Transcription factor ETV6

Overview
NameTranscription factor ETV6
Smed IDSMED30016899
Length (bp)1052
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription factor ETV6 (SMED30016899) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription factor ETV6 (SMED30016899) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcription factor ETV6 (SMED30016899) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcription factor ETV6 (SMED30016899) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016899

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30016899h1SMcG0020046 dd_Smed_v4_5087_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016899h1SMcG0020046 dd_Smed_v4_5087_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016899h1SMcG0020046 dd_Smed_v4_5087_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016899h1SMcG0020046 dd_Smed_v4_5087_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30016899h1SMcG0020046 dd_Smed_v4_5087_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016899h1SMcG0020046 dd_Smed_v4_5087_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016899h1SMcG0020046 dd_Smed_v4_5087_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016899h1SMcG0020046 dd_Smed_v4_5087_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30016899h1SMcG0020046 dd_Smed_v4_5087_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription factor ETV6 vs. Ensembl Celegans
Match: ets-7 (ETS class transcription factor [Source:UniProtKB/TrEMBL;Acc:O01519])

HSP 1 Score: 50.447 bits (119), Expect = 4.120e-7
Identity = 25/70 (35.71%), Postives = 36/70 (51.43%), Query Frame = 2
Query:  632 KRKSPRDQVLLHIFILDLLMHPYYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRF 841
            KR SP  +  L  F+  LL    +   ITWSNK+   F++     VA +W    GN   NY+  +RG+R+
Sbjct:    4 KRTSPNGKQRLLNFLRGLLEDDSHSDLITWSNKDTLEFQMLKPHKVAELWGAATGNPGMNYDKMSRGLRY 73          
BLAST of Transcription factor ETV6 vs. Ensembl Celegans
Match: ets-4 (Transcription factor ets-4 [Source:UniProtKB/Swiss-Prot;Acc:A8WFJ9])

HSP 1 Score: 49.6766 bits (117), Expect = 1.928e-6
Identity = 30/103 (29.13%), Postives = 52/103 (50.49%), Query Frame = 2
Query:  605 CKLTEKEDYKRKSPRDQVLLHI--FILDLLMHP-YYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQL 904
            C  +E +D +R   R Q  +H+  FI +LL  P  Y  C+ W ++++ TF+I++S  +A  W   K     NY+  +R +R +     +  +  K  R VY+ 
Sbjct:  269 CNGSEGDDDERAYTRHQGTVHLWQFIRELLDQPKQYSACVRWVDRDEGTFKIESSLLLARYWGQRKNRSQMNYDKLSRSLR-QYYKKGIIQKPEKKQRLVYKF 370          
BLAST of Transcription factor ETV6 vs. Ensembl Celegans
Match: ets-4 (Transcription factor ets-4 [Source:UniProtKB/Swiss-Prot;Acc:A8WFJ9])

HSP 1 Score: 49.6766 bits (117), Expect = 1.928e-6
Identity = 30/103 (29.13%), Postives = 52/103 (50.49%), Query Frame = 2
Query:  605 CKLTEKEDYKRKSPRDQVLLHI--FILDLLMHP-YYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQL 904
            C  +E +D +R   R Q  +H+  FI +LL  P  Y  C+ W ++++ TF+I++S  +A  W   K     NY+  +R +R +     +  +  K  R VY+ 
Sbjct:  269 CNGSEGDDDERAYTRHQGTVHLWQFIRELLDQPKQYSACVRWVDRDEGTFKIESSLLLARYWGQRKNRSQMNYDKLSRSLR-QYYKKGIIQKPEKKQRLVYKF 370          
BLAST of Transcription factor ETV6 vs. Ensembl Celegans
Match: ets-4 (Transcription factor ets-4 [Source:UniProtKB/Swiss-Prot;Acc:A8WFJ9])

HSP 1 Score: 49.6766 bits (117), Expect = 1.928e-6
Identity = 30/103 (29.13%), Postives = 52/103 (50.49%), Query Frame = 2
Query:  605 CKLTEKEDYKRKSPRDQVLLHI--FILDLLMHP-YYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQL 904
            C  +E +D +R   R Q  +H+  FI +LL  P  Y  C+ W ++++ TF+I++S  +A  W   K     NY+  +R +R +     +  +  K  R VY+ 
Sbjct:  269 CNGSEGDDDERAYTRHQGTVHLWQFIRELLDQPKQYSACVRWVDRDEGTFKIESSLLLARYWGQRKNRSQMNYDKLSRSLR-QYYKKGIIQKPEKKQRLVYKF 370          
BLAST of Transcription factor ETV6 vs. Ensembl Celegans
Match: ets-4 (Transcription factor ets-4 [Source:UniProtKB/Swiss-Prot;Acc:A8WFJ9])

HSP 1 Score: 49.2914 bits (116), Expect = 2.223e-6
Identity = 30/103 (29.13%), Postives = 52/103 (50.49%), Query Frame = 2
Query:  605 CKLTEKEDYKRKSPRDQVLLHI--FILDLLMHP-YYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQL 904
            C  +E +D +R   R Q  +H+  FI +LL  P  Y  C+ W ++++ TF+I++S  +A  W   K     NY+  +R +R +     +  +  K  R VY+ 
Sbjct:  330 CNGSEGDDDERAYTRHQGTVHLWQFIRELLDQPKQYSACVRWVDRDEGTFKIESSLLLARYWGQRKNRSQMNYDKLSRSLR-QYYKKGIIQKPEKKQRLVYKF 431          
BLAST of Transcription factor ETV6 vs. Ensembl Zebrafish
Match: SPDEF (SAM pointed domain containing ETS transcription factor [Source:NCBI gene;Acc:100003543])

HSP 1 Score: 50.447 bits (119), Expect = 1.239e-6
Identity = 27/78 (34.62%), Postives = 41/78 (52.56%), Query Frame = 2
Query:  671 FILDLLMHPY-YGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQ 901
            F+ +LL+ P+ YG CI W NK    F+I++S  VA +W   K     NY+  +R IR +     +  + +   R VYQ
Sbjct:  244 FLRELLLKPHSYGRCIRWLNKEKGIFKIEDSAHVARLWGLRKNRPAMNYDKLSRSIR-QYYKKGIIRKPDVSQRLVYQ 320          
BLAST of Transcription factor ETV6 vs. TrEMBL
Match: A0A267FM46 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022108g1 PE=3 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.201e-7
Identity = 36/110 (32.73%), Postives = 55/110 (50.00%), Query Frame = 2
Query:  617 EKEDYKRKSPR------DQVLLHIFILDLLMHPYYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQLTKTAIHDY 928
            E   ++R +P        + ++H+F+L LL +      I W +K +  F++    A+A +W  IKGN T NYE FARGIR  R     F       + +Y+ +  AI DY
Sbjct:  574 EIRQFQRLAPELFCWHGQKPMIHLFLLKLLDNSRCRANIEWVDKYNRLFKVVTPSAIAKLWKHIKGNKTDNYECFARGIRHSRDIGRYFEPHGFRQKKIYKFSPKAIEDY 683          
BLAST of Transcription factor ETV6 vs. TrEMBL
Match: A0A267FLW3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005521g2 PE=3 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.203e-7
Identity = 36/110 (32.73%), Postives = 55/110 (50.00%), Query Frame = 2
Query:  617 EKEDYKRKSPR------DQVLLHIFILDLLMHPYYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQLTKTAIHDY 928
            E   ++R +P        + ++H+F+L LL +      I W +K +  F++    A+A +W  IKGN T NYE FARGIR  R     F       + +Y+ +  AI DY
Sbjct:  582 EIRQFQRLAPELFCWHGQKPMIHLFLLKLLDNSRCRANIEWVDKYNRLFKVVTPSAIAKLWKHIKGNKTDNYECFARGIRHSRDIGRYFEPHGFRQKKIYKFSPKAIEDY 691          
BLAST of Transcription factor ETV6 vs. TrEMBL
Match: A0A267GSY8 (ETS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005521g1 PE=3 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.204e-7
Identity = 36/110 (32.73%), Postives = 55/110 (50.00%), Query Frame = 2
Query:  617 EKEDYKRKSPR------DQVLLHIFILDLLMHPYYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQLTKTAIHDY 928
            E   ++R +P        + ++H+F+L LL +      I W +K +  F++    A+A +W  IKGN T NYE FARGIR  R     F       + +Y+ +  AI DY
Sbjct:  582 EIRQFQRLAPELFCWHGQKPMIHLFLLKLLDNSRCRANIEWVDKYNRLFKVVTPSAIAKLWKHIKGNKTDNYECFARGIRHSRDIGRYFEPHGFRQKKIYKFSPKAIEDY 691          
BLAST of Transcription factor ETV6 vs. TrEMBL
Match: A0A1I8HT79 (ETS domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 5.338e-7
Identity = 33/90 (36.67%), Postives = 48/90 (53.33%), Query Frame = 2
Query:  659 LLHIFILDLLMHPYYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQLTKTAIHDY 928
            ++H+F+L LL +      I W +K +  F++    A+A +W  IKGN T NYE FARGIR  R     F       + +Y+ +  AI DY
Sbjct:    1 MIHLFLLKLLDNSRCRANIEWVDKYNRLFKVVTPSAIAKLWKHIKGNKTDNYECFARGIRHSRDIGRYFEPHGFRQKKIYKFSPKAIEDY 90          
BLAST of Transcription factor ETV6 vs. TrEMBL
Match: A0A1I8ITS7 (ETS domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.086e-6
Identity = 33/90 (36.67%), Postives = 48/90 (53.33%), Query Frame = 2
Query:  659 LLHIFILDLLMHPYYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQLTKTAIHDY 928
            ++H+F+L LL +      I W +K +  F++    A+A +W  IKGN T NYE FARGIR  R     F       + +Y+ +  AI DY
Sbjct:  244 MIHLFLLKLLDNSRCRANIEWVDKYNRLFKVVTPSAIAKLWKHIKGNKTDNYECFARGIRHSRDIGRYFEPHGFRQKKIYKFSPKAIEDY 333          
BLAST of Transcription factor ETV6 vs. Ensembl Cavefish
Match: SPDEF (SAM pointed domain containing ETS transcription factor [Source:NCBI gene;Acc:103037006])

HSP 1 Score: 50.8322 bits (120), Expect = 1.005e-6
Identity = 27/78 (34.62%), Postives = 41/78 (52.56%), Query Frame = 2
Query:  671 FILDLLMHPY-YGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQ 901
            F+ +LL+ P+ YG CI W NK    F+I++S  VA +W   K     NY+  +R IR +     +  + +   R VYQ
Sbjct:  258 FLRELLLKPHSYGRCIRWLNKEKGIFKIEDSAHVARLWGLRKNRPAMNYDKLSRSIR-QYYKKGIIRKPDVSQRLVYQ 334          
BLAST of Transcription factor ETV6 vs. Ensembl Cavefish
Match: SPDEF (SAM pointed domain containing ETS transcription factor [Source:NCBI gene;Acc:103037006])

HSP 1 Score: 50.8322 bits (120), Expect = 1.005e-6
Identity = 27/78 (34.62%), Postives = 41/78 (52.56%), Query Frame = 2
Query:  671 FILDLLMHPY-YGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQ 901
            F+ +LL+ P+ YG CI W NK    F+I++S  VA +W   K     NY+  +R IR +     +  + +   R VYQ
Sbjct:  258 FLRELLLKPHSYGRCIRWLNKEKGIFKIEDSAHVARLWGLRKNRPAMNYDKLSRSIR-QYYKKGIIRKPDVSQRLVYQ 334          
BLAST of Transcription factor ETV6 vs. Ensembl Cavefish
Match: SPDEF (SAM pointed domain containing ETS transcription factor [Source:NCBI gene;Acc:103037006])

HSP 1 Score: 50.8322 bits (120), Expect = 1.005e-6
Identity = 27/78 (34.62%), Postives = 41/78 (52.56%), Query Frame = 2
Query:  671 FILDLLMHPY-YGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQ 901
            F+ +LL+ P+ YG CI W NK    F+I++S  VA +W   K     NY+  +R IR +     +  + +   R VYQ
Sbjct:  258 FLRELLLKPHSYGRCIRWLNKEKGIFKIEDSAHVARLWGLRKNRPAMNYDKLSRSIR-QYYKKGIIRKPDVSQRLVYQ 334          
BLAST of Transcription factor ETV6 vs. Ensembl Nematostella
Match: EDO45361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSZ8])

HSP 1 Score: 47.3654 bits (111), Expect = 3.056e-7
Identity = 26/70 (37.14%), Postives = 36/70 (51.43%), Query Frame = 2
Query:  638 KSPRDQVLLHI--FILDLLMHPYYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRF 841
            K PR +  +H+  F+L+LL    Y   I WS K    F++KN   VA  W  +K     NYE  +R IR+
Sbjct:    5 KRPRYKNTIHLWEFLLELLADERYSSLIAWSRKEYGEFKLKNQEEVAKRWGILKHRAGMNYEKLSRAIRY 74          
BLAST of Transcription factor ETV6 vs. Ensembl Medaka
Match: SPDEF (SAM pointed domain containing ETS transcription factor [Source:NCBI gene;Acc:101167865])

HSP 1 Score: 50.0618 bits (118), Expect = 1.531e-6
Identity = 27/78 (34.62%), Postives = 41/78 (52.56%), Query Frame = 2
Query:  671 FILDLLMHPY-YGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQ 901
            F+ +LL+ P+ YG CI W NK    F+I++S  VA +W   K     NY+  +R IR +     +  + +   R VYQ
Sbjct:  251 FLRELLLKPHNYGRCIRWLNKEKGIFKIEDSAHVARLWGLRKNRPAMNYDKLSRSIR-QYYKKGIIRKPDVSQRLVYQ 327          
BLAST of Transcription factor ETV6 vs. Planmine SMEST
Match: SMESG000035130.1 (SMESG000035130.1)

HSP 1 Score: 274.633 bits (701), Expect = 2.876e-158
Identity = 132/138 (95.65%), Postives = 133/138 (96.38%), Query Frame = 2
Query:  581 KDPTN---LKNCKLTEKEDYKRKSPRDQVLLHIFILDLLMHPYYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQLTKTAIHDYKVKRSKNELAKQLMEEALL 985
            KDP     +KNCKLTEKEDYKRKSPRDQVLLHIFILDLLMHPYYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQLTKTAIHDYKVKRSKNELAKQLMEEALL
Sbjct:  168 KDPIYDELIKNCKLTEKEDYKRKSPRDQVLLHIFILDLLMHPYYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQLTKTAIHDYKVKRSKNELAKQLMEEALL 305          

HSP 2 Score: 265.003 bits (676), Expect = 2.876e-158
Identity = 131/137 (95.62%), Postives = 133/137 (97.08%), Query Frame = 1
Query:  190 ELKEFFSVYSKILVTYDDEDENNLESFDMSNDCMELCRPLIDSSILSKFIRYMCSKENEFFSETFCHKYFKRSRFSEYPEELINLNRVDAWNIDWAYGLVYQAFIAQEYNLELPCLKKRNRKIPIIGEKLKRSYKSK 600
            E++EFF  YSKILV YDDEDEN LESFDMSNDCMELCRPLIDSSILSKFIRYMCSKENEFFSETFCHKYFKRSRFSEYPEELINLNRVDAWNIDWAYGLVYQAFIAQEYNLELPCLKKRNRKIPIIGEKLKRSYKSK
Sbjct:   29 EVEEFF--YSKILVAYDDEDENYLESFDMSNDCMELCRPLIDSSILSKFIRYMCSKENEFFSETFCHKYFKRSRFSEYPEELINLNRVDAWNIDWAYGLVYQAFIAQEYNLELPCLKKRNRKIPIIGEKLKRSYKSK 163          

HSP 3 Score: 61.2326 bits (147), Expect = 2.876e-158
Identity = 29/30 (96.67%), Postives = 29/30 (96.67%), Query Frame = 3
Query:   51 MKINITMAFDPLLINVTSYDLFYGDDYSEV 140
            MKINITMAFDPLLINVTS DLFYGDDYSEV
Sbjct:    1 MKINITMAFDPLLINVTSSDLFYGDDYSEV 30          
BLAST of Transcription factor ETV6 vs. Planmine SMEST
Match: SMESG000035130.1 (SMESG000035130.1)

HSP 1 Score: 274.633 bits (701), Expect = 1.022e-154
Identity = 132/138 (95.65%), Postives = 133/138 (96.38%), Query Frame = 2
Query:  581 KDPTN---LKNCKLTEKEDYKRKSPRDQVLLHIFILDLLMHPYYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQLTKTAIHDYKVKRSKNELAKQLMEEALL 985
            KDP     +KNCKLTEKEDYKRKSPRDQVLLHIFILDLLMHPYYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQLTKTAIHDYKVKRSKNELAKQLMEEALL
Sbjct:  162 KDPIYDELIKNCKLTEKEDYKRKSPRDQVLLHIFILDLLMHPYYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQLTKTAIHDYKVKRSKNELAKQLMEEALL 299          

HSP 2 Score: 264.618 bits (675), Expect = 1.022e-154
Identity = 131/137 (95.62%), Postives = 133/137 (97.08%), Query Frame = 1
Query:  190 ELKEFFSVYSKILVTYDDEDENNLESFDMSNDCMELCRPLIDSSILSKFIRYMCSKENEFFSETFCHKYFKRSRFSEYPEELINLNRVDAWNIDWAYGLVYQAFIAQEYNLELPCLKKRNRKIPIIGEKLKRSYKSK 600
            E++EFF  YSKILV YDDEDEN LESFDMSNDCMELCRPLIDSSILSKFIRYMCSKENEFFSETFCHKYFKRSRFSEYPEELINLNRVDAWNIDWAYGLVYQAFIAQEYNLELPCLKKRNRKIPIIGEKLKRSYKSK
Sbjct:   23 EVEEFF--YSKILVAYDDEDENYLESFDMSNDCMELCRPLIDSSILSKFIRYMCSKENEFFSETFCHKYFKRSRFSEYPEELINLNRVDAWNIDWAYGLVYQAFIAQEYNLELPCLKKRNRKIPIIGEKLKRSYKSK 157          

HSP 3 Score: 49.2914 bits (116), Expect = 1.022e-154
Identity = 23/24 (95.83%), Postives = 23/24 (95.83%), Query Frame = 3
Query:   69 MAFDPLLINVTSYDLFYGDDYSEV 140
            MAFDPLLINVTS DLFYGDDYSEV
Sbjct:    1 MAFDPLLINVTSSDLFYGDDYSEV 24          
BLAST of Transcription factor ETV6 vs. Planmine SMEST
Match: SMESG000069597.1 (SMESG000069597.1)

HSP 1 Score: 112.849 bits (281), Expect = 3.419e-35
Identity = 55/102 (53.92%), Postives = 69/102 (67.65%), Query Frame = 2
Query:  635 RKSPRDQVLLHIFILDLLMHPYYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQLTKTAIHDYKVKR 940
            R +PR+Q+ L IFILDLL HPYY  CI W +K    F+I NS+ VA+ WM +K NDTCN+ENFARGIR+ RR    F + NK  +  YQ  K AI +Y+ KR
Sbjct:  175 RDAPRNQIGLLIFILDLLNHPYYKGCIRWVDKGSLIFKIINSKLVAYYWMVVKENDTCNFENFARGIRYLRR-VGFFKQINKKAQRTYQFNKKAIKEYEKKR 275          

HSP 2 Score: 54.6842 bits (130), Expect = 3.419e-35
Identity = 34/109 (31.19%), Postives = 56/109 (51.38%), Query Frame = 1
Query:  256 NLES--FDMSNDCMELCRPLIDSSILSKFIRYMCSKENEFFSETFCHKYFKRSRFSEYPEELINLNRVDAWNIDWAYGLVYQAFIAQEYNLELPCLKKRNRKIPIIGEK 576
            NLE    D ++ C++   P     I + F+ +M S+E   + ETF  KYF  + +    + ++   R   W  +  YGL  QA+I    ++ LP + +RNRK PI+ +K
Sbjct:   35 NLEETLIDETDICVDYICPEDSIIIQNNFVNFMKSQELHLYKETFIEKYF--TSYKCPTDHIVQRTRTQLWMENCIYGLQLQAYICMVKDIPLPIVPQRNRKQPILKKK 141          
BLAST of Transcription factor ETV6 vs. Planmine SMEST
Match: SMESG000069596.1 (SMESG000069596.1)

HSP 1 Score: 107.457 bits (267), Expect = 1.540e-29
Identity = 52/113 (46.02%), Postives = 73/113 (64.60%), Query Frame = 2
Query:  635 RKSPRDQVLLHIFILDLLMHPYYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQLTKTAIHDYKVKRSKNELAKQLME 973
            R +PR+Q+ +  FILDLL HPY+  CI W +K   TF+I NS+ VA+ WM +K NDTC++ENFARGIR+  R+   F + +   +  YQ  K +I  YK KR  N L + L++
Sbjct:  207 RDAPRNQIGMLTFILDLLNHPYFEPCIKWEDKKSLTFKIINSKLVAYYWMIVKENDTCSFENFARGIRY-LRHWGYFKQIDMKKQRTYQFNKKSIQTYKSKRQNNNLTRVLID 318          

HSP 2 Score: 40.817 bits (94), Expect = 1.540e-29
Identity = 26/83 (31.33%), Postives = 45/83 (54.22%), Query Frame = 1
Query:  316 SSILSKFIRYMCSKENEFFSETFCHKYFKRSRFSEYPEELINLNRVDAWNIDWAYGLVYQAFIAQEYNLELPCLKKRNRKIPI 564
            SSI   FI  + + E + F++TF  KYF    ++   ++++  +R   W  +  YGL  Q +I    +  +P ++ RNRK+PI
Sbjct:   90 SSIQKDFINLVKNYELKEFNKTFVEKYF--ILYNCPLDDILKKSRSQLWMDNCIYGLQLQVYICMVNDYPIPTVQHRNRKVPI 170          
BLAST of Transcription factor ETV6 vs. Planmine SMEST
Match: SMESG000069596.1 (SMESG000069596.1)

HSP 1 Score: 107.842 bits (268), Expect = 1.751e-29
Identity = 52/113 (46.02%), Postives = 73/113 (64.60%), Query Frame = 2
Query:  635 RKSPRDQVLLHIFILDLLMHPYYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIRFKRRNSNMFTRTNKHNRCVYQLTKTAIHDYKVKRSKNELAKQLME 973
            R +PR+Q+ +  FILDLL HPY+  CI W +K   TF+I NS+ VA+ WM +K NDTC++ENFARGIR+  R+   F + +   +  YQ  K +I  YK KR  N L + L++
Sbjct:  136 RDAPRNQIGMLTFILDLLNHPYFEPCIKWEDKKSLTFKIINSKLVAYYWMIVKENDTCSFENFARGIRY-LRHWGYFKQIDMKKQRTYQFNKKSIQTYKSKRQNNNLTRVLID 247          

HSP 2 Score: 40.4318 bits (93), Expect = 1.751e-29
Identity = 26/83 (31.33%), Postives = 45/83 (54.22%), Query Frame = 1
Query:  316 SSILSKFIRYMCSKENEFFSETFCHKYFKRSRFSEYPEELINLNRVDAWNIDWAYGLVYQAFIAQEYNLELPCLKKRNRKIPI 564
            SSI   FI  + + E + F++TF  KYF    ++   ++++  +R   W  +  YGL  Q +I    +  +P ++ RNRK+PI
Sbjct:   19 SSIQKDFINLVKNYELKEFNKTFVEKYF--ILYNCPLDDILKKSRSQLWMDNCIYGLQLQVYICMVNDYPIPTVQHRNRKVPI 99          
The following BLAST results are available for this feature:
BLAST of Transcription factor ETV6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor ETV6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ets-74.120e-735.71ETS class transcription factor [Source:UniProtKB/... [more]
ets-41.928e-629.13Transcription factor ets-4 [Source:UniProtKB/Swis... [more]
ets-41.928e-629.13Transcription factor ets-4 [Source:UniProtKB/Swis... [more]
ets-41.928e-629.13Transcription factor ets-4 [Source:UniProtKB/Swis... [more]
ets-42.223e-629.13Transcription factor ets-4 [Source:UniProtKB/Swis... [more]
back to top
BLAST of Transcription factor ETV6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor ETV6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SPDEF1.239e-634.62SAM pointed domain containing ETS transcription fa... [more]
back to top
BLAST of Transcription factor ETV6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor ETV6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor ETV6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor ETV6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FM461.201e-732.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FLW31.203e-732.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GSY81.204e-732.73ETS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8HT795.338e-736.67ETS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8ITS71.086e-636.67ETS domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of Transcription factor ETV6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SPDEF1.005e-634.62SAM pointed domain containing ETS transcription fa... [more]
SPDEF1.005e-634.62SAM pointed domain containing ETS transcription fa... [more]
SPDEF1.005e-634.62SAM pointed domain containing ETS transcription fa... [more]
back to top
BLAST of Transcription factor ETV6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor ETV6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transcription factor ETV6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO453613.056e-737.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcription factor ETV6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SPDEF1.531e-634.62SAM pointed domain containing ETS transcription fa... [more]
back to top
BLAST of Transcription factor ETV6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035130.12.876e-15895.65SMESG000035130.1[more]
SMESG000035130.11.022e-15495.65SMESG000035130.1[more]
SMESG000069597.13.419e-3553.92SMESG000069597.1[more]
SMESG000069596.11.540e-2946.02SMESG000069596.1[more]
SMESG000069596.11.751e-2946.02SMESG000069596.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016899 ID=SMED30016899|Name=Transcription factor ETV6|organism=Schmidtea mediterranea sexual|type=transcript|length=1052bp
TGGTTGATTTCGCTTTATTATAAAAATGTATATATTAAATTGTATAGTTT
ATGAAAATTAATATAACAATGGCTTTTGATCCATTGTTAATAAATGTGAC
AAGCTACGATTTGTTTTATGGAGATGACTATAGTGAAGTTGAGGAATTCT
GTAATTCGTTTTTGTTTCTATTTTGTTTTTCTTTCAATAGAATTAAAAGA
ATTTTTTTCAGTTTATTCAAAAATTCTGGTCACATATGATGATGAAGATG
AGAATAATTTGGAAAGTTTTGACATGTCAAATGACTGCATGGAGTTATGC
CGACCACTAATTGATAGCTCTATTTTATCAAAATTTATCAGATACATGTG
TTCTAAGGAAAATGAATTTTTCTCAGAAACATTCTGCCATAAATATTTTA
AAAGATCTCGATTTTCTGAATACCCGGAAGAATTGATCAACCTTAATAGA
GTTGACGCTTGGAATATCGACTGGGCGTATGGCCTAGTATATCAGGCATT
TATAGCCCAAGAATACAATCTAGAATTGCCTTGTCTTAAAAAAAGAAATA
GAAAAATTCCAATTATCGGGGAAAAACTGAAAAGATCCTACAAATCTAAA
GAATTGTAAATTAACGGAAAAAGAAGACTATAAAAGAAAGTCACCGAGAG
ATCAAGTGTTGTTGCACATTTTTATCCTTGATCTTTTGATGCATCCTTAT
TATGGGTTTTGTATAACATGGAGTAATAAAAATGATTTCACTTTTGAAAT
CAAGAATTCTCGAGCAGTTGCACATATCTGGATGACTATTAAAGGAAATG
ACACCTGCAACTATGAAAATTTTGCTAGAGGAATACGTTTCAAACGACGA
AACAGTAACATGTTTACAAGGACAAATAAGCACAATAGATGTGTTTACCA
ATTGACAAAGACCGCCATTCATGATTACAAGGTCAAACGCAGTAAAAATG
AATTAGCAAAACAATTGATGGAAGAAGCTCTGTTATGATAATATTAAAGA
AAAACCCGATATACTTTCGAACTTGGCTGGGAATAATTTCAGCATAGCAT
GA
back to top

protein sequence of SMED30016899-orf-1

>SMED30016899-orf-1 ID=SMED30016899-orf-1|Name=SMED30016899-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=164bp
MEMTIVKLRNSVIRFCFYFVFLSIELKEFFSVYSKILVTYDDEDENNLES
FDMSNDCMELCRPLIDSSILSKFIRYMCSKENEFFSETFCHKYFKRSRFS
EYPEELINLNRVDAWNIDWAYGLVYQAFIAQEYNLELPCLKKRNRKIPII
GEKLKRSYKSKEL*
back to top

protein sequence of SMED30016899-orf-2

>SMED30016899-orf-2 ID=SMED30016899-orf-2|Name=SMED30016899-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=100bp
MHPYYGFCITWSNKNDFTFEIKNSRAVAHIWMTIKGNDTCNYENFARGIR
FKRRNSNMFTRTNKHNRCVYQLTKTAIHDYKVKRSKNELAKQLMEEALL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
Vocabulary: INTERPRO
TermDefinition
IPR000418Ets_dom
IPR011991WHTH_DNA-bd_dom
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus