +F D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++G+  ++++ V+ + ELF+ L  H+NK     VP  FL   QITLREFF AI AGK++  SWKK IYK I KLD  +PE FK  N + EL
Sbjct:  582 LSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGSEELSVSRDCELFRALNMHYNKANDFEVPERFLEVAQITLREFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQEL 736          
BLAST of PROX-1 vs. Ensembl Zebrafish
Match: prox2 (prospero homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-081003-3])

HSP 1 Score: 176.792 bits (447), Expect = 2.771e-48
Identity = 82/154 (53.25%), Postives = 111/154 (72.08%), Query Frame = 3
Query:  987 YTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWM 1448
            ++LTP HL+KAKLMF YTRYP+S +LK++FPD+ F +  T+QL+KWFSNFREFYY +MEK  ++A+ +G+   KDI V+ ESELF+ L  H+NK     VP  FL   ++TL+EF+ AIS  K+   SWKK IYK I KLD  +PE FK  +++
Sbjct:  430 HSLTPNHLKKAKLMFFYTRYPSSNLLKNFFPDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAIIDGVTDVKDISVSRESELFRALNMHYNKANDFQVPDRFLEVAEVTLQEFYSAISLSKDSDPSWKKAIYKVICKLDSDVPEEFKSPSYL 583          
BLAST of PROX-1 vs. Ensembl Zebrafish
Match: prox2 (prospero homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-081003-3])

HSP 1 Score: 175.637 bits (444), Expect = 9.108e-48
Identity = 82/152 (53.95%), Postives = 109/152 (71.71%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWM 1448
            LTP HL+KAKLMF YTRYP+S +LK++FPD+ F +  T+QL+KWFSNFREFYY +MEK  ++A+ +G+   KDI V+ ESELF+ L  H+NK     VP  FL   ++TL+EF+ AIS  K+   SWKK IYK I KLD  +PE FK  +++
Sbjct:  431 LTPNHLKKAKLMFFYTRYPSSNLLKNFFPDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAIIDGVTDVKDISVSRESELFRALNMHYNKANDFQVPDRFLEVAEVTLQEFYSAISLSKDSDPSWKKAIYKVICKLDSDVPEEFKSPSYL 582          
BLAST of PROX-1 vs. Ensembl Zebrafish
Match: prox3 (prospero homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-050107-3])

HSP 1 Score: 150.214 bits (378), Expect = 1.604e-38
Identity = 69/149 (46.31%), Postives = 101/149 (67.79%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKD--IDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFK 1433
            L+P HL+KAKLMF YTRYP+S  LK+YFPD+ F +  T+QL+KWFSNFREF+Y +ME+  ++A    +  A++  + +  ++EL++ L  H+NK     VP  F+   ++ LREFF AI +G++    WKK IYK I KLD  +P+ F+
Sbjct:  494 LSPCHLKKAKLMFFYTRYPSSSTLKTYFPDVKFNRCVTSQLIKWFSNFREFFYIQMERFARQAAREVLTSARERALRLGRDTELYRILNMHYNKSNDYQVPERFVEISEVALREFFTAIQSGRDADPCWKKSIYKIICKLDSPVPDSFR 642          
BLAST of PROX-1 vs. Ensembl Xenopus
Match: PROX1 (prospero homeobox 1 [Source:NCBI gene;Acc:100134995])

HSP 1 Score: 178.333 bits (451), Expect = 6.431e-48
Identity = 82/155 (52.90%), Postives = 111/155 (71.61%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            L+P HL+KAKLMF YTRYP+S MLK++F D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++GI   +++ +T + EL++ L  H+NK     VP  FL   QITLREFF AI AGK++  SWKK IYK I KLD  +P+ F+  N + EL
Sbjct:  582 LSPNHLKKAKLMFFYTRYPSSNMLKTFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGITSTEELCITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPDIFRSPNCLQEL 736          
BLAST of PROX-1 vs. Ensembl Mouse
Match: Prox1 (prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:97772])

HSP 1 Score: 184.111 bits (466), Expect = 4.656e-50
Identity = 85/162 (52.47%), Postives = 113/162 (69.75%), Query Frame = 3
Query:  972 GDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            G   +  L+P HL+KAKLMF YTRYP+S MLK+YF D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++G+   +++ +T + EL++ L  H+NK     VP  FL   QITLREFF AI AGK++  SWKK IYK I KLD  +PE FK  N + EL
Sbjct:  573 GSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQEL 734          
BLAST of PROX-1 vs. Ensembl Mouse
Match: Prox1 (prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:97772])

HSP 1 Score: 184.111 bits (466), Expect = 4.656e-50
Identity = 85/162 (52.47%), Postives = 113/162 (69.75%), Query Frame = 3
Query:  972 GDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            G   +  L+P HL+KAKLMF YTRYP+S MLK+YF D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++G+   +++ +T + EL++ L  H+NK     VP  FL   QITLREFF AI AGK++  SWKK IYK I KLD  +PE FK  N + EL
Sbjct:  573 GSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQEL 734          
BLAST of PROX-1 vs. Ensembl Mouse
Match: Prox1 (prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:97772])

HSP 1 Score: 184.111 bits (466), Expect = 4.656e-50
Identity = 85/162 (52.47%), Postives = 113/162 (69.75%), Query Frame = 3
Query:  972 GDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            G   +  L+P HL+KAKLMF YTRYP+S MLK+YF D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++G+   +++ +T + EL++ L  H+NK     VP  FL   QITLREFF AI AGK++  SWKK IYK I KLD  +PE FK  N + EL
Sbjct:  573 GSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQEL 734          
BLAST of PROX-1 vs. Ensembl Mouse
Match: Prox2 (prospero homeobox 2 [Source:MGI Symbol;Acc:MGI:1920672])

HSP 1 Score: 175.637 bits (444), Expect = 1.095e-47
Identity = 82/155 (52.90%), Postives = 112/155 (72.26%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            L+P HL+KAKLMF +TRYP+S +LK+YFPD+ F +  T+Q++KWFSNFREFYY +MEK  ++A+S+GI  A+ + V  +SELF+ L TH+NK     VP  FL    +TL+EFF A+ AGK+   SWKKPIYK I+KLD  +PE  K  +++  L
Sbjct:  436 LSPGHLKKAKLMFFFTRYPSSSLLKAYFPDVQFNRCITSQMIKWFSNFREFYYIQMEKYARQALSDGITNAQALAVLRDSELFRVLNTHYNKGNDFEVPDCFLEIAALTLKEFFRAVLAGKDSDPSWKKPIYKVISKLDSDVPEMLKSPSFLPGL 590          
BLAST of PROX-1 vs. Ensembl Mouse
Match: Prox2 (prospero homeobox 2 [Source:MGI Symbol;Acc:MGI:1920672])

HSP 1 Score: 175.637 bits (444), Expect = 1.095e-47
Identity = 82/155 (52.90%), Postives = 112/155 (72.26%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            L+P HL+KAKLMF +TRYP+S +LK+YFPD+ F +  T+Q++KWFSNFREFYY +MEK  ++A+S+GI  A+ + V  +SELF+ L TH+NK     VP  FL    +TL+EFF A+ AGK+   SWKKPIYK I+KLD  +PE  K  +++  L
Sbjct:  436 LSPGHLKKAKLMFFFTRYPSSSLLKAYFPDVQFNRCITSQMIKWFSNFREFYYIQMEKYARQALSDGITNAQALAVLRDSELFRVLNTHYNKGNDFEVPDCFLEIAALTLKEFFRAVLAGKDSDPSWKKPIYKVISKLDSDVPEMLKSPSFLPGL 590          
BLAST of PROX-1 vs. UniProt/SwissProt
Match: sp|P34522|PROS1_CAEEL (Homeobox protein prospero homolog 1 OS=Caenorhabditis elegans OX=6239 GN=pros-1 PE=2 SV=2)

HSP 1 Score: 194.512 bits (493), Expect = 8.369e-54
Identity = 94/162 (58.02%), Postives = 116/162 (71.60%), Query Frame = 3
Query:  972 GDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            G      LTP+HLRKAKLMF YTRYPNS +LKSYFPDI F K NTAQLVKWFSNFREFYYN+MEK  ++A++ GI    DI V+ +SELFK L TH+N+   I  P   +  VQ TLREF +AI  GK++  SWKK IYK I +L+  +P+FFK+ N++  L
Sbjct:  431 GGGSSSMLTPMHLRKAKLMFFYTRYPNSNLLKSYFPDIRFNKNNTAQLVKWFSNFREFYYNQMEKFARQALAEGITDRNDIFVSKDSELFKVLNTHYNRNNHIKAPDRLVFVVQETLREFHDAIKQGKDIEPSWKKTIYKVINRLEDQIPDFFKEPNFLERL 592          
BLAST of PROX-1 vs. UniProt/SwissProt
Match: sp|P29617|PROS_DROME (Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3)

HSP 1 Score: 188.734 bits (478), Expect = 5.305e-50
Identity = 88/156 (56.41%), Postives = 114/156 (73.08%), Query Frame = 3
Query:  990 TLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            TLTP+HLRKAKLMF + RYP+S +LK YFPDI F K NTAQLVKWFSNFREFYY +MEK  ++AV+ GI+   D+ +  +SEL++ L  H+N+   I VP  F   V+ TLREFF AI  GK+  QSWKK IYK I+++D  +PE+FK  N++ +L
Sbjct: 1547 TLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQL 1702          
BLAST of PROX-1 vs. UniProt/SwissProt
Match: sp|P48437|PROX1_MOUSE (Prospero homeobox protein 1 OS=Mus musculus OX=10090 GN=Prox1 PE=1 SV=2)

HSP 1 Score: 184.111 bits (466), Expect = 3.257e-49
Identity = 85/162 (52.47%), Postives = 113/162 (69.75%), Query Frame = 3
Query:  972 GDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            G   +  L+P HL+KAKLMF YTRYP+S MLK+YF D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++G+   +++ +T + EL++ L  H+NK     VP  FL   QITLREFF AI AGK++  SWKK IYK I KLD  +PE FK  N + EL
Sbjct:  573 GSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQEL 734          
BLAST of PROX-1 vs. UniProt/SwissProt
Match: sp|Q92786|PROX1_HUMAN (Prospero homeobox protein 1 OS=Homo sapiens OX=9606 GN=PROX1 PE=1 SV=2)

HSP 1 Score: 184.111 bits (466), Expect = 3.257e-49
Identity = 85/162 (52.47%), Postives = 113/162 (69.75%), Query Frame = 3
Query:  972 GDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            G   +  L+P HL+KAKLMF YTRYP+S MLK+YF D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++G+   +++ +T + EL++ L  H+NK     VP  FL   QITLREFF AI AGK++  SWKK IYK I KLD  +PE FK  N + EL
Sbjct:  573 GSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQEL 734          
BLAST of PROX-1 vs. UniProt/SwissProt
Match: sp|Q91018|PROX1_CHICK (Prospero homeobox protein 1 OS=Gallus gallus OX=9031 GN=PROX1 PE=2 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 3.630e-49
Identity = 85/162 (52.47%), Postives = 113/162 (69.75%), Query Frame = 3
Query:  972 GDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            G   +  L+P HL+KAKLMF YTRYP+S MLK+YF D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++G+   +++ +T + EL++ L  H+NK     VP  FL   QITLREFF AI AGK++  SWKK IYK I KLD  +PE FK  N + EL
Sbjct:  572 GSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQEL 733          
BLAST of PROX-1 vs. TrEMBL
Match: H9CXU6 (PROX-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 870.922 bits (2249), Expect = 0.000e+0
Identity = 480/480 (100.00%), Postives = 480/480 (100.00%), Query Frame = 3
Query:   48 MIKSAGIATSSMCCKVQNPKMNSPQPYSVQSLLNQEGDDSILDLSVKEKRLRQTHEEPVSNEMMNLSEVLPELSNPDRMKQILFNVIQQRELHAQSNKKLNNQNVDFFQTSQSNLDNLQKFCNPSQNLPWNFLRPPVSSVSDTGASMXXXXXXXXXXXXXXXXTITNPNSIYPRRNMKNLFPNSFNPDSIPHYFNNLTQLFHSRLNQNNQTETTSHIPVVLPENFSKQYTNSNIDINTHFSLQNILXXXXXXXXXXXXXXXXXLPRRNTSLGNFPNLHESTIPETTRFXXXXXXXXXXXXXXXXEETPGDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELAKDENDSLNS 1487
            MIKSAGIATSSMCCKVQNPKMNSPQPYSVQSLLNQEGDDSILDLSVKEKRLRQTHEEPVSNEMMNLSEVLPELSNPDRMKQILFNVIQQRELHAQSNKKLNNQNVDFFQTSQSNLDNLQKFCNPSQNLPWNFLRPPVSSVSDTGASMLNQFQKFLFNKNFHNQTITNPNSIYPRRNMKNLFPNSFNPDSIPHYFNNLTQLFHSRLNQNNQTETTSHIPVVLPENFSKQYTNSNIDINTHFSLQNILKSSSNRKRKRTKVTDTRLPRRNTSLGNFPNLHESTIPETTRFSNYLNPPSNSSQSSHSEETPGDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELAKDENDSLNS
Sbjct:    1 MIKSAGIATSSMCCKVQNPKMNSPQPYSVQSLLNQEGDDSILDLSVKEKRLRQTHEEPVSNEMMNLSEVLPELSNPDRMKQILFNVIQQRELHAQSNKKLNNQNVDFFQTSQSNLDNLQKFCNPSQNLPWNFLRPPVSSVSDTGASMLNQFQKFLFNKNFHNQTITNPNSIYPRRNMKNLFPNSFNPDSIPHYFNNLTQLFHSRLNQNNQTETTSHIPVVLPENFSKQYTNSNIDINTHFSLQNILKSSSNRKRKRTKVTDTRLPRRNTSLGNFPNLHESTIPETTRFSNYLNPPSNSSQSSHSEETPGDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELAKDENDSLNS 480          
BLAST of PROX-1 vs. TrEMBL
Match: A0A183AEI2 (Prospero domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS5367 PE=4 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 9.678e-65
Identity = 102/162 (62.96%), Postives = 128/162 (79.01%), Query Frame = 3
Query:  978 PKRY-TLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELA 1460
            PKRY TLTP+HLRKAKLMF YTRYPNS ++K YFPD+ FYK NTAQLVKWFSNFREFYY +MEK  + A+S G++ A++I VT +SEL++ L  H+N+ +Q+ VP  F   V+ TLREFF A+  GK+  QSWKKPIYK IA++DQ +PEFFK+ NWM +LA
Sbjct:    7 PKRYYTLTPVHLRKAKLMFFYTRYPNSTLIKMYFPDVKFYKNNTAQLVKWFSNFREFYYIQMEKFARVAISEGVRSAEEIHVTTDSELYRALNLHYNRNQQLEVPEHFRIVVEATLREFFNALMTGKDAEQSWKKPIYKIIARMDQPVPEFFKNPNWMEQLA 168          
BLAST of PROX-1 vs. TrEMBL
Match: A0A1S8WHF4 (Prospero domain-containing protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_10339 PE=4 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 4.448e-63
Identity = 98/157 (62.42%), Postives = 123/157 (78.34%), Query Frame = 3
Query:  990 TLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELA 1460
            TLTP+HLRKAKLMF YTRYPNS ++K YFPD+ FYK NTAQLVKWFSNFREFYY +MEK  + A+S G++ A +I VT +SEL++ L  H+N+ +Q+ VP  F   V+ TLREFF A+  GK+  QSWKKPIYK IA++DQ +PEFFK+ NWM +LA
Sbjct:   32 TLTPVHLRKAKLMFFYTRYPNSTLIKMYFPDVKFYKNNTAQLVKWFSNFREFYYIQMEKFARVAISEGVRSADEIHVTTDSELYRALNLHYNRNQQLEVPDHFRIVVEATLREFFNALMTGKDTEQSWKKPIYKIIARMDQPVPEFFKNPNWMEQLA 188          
BLAST of PROX-1 vs. TrEMBL
Match: A0A074ZP01 (Prospero domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_07444 PE=4 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 5.580e-63
Identity = 98/157 (62.42%), Postives = 123/157 (78.34%), Query Frame = 3
Query:  990 TLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELA 1460
            TLTP+HLRKAKLMF YTRYPNS ++K YFPD+ FYK NTAQLVKWFSNFREFYY +MEK  + A+S G++ A +I VT +SEL++ L  H+N+ +Q+ VP  F   V+ TLREFF A+  GK+  QSWKKPIYK IA++DQ +PEFFK+ NWM +LA
Sbjct:   37 TLTPVHLRKAKLMFFYTRYPNSTLIKMYFPDVKFYKNNTAQLVKWFSNFREFYYIQMEKFARVAISEGVRSADEIHVTTDSELYRALNLHYNRNQQLEVPDHFRIVVEATLREFFNALMTGKDTEQSWKKPIYKIIARMDQPVPEFFKNPNWMEQLA 193          
BLAST of PROX-1 vs. TrEMBL
Match: A0A4S2KFM3 (Prospero domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010997 PE=4 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 3.226e-58
Identity = 98/157 (62.42%), Postives = 124/157 (78.98%), Query Frame = 3
Query:  990 TLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELA 1460
            TLTP+HLRKAKLMF YTRYPNS ++K YFPD+ FYK NTAQLVKWFSNFREFYY +MEK  + A+S G++ A +I VT +SEL++ L  H+N+ +Q+ VP  F   V+ TLREFF+A+  GK+  QSWKKPIYK IA++DQ +PEFFK+ NWM +LA
Sbjct:  817 TLTPVHLRKAKLMFFYTRYPNSTLIKMYFPDVKFYKNNTAQLVKWFSNFREFYYIQMEKFARVAISEGVRTADEIHVTTDSELYRALNLHYNRNQQLEVPDHFRIVVEATLREFFKALMTGKDTEQSWKKPIYKIIARMDQPVPEFFKNPNWMEQLA 973          
BLAST of PROX-1 vs. Ensembl Cavefish
Match: ENSAMXT00000012572.2 (prospero homeobox protein 1-like [Source:NCBI gene;Acc:103022569])

HSP 1 Score: 185.267 bits (469), Expect = 2.083e-50
Identity = 87/155 (56.13%), Postives = 111/155 (71.61%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            L+P HL+KAKLMF YTRYP+S MLK +F D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++G+  A +I V+ +SELF+ L  H+NK     VP  FL   QITLREFF AI AGK++  SWKK IYK I KLD  +PE FK  N + EL
Sbjct:  627 LSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGADEISVSRDSELFRALNMHYNKANDFEVPERFLEVAQITLREFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQEL 781          
BLAST of PROX-1 vs. Ensembl Cavefish
Match: prox1a (prospero homeobox protein 1 [Source:NCBI gene;Acc:103040734])

HSP 1 Score: 177.948 bits (450), Expect = 5.989e-48
Identity = 82/155 (52.90%), Postives = 111/155 (71.61%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            L+P HL+KAKLMF YTRYP+S MLK +F D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++G+  ++++ V+ + EL++ L  H+NK     VP  FL   QITL+EFF AI AGK++  SWKK IYK I KLD  +PE FK  N + EL
Sbjct:  583 LSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVAGSEELTVSRDCELYRALNMHYNKANDFEVPERFLEVAQITLQEFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQEL 737          
BLAST of PROX-1 vs. Ensembl Cavefish
Match: prox2 (prospero homeobox 2 [Source:NCBI gene;Acc:103029539])

HSP 1 Score: 174.096 bits (440), Expect = 7.534e-47
Identity = 82/152 (53.95%), Postives = 108/152 (71.05%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWM 1448
            LTP HL+KAKLMF YTRYP+S +LK++FPD+ F +  T+QL+KWFSNFREFYY +MEK  ++A+ +G+   KD+ VT +SELF+ L  H+NK     VP  FL   +ITL EF+ AIS  K+   SWKK IYK I KLD  +PE FK  +++
Sbjct:  516 LTPNHLKKAKLMFFYTRYPSSNVLKTFFPDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAIVDGVSDVKDMAVTRDSELFRALNMHYNKANDFQVPDRFLEVAEITLHEFYNAISLNKDSDPSWKKAIYKVICKLDSDVPEEFKSPSYL 667          
BLAST of PROX-1 vs. Ensembl Cavefish
Match: prox3 (prospero homeobox protein 1-like [Source:NCBI gene;Acc:103040122])

HSP 1 Score: 156.377 bits (394), Expect = 1.642e-40
Identity = 72/149 (48.32%), Postives = 101/149 (67.79%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKD--IDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFK 1433
            L+P HL+KAKLMF YTRYP+S  LK+YFPD+ F +  T+QL+KWFSNFREF+Y +ME+  ++A   G+  ++D  + ++  SELF+ L  H+NK     VP  F+   ++ LREFF AI  G++    WKK IYK I KLD  +P+ F+
Sbjct:  545 LSPCHLKKAKLMFFYTRYPSSNTLKTYFPDVKFNRCVTSQLIKWFSNFREFFYIQMERFARQAAREGLPTSRDRVLRLSRNSELFRILNMHYNKSNDYQVPDRFVEVSELALREFFAAIQGGRDTDPCWKKSIYKIICKLDSPVPDSFR 693          
BLAST of PROX-1 vs. Ensembl Cavefish
Match: prox3 (prospero homeobox protein 1-like [Source:NCBI gene;Acc:103040122])

HSP 1 Score: 155.992 bits (393), Expect = 1.744e-40
Identity = 72/149 (48.32%), Postives = 101/149 (67.79%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKD--IDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFK 1433
            L+P HL+KAKLMF YTRYP+S  LK+YFPD+ F +  T+QL+KWFSNFREF+Y +ME+  ++A   G+  ++D  + ++  SELF+ L  H+NK     VP  F+   ++ LREFF AI  G++    WKK IYK I KLD  +P+ F+
Sbjct:  519 LSPCHLKKAKLMFFYTRYPSSNTLKTYFPDVKFNRCVTSQLIKWFSNFREFFYIQMERFARQAAREGLPTSRDRVLRLSRNSELFRILNMHYNKSNDYQVPDRFVEVSELALREFFAAIQGGRDTDPCWKKSIYKIICKLDSPVPDSFR 667          
BLAST of PROX-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007312.1 (pep scaffold:Pmarinus_7.0:GL481361:690:12474:1 gene:ENSPMAG00000006606.1 transcript:ENSPMAT00000007312.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.168 bits (300), Expect = 5.387e-33
Identity = 54/92 (58.70%), Postives = 73/92 (79.35%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNK 1268
            LTP HL+KAKLMF Y+RYP+S MLK YFPD+ F +  T+QL+KWFSNFREFYY +MEK  + A+++G+  A+++ VT +SELF+ L  H+NK
Sbjct:    4 LTPGHLKKAKLMFYYSRYPSSTMLKIYFPDVKFNRCITSQLIKWFSNFREFYYIQMEKFARAALADGVTSAEELTVTRDSELFRALNVHYNK 95          
BLAST of PROX-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007316.1 (pep scaffold:Pmarinus_7.0:GL481361:12253:13226:1 gene:ENSPMAG00000006606.1 transcript:ENSPMAT00000007316.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 1.139e-15
Identity = 30/55 (54.55%), Postives = 44/55 (80.00%), Query Frame = 3
Query: 1104 TAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNK 1268
            T+QL+KWFSNFREFYY +MEK  + A+++G+  A+++ VT +SELF+ L  H+NK
Sbjct:   10 TSQLIKWFSNFREFYYIQMEKFARAALADGVTSAEELTVTRDSELFRALNVHYNK 64          
BLAST of PROX-1 vs. Ensembl Medaka
Match: prox1 (prospero homeobox 1 [Source:NCBI gene;Acc:100302041])

HSP 1 Score: 186.808 bits (473), Expect = 9.048e-51
Identity = 86/161 (53.42%), Postives = 115/161 (71.43%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELAKDEND 1475
            L+P HL+KAKLMF YTRYP+S MLK +F D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++G+  A+++ V+ + ELF+ L  H+NK     VP  FL   +ITLREFF AI AGK++  SWKK IYK I KLD  +PE FK  N + EL  D++D
Sbjct:  663 LSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGAEELSVSRDCELFRALNMHYNKANDFEVPDRFLEVAEITLREFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHDDSD 823          
BLAST of PROX-1 vs. Ensembl Medaka
Match: prox2 (prospero homeobox 2 [Source:NCBI gene;Acc:101167581])

HSP 1 Score: 182.185 bits (461), Expect = 5.236e-50
Identity = 85/152 (55.92%), Postives = 110/152 (72.37%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWM 1448
            LTP HL+KAKLMF YTRYP+S +LK+YFPD+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++GI+  KDI V+ +SELF+ L  H+NK     VP  FL   +ITL EF+ AISA K+   SWKK IYK I K+D  +PE FK  + M
Sbjct:  477 LTPSHLKKAKLMFFYTRYPSSNVLKTYFPDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAIADGIRDVKDITVSRDSELFRALNMHYNKANDFHVPDRFLEVAEITLHEFYNAISASKDSDSSWKKSIYKVICKMDSEVPEEFKTSSCM 628          
BLAST of PROX-1 vs. Ensembl Medaka
Match: prox1b (prospero-related homeobox protein 1b [Source:NCBI gene;Acc:100302040])

HSP 1 Score: 184.882 bits (468), Expect = 5.478e-50
Identity = 85/158 (53.80%), Postives = 112/158 (70.89%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELAKD 1466
            L+P HL+KAKLMF YTRYP+S MLK +F D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++G+  A+++ V  ++ELF+ L  H+NK     VP  FL   Q+TLREFF AI AGK+   SWKK IYK I KLD  +PE FK  N + EL +D
Sbjct:  725 LSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGAEELTVGRDAELFRALNMHYNKANDFEVPDRFLEVAQVTLREFFNAIVAGKDADPSWKKAIYKVICKLDSEVPEVFKSPNCLQELLRD 882          
BLAST of PROX-1 vs. Ensembl Medaka
Match: prox2 (prospero homeobox 2 [Source:NCBI gene;Acc:101167581])

HSP 1 Score: 182.185 bits (461), Expect = 8.183e-50
Identity = 85/152 (55.92%), Postives = 110/152 (72.37%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWM 1448
            LTP HL+KAKLMF YTRYP+S +LK+YFPD+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++GI+  KDI V+ +SELF+ L  H+NK     VP  FL   +ITL EF+ AISA K+   SWKK IYK I K+D  +PE FK  + M
Sbjct:  506 LTPSHLKKAKLMFFYTRYPSSNVLKTYFPDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAIADGIRDVKDITVSRDSELFRALNMHYNKANDFHVPDRFLEVAEITLHEFYNAISASKDSDSSWKKSIYKVICKMDSEVPEEFKTSSCM 657          
BLAST of PROX-1 vs. Ensembl Medaka
Match: prox1 (prospero homeobox 1 [Source:NCBI gene;Acc:100302041])

HSP 1 Score: 182.57 bits (462), Expect = 2.984e-49
Identity = 84/155 (54.19%), Postives = 111/155 (71.61%), Query Frame = 3
Query:  993 LTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMEL 1457
            L+P HL+KAKLMF YTRYP+S MLK +F D+ F +  T+QL+KWFSNFREFYY +MEK  ++A+++G+  A+++ V+ + ELF+ L  H+NK     VP  FL   +ITLREFF AI AGK++  SWKK IYK I KLD  +PE FK  N + EL
Sbjct:  663 LSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGAEELSVSRDCELFRALNMHYNKANDFEVPDRFLEVAEITLREFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQEL 817          
BLAST of PROX-1 vs. Planmine SMEST
Match: SMESG000068287.1 (SMESG000068287.1)

HSP 1 Score: 873.233 bits (2255), Expect = 0.000e+0
Identity = 479/479 (100.00%), Postives = 479/479 (100.00%), Query Frame = 3
Query:   48 MIKSAGIATSSMCCKVQNPKMNSPQPYSVQSLLNQEGDDSILDLSVKEKRLRQTHEEPVSNEMMNLSEVLPELSNPDRMKQILFNVIQQRELHAQSNKKLNNQNVDFFQTSQSNLDNLQKFCNPSQNLPWNFLRPPVSSVSDTGASMXXXXXXXXXXXXXXXXTITNPNSIYPRRNMKNLFPNSFNPDSIPHYFNNLTQLFHSRLNQNNQTETTSHIPVVLPENFSKQYTNSNIDINTHFSLQNILXXXXXXXXXXXXXXXXXLPRRNTSLGNFPNLHESTIPETTRFXXXXXXXXXXXXXXXXEETPGDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELAKDENDSLN 1484
            MIKSAGIATSSMCCKVQNPKMNSPQPYSVQSLLNQEGDDSILDLSVKEKRLRQTHEEPVSNEMMNLSEVLPELSNPDRMKQILFNVIQQRELHAQSNKKLNNQNVDFFQTSQSNLDNLQKFCNPSQNLPWNFLRPPVSSVSDTGASMLNQFQKFLFNKNFHNQTITNPNSIYPRRNMKNLFPNSFNPDSIPHYFNNLTQLFHSRLNQNNQTETTSHIPVVLPENFSKQYTNSNIDINTHFSLQNILKSSSNRKRKRTKVTDTRLPRRNTSLGNFPNLHESTIPETTRFSNYLNPPSNSSQSSHSEETPGDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELAKDENDSLN
Sbjct:    1 MIKSAGIATSSMCCKVQNPKMNSPQPYSVQSLLNQEGDDSILDLSVKEKRLRQTHEEPVSNEMMNLSEVLPELSNPDRMKQILFNVIQQRELHAQSNKKLNNQNVDFFQTSQSNLDNLQKFCNPSQNLPWNFLRPPVSSVSDTGASMLNQFQKFLFNKNFHNQTITNPNSIYPRRNMKNLFPNSFNPDSIPHYFNNLTQLFHSRLNQNNQTETTSHIPVVLPENFSKQYTNSNIDINTHFSLQNILKSSSNRKRKRTKVTDTRLPRRNTSLGNFPNLHESTIPETTRFSNYLNPPSNSSQSSHSEETPGDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELAKDENDSLN 479          
BLAST of PROX-1 vs. Planmine SMEST
Match: SMESG000068287.1 (SMESG000068287.1)

HSP 1 Score: 870.922 bits (2249), Expect = 0.000e+0
Identity = 480/480 (100.00%), Postives = 480/480 (100.00%), Query Frame = 3
Query:   48 MIKSAGIATSSMCCKVQNPKMNSPQPYSVQSLLNQEGDDSILDLSVKEKRLRQTHEEPVSNEMMNLSEVLPELSNPDRMKQILFNVIQQRELHAQSNKKLNNQNVDFFQTSQSNLDNLQKFCNPSQNLPWNFLRPPVSSVSDTGASMXXXXXXXXXXXXXXXXTITNPNSIYPRRNMKNLFPNSFNPDSIPHYFNNLTQLFHSRLNQNNQTETTSHIPVVLPENFSKQYTNSNIDINTHFSLQNILXXXXXXXXXXXXXXXXXLPRRNTSLGNFPNLHESTIPETTRFXXXXXXXXXXXXXXXXEETPGDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELAKDENDSLNS 1487
            MIKSAGIATSSMCCKVQNPKMNSPQPYSVQSLLNQEGDDSILDLSVKEKRLRQTHEEPVSNEMMNLSEVLPELSNPDRMKQILFNVIQQRELHAQSNKKLNNQNVDFFQTSQSNLDNLQKFCNPSQNLPWNFLRPPVSSVSDTGASMLNQFQKFLFNKNFHNQTITNPNSIYPRRNMKNLFPNSFNPDSIPHYFNNLTQLFHSRLNQNNQTETTSHIPVVLPENFSKQYTNSNIDINTHFSLQNILKSSSNRKRKRTKVTDTRLPRRNTSLGNFPNLHESTIPETTRFSNYLNPPSNSSQSSHSEETPGDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELAKDENDSLNS
Sbjct:    1 MIKSAGIATSSMCCKVQNPKMNSPQPYSVQSLLNQEGDDSILDLSVKEKRLRQTHEEPVSNEMMNLSEVLPELSNPDRMKQILFNVIQQRELHAQSNKKLNNQNVDFFQTSQSNLDNLQKFCNPSQNLPWNFLRPPVSSVSDTGASMLNQFQKFLFNKNFHNQTITNPNSIYPRRNMKNLFPNSFNPDSIPHYFNNLTQLFHSRLNQNNQTETTSHIPVVLPENFSKQYTNSNIDINTHFSLQNILKSSSNRKRKRTKVTDTRLPRRNTSLGNFPNLHESTIPETTRFSNYLNPPSNSSQSSHSEETPGDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELAKDENDSLNS 480          
BLAST of PROX-1 vs. Planmine SMEST
Match: SMESG000032751.1 (SMESG000032751.1)

HSP 1 Score: 293.123 bits (749), Expect = 8.164e-94
Identity = 138/176 (78.41%), Postives = 156/176 (88.64%), Query Frame = 3
Query:  960 EETPGDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELAKDENDSLNS 1487
            E+   DPK+YTLTPIHLRKAKLMFLYTRYPNSQMLK++FPDI FYKQNTAQLVKWFSNFREFYY+EMEKAVQR++S+GI+ + ++ VT E ELFKNLMTHFNK +QI VP EF+ TVQITLREFFEA S GKNLHQSWKKPIYK IAKLDQ LPEFFKD NWM+ELAK+EN + +S
Sbjct:  270 EDLTNDPKKYTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKEENGASHS 445          
BLAST of PROX-1 vs. Planmine SMEST
Match: SMESG000035419.1 (SMESG000035419.1)

HSP 1 Score: 171.785 bits (434), Expect = 5.021e-49
Identity = 77/156 (49.36%), Postives = 111/156 (71.15%), Query Frame = 3
Query:  990 TLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSN-GIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMME 1454
            +LT  HLRKAKLMFLY RYPNS +LK +FPDITF K +TAQLVKWFSNFREF+Y ++EK ++  + N       D+ + ++ E+++ L+ H+++  QI +P  FL  ++ TL  F++AI  G++   SWKKPIYK IA++D  +PEFFK   W+++
Sbjct:  152 SLTSQHLRKAKLMFLYVRYPNSSILKDFFPDITFDKNSTAQLVKWFSNFREFFYIQLEKYIRTNIINLRFTDENDVKIDMDCEIYRTLVNHYDRTNQIQIPTNFLQVLKTTLWHFYQAIVTGRDRDHSWKKPIYKIIARMDITVPEFFKHTQWLLD 307          
BLAST of PROX-1 vs. Planmine SMEST
Match: SMESG000012837.1 (SMESG000012837.1)

HSP 1 Score: 172.94 bits (437), Expect = 6.798e-49
Identity = 85/152 (55.92%), Postives = 109/152 (71.71%), Query Frame = 3
Query:  990 TLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNW 1445
             L P HLRKAKLMF YTRYP+S  LKS FPDI F K NTAQLVKWFSNFREFYY ++EK  ++ +S G +   ++D  +  +L++ L+ H+N+  QI+VP EF   V+ TL EF+ AI +GK+  QSWKK IYK IA+LDQ  P +FK+ NW
Sbjct:  201 VLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNW 351          
The following BLAST results are available for this feature:
BLAST of PROX-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PROX16.781e-5052.47prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9... [more]
PROX16.781e-5052.47prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9... [more]
PROX16.781e-5052.47prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9... [more]
PROX16.781e-5052.47prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9... [more]
PROX24.565e-4652.98prospero homeobox 2 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of PROX-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pros-16.579e-5558.02Homeobox protein prospero homolog 1 [Source:UniPr... [more]
back to top
BLAST of PROX-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pros7.374e-5255.63gene:FBgn0004595 transcript:FBtr0304606[more]
pros9.111e-5255.63gene:FBgn0004595 transcript:FBtr0304604[more]
pros1.194e-5155.63gene:FBgn0004595 transcript:FBtr0304603[more]
pros1.333e-5155.63gene:FBgn0004595 transcript:FBtr0304607[more]
pros5.292e-5156.41gene:FBgn0004595 transcript:FBtr0304608[more]
back to top
BLAST of PROX-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prox1a4.133e-4954.19prospero homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-980... [more]
prox1a4.133e-4954.19prospero homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-980... [more]
prox22.771e-4853.25prospero homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-0810... [more]
prox29.108e-4853.95prospero homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-0810... [more]
prox31.604e-3846.31prospero homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-0501... [more]
back to top
BLAST of PROX-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PROX16.431e-4852.90prospero homeobox 1 [Source:NCBI gene;Acc:10013499... [more]
back to top
BLAST of PROX-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prox14.656e-5052.47prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:977... [more]
Prox14.656e-5052.47prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:977... [more]
Prox14.656e-5052.47prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:977... [more]
Prox21.095e-4752.90prospero homeobox 2 [Source:MGI Symbol;Acc:MGI:192... [more]
Prox21.095e-4752.90prospero homeobox 2 [Source:MGI Symbol;Acc:MGI:192... [more]
back to top
BLAST of PROX-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P34522|PROS1_CAEEL8.369e-5458.02Homeobox protein prospero homolog 1 OS=Caenorhabdi... [more]
sp|P29617|PROS_DROME5.305e-5056.41Homeobox protein prospero OS=Drosophila melanogast... [more]
sp|P48437|PROX1_MOUSE3.257e-4952.47Prospero homeobox protein 1 OS=Mus musculus OX=100... [more]
sp|Q92786|PROX1_HUMAN3.257e-4952.47Prospero homeobox protein 1 OS=Homo sapiens OX=960... [more]
sp|Q91018|PROX1_CHICK3.630e-4952.47Prospero homeobox protein 1 OS=Gallus gallus OX=90... [more]
back to top
BLAST of PROX-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXU60.000e+0100.00PROX-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
A0A183AEI29.678e-6562.96Prospero domain-containing protein OS=Echinostoma ... [more]
A0A1S8WHF44.448e-6362.42Prospero domain-containing protein (Fragment) OS=O... [more]
A0A074ZP015.580e-6362.42Prospero domain-containing protein OS=Opisthorchis... [more]
A0A4S2KFM33.226e-5862.42Prospero domain-containing protein OS=Opisthorchis... [more]
back to top
BLAST of PROX-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000012572.22.083e-5056.13prospero homeobox protein 1-like [Source:NCBI gene... [more]
prox1a5.989e-4852.90prospero homeobox protein 1 [Source:NCBI gene;Acc:... [more]
prox27.534e-4753.95prospero homeobox 2 [Source:NCBI gene;Acc:10302953... [more]
prox31.642e-4048.32prospero homeobox protein 1-like [Source:NCBI gene... [more]
prox31.744e-4048.32prospero homeobox protein 1-like [Source:NCBI gene... [more]
back to top
BLAST of PROX-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007312.15.387e-3358.70pep scaffold:Pmarinus_7.0:GL481361:690:12474:1 gen... [more]
ENSPMAT00000007316.11.139e-1554.55pep scaffold:Pmarinus_7.0:GL481361:12253:13226:1 g... [more]
back to top
BLAST of PROX-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROX-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PROX-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prox19.048e-5153.42prospero homeobox 1 [Source:NCBI gene;Acc:10030204... [more]
prox25.236e-5055.92prospero homeobox 2 [Source:NCBI gene;Acc:10116758... [more]
prox1b5.478e-5053.80prospero-related homeobox protein 1b [Source:NCBI ... [more]
prox28.183e-5055.92prospero homeobox 2 [Source:NCBI gene;Acc:10116758... [more]
prox12.984e-4954.19prospero homeobox 1 [Source:NCBI gene;Acc:10030204... [more]
back to top
BLAST of PROX-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068287.10.000e+0100.00SMESG000068287.1[more]
SMESG000068287.10.000e+0100.00SMESG000068287.1[more]
SMESG000032751.18.164e-9478.41SMESG000032751.1[more]
SMESG000035419.15.021e-4949.36SMESG000035419.1[more]
SMESG000012837.16.798e-4955.92SMESG000012837.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30016901
GenBankAFD29617.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016901 ID=SMED30016901|Name=PROX-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1564bp
AAATAATAGAAAAAAACTTTCCGTTGATATTAAATTTATAATAGTTCATG
ATAAAGTCAGCCGGAATAGCAACGTCCTCAATGTGCTGTAAAGTGCAGAA
TCCAAAAATGAATTCACCACAACCATATTCAGTTCAGTCTTTGCTAAATC
AAGAAGGCGATGATTCAATTCTTGATTTGTCAGTTAAAGAAAAAAGATTA
AGACAAACCCATGAAGAACCTGTATCTAATGAAATGATGAACCTATCAGA
AGTTCTACCCGAGCTCTCAAATCCCGATCGCATGAAACAAATACTTTTCA
ACGTGATACAACAAAGAGAACTTCACGCTCAATCAAATAAAAAACTCAAT
AATCAAAATGTTGATTTTTTTCAGACATCTCAGTCAAATTTAGACAACCT
TCAGAAATTTTGCAACCCTTCCCAAAACCTTCCATGGAATTTTTTACGAC
CCCCCGTTTCCAGTGTTTCAGATACAGGAGCAAGCATGCTCAACCAATTC
CAGAAATTCCTATTCAATAAAAACTTTCATAATCAAACAATAACAAATCC
CAATTCGATTTATCCTCGACGAAATATGAAAAACCTTTTTCCAAATTCAT
TTAATCCCGATTCAATTCCCCATTATTTCAATAACTTAACTCAACTCTTT
CATTCGAGACTGAATCAAAATAATCAAACAGAAACGACATCACACATTCC
AGTAGTCTTACCAGAAAACTTTTCGAAACAATATACTAATTCAAACATAG
ATATTAACACTCATTTCAGTTTACAAAACATTCTCAAATCTTCGTCGAAT
AGGAAAAGAAAACGAACAAAAGTTACTGATACACGTCTTCCAAGACGAAA
TACAAGTTTAGGTAACTTCCCGAATCTCCACGAATCGACAATACCAGAAA
CAACACGGTTTTCCAATTACCTAAATCCTCCATCAAACAGTTCCCAGTCA
TCACATTCGGAAGAAACACCCGGTGATCCAAAAAGATATACGCTAACACC
GATTCATTTACGAAAGGCCAAACTTATGTTCCTCTATACCCGATATCCGA
ACTCACAAATGCTTAAGAGCTATTTTCCTGATATCACGTTCTACAAACAG
AACACTGCTCAACTAGTAAAATGGTTCAGTAACTTCCGAGAATTTTATTA
CAATGAAATGGAGAAAGCCGTTCAACGAGCCGTTTCAAATGGTATACAGC
AAGCCAAAGACATCGATGTGACGGTCGAATCCGAGTTATTCAAAAATTTA
ATGACCCATTTCAATAAGAAAAAACAAATCGTTGTACCATGTGAATTTTT
AACAACCGTTCAAATTACATTGCGAGAATTTTTCGAAGCGATTTCCGCCG
GTAAAAACCTTCATCAATCTTGGAAGAAACCGATTTATAAAACTATTGCT
AAACTCGATCAGATGTTGCCAGAGTTTTTTAAGGATATGAACTGGATGAT
GGAGCTGGCCAAAGATGAGAATGACAGTTTAAATAGTTAATACGTTACTG
AAAATTGTTTGAATTATACACACGTATAGAGACTATAATAAAAATGATAT
GGATAAAAATAAAA
back to top

protein sequence of SMED30016901-orf-1

>SMED30016901-orf-1 ID=SMED30016901-orf-1|Name=SMED30016901-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=481bp
MIKSAGIATSSMCCKVQNPKMNSPQPYSVQSLLNQEGDDSILDLSVKEKR
LRQTHEEPVSNEMMNLSEVLPELSNPDRMKQILFNVIQQRELHAQSNKKL
NNQNVDFFQTSQSNLDNLQKFCNPSQNLPWNFLRPPVSSVSDTGASMLNQ
FQKFLFNKNFHNQTITNPNSIYPRRNMKNLFPNSFNPDSIPHYFNNLTQL
FHSRLNQNNQTETTSHIPVVLPENFSKQYTNSNIDINTHFSLQNILKSSS
NRKRKRTKVTDTRLPRRNTSLGNFPNLHESTIPETTRFSNYLNPPSNSSQ
SSHSEETPGDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYK
QNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKN
LMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTI
AKLDQMLPEFFKDMNWMMELAKDENDSLNS*
back to top
Aliases
The feature 'PROX-1' has the following synonyms
Synonym
PROX-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000039gamma neoblast
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR037131Homeo_prospero_dom_sf
IPR039350Prospero_homeodomain
IPR023082Homeo_prospero_dom
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR037131Homeo-prospero domain superfamilyGENE3DG3DSA:1.10.10.500coord: 300..473
e-value: 5.3E-72
score: 242.8
IPR023082Homeo-prospero domainPFAMPF05044HPDcoord: 315..467
e-value: 2.6E-66
score: 222.3
IPR023082Homeo-prospero domainPROSITEPS51818HOMEO_PROSPEROcoord: 313..471
score: 80.262
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 264..279
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 294..314
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 247..279
IPR039350Prospero homeodomain familyPANTHERPTHR12198HOMEOBOX PROTEIN PROSPERO/PROX-1/CEH-26coord: 69..470
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 315..463