Copine-3

Overview
NameCopine-3
Smed IDSMED30016898
Length (bp)1922
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Copine-3 (SMED30016898) t-SNE clustered cells

Violin plots show distribution of expression levels for Copine-3 (SMED30016898) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Copine-3 (SMED30016898) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Copine-3 (SMED30016898) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016898

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30016898SMESG000043402.1 SmedASXL_017099SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30016898SMESG000043402.1 dd_Smed_v4_12323_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30016898SMESG000043402.1 dd_Smed_v6_12323_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Copine-3 vs. Ensembl Human
Match: CPNE5 (copine 5 [Source:HGNC Symbol;Acc:HGNC:2318])

HSP 1 Score: 328.946 bits (842), Expect = 7.306e-104
Identity = 203/563 (36.06%), Postives = 307/563 (54.53%), Query Frame = 1
Query:   13 SKVIISVGCRHL----------PLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKP---------------TFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDV 1608
            +KV I+V CR+L          PL V+         G E     ++  +TE ++ T NPDF  + +V+Y FEEKQ L   ++  DS S    +    G  F  +G I+ + GS +E P+ I +  LN+   KP               T I+  +E S  ++   M+     LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W++  I +  LC+GD ++ I    +DWD         D   D  IGE   + + L   ++   I +++N KK+ KK+ Y+NSG + +++       TFLDY+  G  +NF VA+D +    N   Q  S+   +   Q N Y +A+ AV EI+Q YD+D +FPA GFGA++PPD +  HE+PLNG+ +N  C G+DG+L AY  +L+TV+      F PV+  V   A    DGS Y VLLI+T+G + D  +TK A++ A+ LP+SII+VG+G   F  M  LD D   +    + A RD VQFVP R ++    D +     +   LA++VLAE+PDQLV+YMK   +
Sbjct:   23 TKVEITVSCRNLLDKDMFSKSDPLCVMYTQ------GMEN-KQWREFGRTEVIDNTLNPDFVRKFIVDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQAFCTLGEIVGSPGSRLEKPLTIGAFSLNSRTGKPMPAVSNGGVPGKKCGTIILSAEELSNCRDVATMQFCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVMKNTLNPVWQTFSIPVRALCNGDYDRTIKVEVYDWD--------RDGSHD-FIGEFTTSYRELARGQSQFNIYEVVNPKKKMKKKKYVNSGTVTLLSFAVESECTFLDYIKGGTQINFTVAIDFTASNGN-PSQSTSLHYMS-PYQLNAYALALTAVGEIIQHYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYGPTNFAPVVTHVARNAAAVQDGSQYSVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYV----DRTGNHVLSMARLARDVLAEIPDQLVSYMKAQGI 563          
BLAST of Copine-3 vs. Ensembl Human
Match: CPNE9 (copine family member 9 [Source:HGNC Symbol;Acc:HGNC:24336])

HSP 1 Score: 322.398 bits (825), Expect = 7.655e-102
Identity = 192/543 (35.36%), Postives = 310/543 (57.09%), Query Frame = 1
Query:   13 SKVIISVGCRHL-PLEVIRAY--RVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQ----EKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKP--TFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +K+ I+V CR+L  L+        V L          ++  +TE ++ T NPDF  + V++Y FEEKQ L   ++  DS +     +   G  F  +G +I   GS     ++E   L  +  K   T ++  +E S  ++   M++    LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W+   I +  LC+GD ++ +    +DWD         D   D  IGE   + + L +++N   + +++N +K+ KK+ Y+NSG + +++      +TF+DY+  G  LNF VA+D +    N   Q  S+   +   Q + Y +A+KAV EI+Q+YD+D LFPA+GFGA++PP+ +  H++PLN + ++  C G++GVL +Y  +L+TV+      F PVI QV   A +  DGS Y+VLLI+T+G + D  +TK A++ ASSLP+SII+VG+G   F  M+ LD D   +      A RD VQFVP R ++    D S     +   LAK+VLAE+P+QL++YM+  D++
Sbjct:   14 TKIEITVSCRNLLDLDTFSKSDPMVVLYTQSRASQEWREFGRTEVIDNTLNPDFVRKFVLDYFFEEKQNLRFDVYNVDSKTNISKPKDFLGQAFLALGEVIGGQGS-----RVERT-LTGVPGKKCGTILLTAEELSNCRDIATMQLCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFSIPVRALCNGDYDRTVKIDVYDWD--------RDGSHD-FIGEFTTSYRELSKAQNQFTVYEVLNPRKKCKKKKYVNSGTVTLLSFSVDSEFTFVDYIKGGTQLNFTVAIDFTASNGN-PLQPTSLHYMS-PYQLSAYAMALKAVGEIIQDYDSDKLFPAYGFGAKLPPEGRISHQFPLNNNDEDPNCAGIEGVLESYFQSLRTVQLYGPTYFAPVINQVARAAAKISDGSQYYVLLIITDGVISDMTQTKEAIVSASSLPMSIIIVGVGPAMFEAMEELDGDDVRVSSRGRYAERDIVQFVPFRDYV----DRSGNQVLSMARLAKDVLAEIPEQLLSYMRTRDIQ 535          
BLAST of Copine-3 vs. Ensembl Human
Match: CPNE8 (copine 8 [Source:HGNC Symbol;Acc:HGNC:23498])

HSP 1 Score: 320.087 bits (819), Expect = 7.689e-101
Identity = 193/549 (35.15%), Postives = 304/549 (55.37%), Query Frame = 1
Query:   13 SKVIISVGCRHL----------PLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            ++V +SV CR+L          P+ V+    V       G    ++  +TE ++ T NPDF  + +++Y FEE++ L   ++  DS S    +    G  F  +G I+ + GS +E PI          K   T I+  +E +  ++  +M+     LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W++  I +  LC+GD ++ I    +DWD         D   D  IGE   + + L   ++   + +++N KK+ KK+ Y NSG + +++       +FLDY+  G  +NF VA+D +    N   Q  S+   N   Q N Y +A+KAV EI+Q+YD+D +FPA GFGA++PPD +  HE+ LNG+ QN +C G++GV+ AY  +LK+V+      F PVI  V   A    DGS YFVLLI+T+G + D  +TK +++ AS LP+SII+VG+G   F  M  LD D   +    + A RD VQFVP R ++    D S     +   LAK+VLAE+P+Q ++YM+   ++
Sbjct:   24 TRVEVSVSCRNLLDRDTFSKSDPICVLYVQGV-------GNKEWREFGRTEVIDNTLNPDFVRKFILDYFFEERENLRFDLYDVDSKSPNLSKHDFLGQVFCTLGEIVGSQGSRLEKPIVGIPG-----KKCGTIILTAEELNCCRDAVLMQFCANKLDKKDFFGKSDPFLVFYRSNEDGSFTICHKTEVVKNTLNPVWQAFKISVRALCNGDYDRTIKVEVYDWD--------RDGSHD-FIGEFTTSYRELSRGQSQFNVYEVVNPKKKGKKKKYTNSGTVTLLSFLVETEVSFLDYIKGGTQINFTVAIDFTASNGN-PAQPTSLHYMN-PYQLNAYGMALKAVGEIVQDYDSDKMFPALGFGAKLPPDGRISHEFALNGNPQNPYCDGIEGVMEAYYRSLKSVQLYGPTNFAPVINHVARYASSVKDGSQYFVLLIVTDGVISDMAQTKESIVNASKLPMSIIIVGVGPAEFDAMVELDGDDVRVSSRGKYAERDIVQFVPFRDYI----DRSGNHILSMARLAKDVLAEIPEQFLSYMRARGIK 545          
BLAST of Copine-3 vs. Ensembl Human
Match: CPNE8 (copine 8 [Source:HGNC Symbol;Acc:HGNC:23498])

HSP 1 Score: 316.62 bits (810), Expect = 1.017e-99
Identity = 183/501 (36.53%), Postives = 286/501 (57.09%), Query Frame = 1
Query:  127 KTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +TE ++ T NPDF  + +++Y FEE++ L   ++  DS S    +    G  F  +G I+ + GS +E PI          K   T I+  +E +  ++  +M+     LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W++  I +  LC+GD ++ I    +DWD         D   D  IGE   + + L   ++   + +++N KK+ KK+ Y NSG + +++       +FLDY+  G  +NF VA+D +    N   Q  S+   N   Q N Y +A+KAV EI+Q+YD+D +FPA GFGA++PPD +  HE+ LNG+ QN +C G++GV+ AY  +LK+V+      F PVI  V   A    DGS YFVLLI+T+G + D  +TK +++ AS LP+SII+VG+G   F  M  LD D   +    + A RD VQFVP R ++    D S     +   LAK+VLAE+P+Q ++YM+   ++
Sbjct:   53 RTEVIDNTLNPDFVRKFILDYFFEERENLRFDLYDVDSKSPNLSKHDFLGQVFCTLGEIVGSQGSRLEKPIVGIPG-----KKCGTIILTAEELNCCRDAVLMQFCANKLDKKDFFGKSDPFLVFYRSNEDGSFTICHKTEVVKNTLNPVWQAFKISVRALCNGDYDRTIKVEVYDWD--------RDGSHD-FIGEFTTSYRELSRGQSQFNVYEVVNPKKKGKKKKYTNSGTVTLLSFLVETEVSFLDYIKGGTQINFTVAIDFTASNGN-PAQPTSLHYMN-PYQLNAYGMALKAVGEIVQDYDSDKMFPALGFGAKLPPDGRISHEFALNGNPQNPYCDGIEGVMEAYYRSLKSVQLYGPTNFAPVINHVARYASSVKDGSQYFVLLIVTDGVISDMAQTKESIVNASKLPMSIIIVGVGPAEFDAMVELDGDDVRVSSRGKYAERDIVQFVPFRDYI----DRSGNHILSMARLAKDVLAEIPEQFLSYMRARGIK 533          
BLAST of Copine-3 vs. Ensembl Human
Match: CPNE2 (copine 2 [Source:HGNC Symbol;Acc:HGNC:2315])

HSP 1 Score: 303.138 bits (775), Expect = 1.637e-94
Identity = 192/494 (38.87%), Postives = 285/494 (57.69%), Query Frame = 1
Query:  151 NPDFTSQLVVEYVFEEKQILAATIFYQDSASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTF--IIKLKEDSVKKNNFM-MKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVI-IQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCD---GSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKV-GNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDV 1608
            NP F+ + V++Y FEE Q L   +F QD +S  ++  H F  +G+   + G+I    KI +  L  + +KP    +I +    +  N  + + ++G  LDKKDLFGKSDP++  +K  D GKW+  +RTE+IK  L+P WK   + L  LCDGD+ K I   C+D+D   G          + IGE   +   + E+ ++  +  + IN KKQ+KK++Y NSG I + +    ++Y+FLDY+  G  L F V +D +    N  D   S+   N    +NEY  AI AV +I+Q+YD+D +FPA GFGAQ+PPD+K  HE+ +N +  N FC GVDG+ +AY   L  ++      F+P++  V   A +       + YF+LLI+T+G + D  ET+ AV++AS LP+SII+VG+G+  F  M+ LD D  +L+    E+A+RD VQFVP R+F R AA         K  LAK VLAELP Q+V Y K  ++
Sbjct:   72 NPAFSKKFVLDYHFEEVQKLKFALFDQDKSSM-RLDEHDF--LGQFSCSLGTIVSSKKI-TRPLLLLNDKPAGKGLITIAAQELSDNRVITLSLAGRRLDKKDLFGKSDPFLEFYKPGDDGKWMLVHRTEVIKYTLDPVWKPFTVPLVSLCDGDMEKPIQVMCYDYDNDGGH---------DFIGEFQTSVSQMCEARDSVPLEFECINPKKQRKKKNYKNSGIIILRSCKINRDYSFLDYILGGCQLMFTVGIDFTASNGNPLDP-SSLHYIN-PMGTNEYLSAIWAVGQIIQDYDSDKMFPALGFGAQLPPDWKVSHEFAINFNPTNPFCSGVDGIAQAYSACLPHIRFYGPTNFSPIVNHVARFAAQATQQRTATQYFILLIITDGVISDMEETRHAVVQASKLPMSIIIVGVGNADFAAMEFLDGDSRMLRSHTGEEAARDIVQFVPFREF-RNAA---------KETLAKAVLAELPQQVVQYFKHKNL 540          
BLAST of Copine-3 vs. Ensembl Celegans
Match: nra-1 (Nicotinic receptor-associated protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUB9])

HSP 1 Score: 239.195 bits (609), Expect = 6.015e-70
Identity = 174/513 (33.92%), Postives = 258/513 (50.29%), Query Frame = 1
Query:  151 NPDFTSQLVVEYVFEEKQILAATIFYQDSAS-QEKIYGHCFSNMGRI------IHNGGSIEVPI----KIESNELNNMKNKPTFIIKL-KEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFD---WDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYIN-SGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHC-DGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAAD---GSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVRLKFCDN 1629
            NP FT   ++ Y FEE Q+L   I+  DS +  + +  H F  +GR       I +  +++  +    +I +   N  KN  T  I +  E+  K       + G  LDKKD FGKSDPY+   +K D G     +RTE+    L+P W ++ I    LC  D ++ I+  C+D   W   E    D     D+LIG +  T   L+   ++ V I L N KK+ KK      SG ++I     +   TFLD++  G  L+F VAVD +    N   +  S   F    + N+YE+A+++V+ I Q Y++   F AFGFGA++P        +PL+     +   G+ GV+ AY+ AL  V+      F P+I  V   A+    D + Y +LLI+T+G + D   T R++I AS LP+SII++G+G+  F  M  LD D  LL+  +  A RD VQFV MR+FL            I+ N   LA+EVL E+P QL  YMKQ   + +  D+
Sbjct:   80 NPQFTKTFLLPYFFEETQLLRFEIYDADSPTVGQDLSSHDF--LGRFECVLAQIVSYSTLKAHLGKTGQIGAQWRNKDKNTKTGSITIYAEEDEKAEKIQFDVCGEGLDKKDFFGKSDPYLNFKRKFDDGSTHLIHRTEVKPKTLDPRWATVQINTQTLCAKDGDRPIIIECYDHDKWKKGEEPRGDAKFSRDDLIGTAQTTLNELLRGSSDAVEILLTNEKKKAKKGDKYKCSGTLKIWNSRIVIEPTFLDFISGGTQLDFAVAVDFTAS--NGPPKSSSSLHFMSADRPNQYELALRSVLSICQHYNSSKTFEAFGFGAKLPNQSSVSAIFPLDLQRGTSEVVGITGVMTAYRHALSNVQLYGPTNFAPIIENVARKAQNMIHDSARYQILLIITDGIISDMHATIRSIISASGLPLSIIIIGVGNEDFEKMHELDSDDALLQQDSRIAQRDIVQFVTMREFLNNGQGLYLDPDVIQEN---LAREVLYEVPAQLTGYMKQRGFQPRPVDD 585          
BLAST of Copine-3 vs. Ensembl Celegans
Match: nra-1 (Nicotinic receptor-associated protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUB9])

HSP 1 Score: 234.187 bits (596), Expect = 3.067e-68
Identity = 172/510 (33.73%), Postives = 257/510 (50.39%), Query Frame = 1
Query:  151 NPDFTSQLVVEYVFEEKQILAATIFYQDSAS-QEKIYGHCFSNMGRI------IHNGGSIEVPI----KIESNELNNMKNKPTFIIKL-KEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYIN-SGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHC-DGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAAD---GSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVRLKFCDN 1629
            NP FT   ++ Y FEE Q+L   I+  DS +  + +  H F  +GR       I +  +++  +    +I +   N  KN  T  I +  E+  K       + G  LDKKD FGKSDPY+   +K D G     +RTE+    L+P W ++ I    LC  D ++ I+  C+D D  + D         +LIG +  T   L+   ++ V I L N KK+ KK      SG ++I     +   TFLD++  G  L+F VAVD +    N   +  S   F    + N+YE+A+++V+ I Q Y++   F AFGFGA++P        +PL+     +   G+ GV+ AY+ AL  V+      F P+I  V   A+    D + Y +LLI+T+G + D   T R++I AS LP+SII++G+G+  F  M  LD D  LL+  +  A RD VQFV MR+FL            I+ N   LA+EVL E+P QL  YMKQ   + +  D+
Sbjct:   80 NPQFTKTFLLPYFFEETQLLRFEIYDADSPTVGQDLSSHDF--LGRFECVLAQIVSYSTLKAHLGKTGQIGAQWRNKDKNTKTGSITIYAEEDEKAEKIQFDVCGEGLDKKDFFGKSDPYLNFKRKFDDGSTHLIHRTEVKPKTLDPRWATVQINTQTLCAKDGDRPIIIECYDHDKWKKD---------DLIGTAQTTLNELLRGSSDAVEILLTNEKKKAKKGDKYKCSGTLKIWNSRIVIEPTFLDFISGGTQLDFAVAVDFTAS--NGPPKSSSSLHFMSADRPNQYELALRSVLSICQHYNSSKTFEAFGFGAKLPNQSSVSAIFPLDLQRGTSEVVGITGVMTAYRHALSNVQLYGPTNFAPIIENVARKAQNMIHDSARYQILLIITDGIISDMHATIRSIISASGLPLSIIIIGVGNEDFEKMHELDSDDALLQQDSRIAQRDIVQFVTMREFLNNGQGLYLDPDVIQEN---LAREVLYEVPAQLTGYMKQRGFQPRPVDD 573          
BLAST of Copine-3 vs. Ensembl Celegans
Match: gem-4 (Gon-2 Extragenic Modifier [Source:UniProtKB/TrEMBL;Acc:Q22422])

HSP 1 Score: 230.72 bits (587), Expect = 6.573e-67
Identity = 166/505 (32.87%), Postives = 258/505 (51.09%), Query Frame = 1
Query:  151 NPDFTSQLVVEYVFEEKQILAATIFYQDSAS-QEKIYGHCFSNMGRI--------------IHNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENN--TVIIQLINHKKQKKKRSYI-NSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQV-NSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADG---SKTIRWNKVALAKEVLAELPDQLVAYMKQ 1599
            NP F +  ++ Y FEE Q+    ++  DS      + GH F  +GR                H GG   +  + ++ +   +    +  I+ +ED  K       + G  LD+KD FGKSDPY+   ++ D G     ++TE+    LNP W ++ I    LC  ++++ I+  C+D +  +        + D++IG +  T   LIE      +  I LIN KK+ KK +   NSG ++I     +   TFLD++  G  L+F VAVD +    N   +      +  T   N+YE+A+++V+ I Q Y++   F A+GFGA++P        +PL+ + Q++   G++GV+ AY+ AL+ V       F+P+I +V N   K     + Y +LLI+T+G + D   T   VI AS LP+SII++G+G+  F  M  LD D  LL+  +  A RD VQFV MR FL   + G   + TI  N   LA+EVL E+PDQL  YMK+
Sbjct:   81 NPQFKTTFLIPYFFEETQLFRFELYDVDSPKVGADMSGHDF--LGRFECVLAQIVSYSTLRAHLGGKHSIGAQWKNKD--KVSKNGSITIRAEEDE-KNEKIQFDVCGEKLDRKDFFGKSDPYLNFKRRFDDGSSHMIHQTEVKPKTLNPRWSTVLISTQALCGKNMDRPIIIECYDHEKFK--------KQDDIIGTAQTTLNTLIEQAGGGESTQIPLINEKKKLKKGAKYKNSGMLKIWNAKLVLEPTFLDFIAGGTQLDFAVAVDFTASNGN--PRTPGSLHYMATGIPNQYEIALRSVLTICQHYNSSKTFEAYGFGAKLPNHQTVSAVFPLDLNRQSSSVVGINGVMNAYRHALQNVTLYGPTNFSPIIVEVANKAQKMMKTTARYQILLIITDGIISDMYATINTVINASGLPLSIIIIGVGNEDFERMHELDSDDALLQQDSRIAERDIVQFVTMRDFLGNQSGGYLNTDTIMEN---LAREVLYEVPDQLTGYMKR 567          
BLAST of Copine-3 vs. Ensembl Celegans
Match: gem-4 (Gon-2 Extragenic Modifier [Source:UniProtKB/TrEMBL;Acc:Q22422])

HSP 1 Score: 230.72 bits (587), Expect = 6.573e-67
Identity = 166/505 (32.87%), Postives = 258/505 (51.09%), Query Frame = 1
Query:  151 NPDFTSQLVVEYVFEEKQILAATIFYQDSAS-QEKIYGHCFSNMGRI--------------IHNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENN--TVIIQLINHKKQKKKRSYI-NSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQV-NSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADG---SKTIRWNKVALAKEVLAELPDQLVAYMKQ 1599
            NP F +  ++ Y FEE Q+    ++  DS      + GH F  +GR                H GG   +  + ++ +   +    +  I+ +ED  K       + G  LD+KD FGKSDPY+   ++ D G     ++TE+    LNP W ++ I    LC  ++++ I+  C+D +  +        + D++IG +  T   LIE      +  I LIN KK+ KK +   NSG ++I     +   TFLD++  G  L+F VAVD +    N   +      +  T   N+YE+A+++V+ I Q Y++   F A+GFGA++P        +PL+ + Q++   G++GV+ AY+ AL+ V       F+P+I +V N   K     + Y +LLI+T+G + D   T   VI AS LP+SII++G+G+  F  M  LD D  LL+  +  A RD VQFV MR FL   + G   + TI  N   LA+EVL E+PDQL  YMK+
Sbjct:   81 NPQFKTTFLIPYFFEETQLFRFELYDVDSPKVGADMSGHDF--LGRFECVLAQIVSYSTLRAHLGGKHSIGAQWKNKD--KVSKNGSITIRAEEDE-KNEKIQFDVCGEKLDRKDFFGKSDPYLNFKRRFDDGSSHMIHQTEVKPKTLNPRWSTVLISTQALCGKNMDRPIIIECYDHEKFK--------KQDDIIGTAQTTLNTLIEQAGGGESTQIPLINEKKKLKKGAKYKNSGMLKIWNAKLVLEPTFLDFIAGGTQLDFAVAVDFTASNGN--PRTPGSLHYMATGIPNQYEIALRSVLTICQHYNSSKTFEAYGFGAKLPNHQTVSAVFPLDLNRQSSSVVGINGVMNAYRHALQNVTLYGPTNFSPIIVEVANKAQKMMKTTARYQILLIITDGIISDMYATINTVINASGLPLSIIIIGVGNEDFERMHELDSDDALLQQDSRIAERDIVQFVTMRDFLGNQSGGYLNTDTIMEN---LAREVLYEVPDQLTGYMKR 567          
BLAST of Copine-3 vs. Ensembl Celegans
Match: cpna-5 (Copine family protein 5 [Source:UniProtKB/Swiss-Prot;Acc:Q09219])

HSP 1 Score: 179.489 bits (454), Expect = 4.287e-48
Identity = 140/511 (27.40%), Postives = 241/511 (47.16%), Query Frame = 1
Query:  160 FTSQLVVEYVFEEKQILAATIFY-----QDSASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTF-----------IIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFK--KSDKGK----WIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINK--EILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLA-KEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVRLK 1617
            FT +   +YVFE+ Q++ A         + S+S   I       +  +I   GS  + ++ +  +  N+ +  +            II   E   K+   +++  G  LD+KD     D   + F+  + ++GK     +  Y +E +KN+ +P W    +      D + N+  EI     D DG EG            IG+ + T   +     +  +  +IN  K+ +K+SY NSGK++++    +  Y+FLDY+ SG  L+F + VD S P        E +   +  R   E  +AI+A+  I+++Y  + LF AFG GA+IPP F E +E+ LN    +  C+G+DGV+ AY+     V  +  +  +PVI  V  ++ +    G HY VL + T G V D  E ++A+  AS  P+SI+++G+G   F+ ++ L           +   RD VQF+ ++  L    +G++    NK  +A+  L  +P  +V YM   ++  K
Sbjct:  114 FTDKFSYQYVFEKTQLIKAVFSRCHDRDKPSSSSRDILATSIFKVDELI---GSFGLQLRRQLEKNGNIASALSGTQRVTDEYLGGIIVSAEMPEKEQPIVVQFHGKSLDRKDFLW--DETAVFFRVFRLEEGKDDDSLVFLYESEALKNHSHPQWAEFRLDTQDAAD-NRNRLLEIWVMYKDVDGKEG-----------YIGKFLTTYAKMKYGPGSDNVYSVINDVKKAQKKSYENSGKMELVKFTDVSFYSFLDYIVSGTQLHFEIGVDFSSP--------EPVHELDQRRFDGELHMAIRAIGSIIRDYTPNRLFAAFGIGAKIPPTFHESNEFFLNFSM-DPICRGLDGVMEAYRKTQTMVTPLKESKLSPVINYVTRMSHRSGFRGLHYHVLALFTRGEVTDLKEIQQALNSASDAPLSILIIGMGDFDFSSLQKLCSK-------RKDGRRDVVQFIHLKSLL----NGAEAPWLNKSRIAETALRHVPQHMVQYMHNANIAAK 587          
BLAST of Copine-3 vs. Ensembl Zebrafish
Match: cpne5a (copine Va [Source:ZFIN;Acc:ZDB-GENE-081105-9])

HSP 1 Score: 342.043 bits (876), Expect = 1.941e-109
Identity = 202/549 (36.79%), Postives = 307/549 (55.92%), Query Frame = 1
Query:   13 SKVIISVGCRHL----------PLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +KV I+V CR+L          PL ++         G E     ++  +TE ++ T NPDF  + +++Y FEEKQ L   I+  DS S    +    G  F  +G I+ + GS +E P+          KN  T I+  +E    ++   M+     LDKKD FG+SDP+++ ++ ++ G +   ++TE++KN LNP W+   I +  LC+GD ++ I    +DWD         D   D  IGE   + + L   ++   + +++N KK+ KKR YINSG + +++      +TFLDY+ +G+ ++F VA+D +    N   Q  S+   N   Q N Y +A+KAV EI+Q+YD+D +FPA GFGA++PPD +  HE+PLNG+  N +C G++G+L AY  +LKTV+      F PVI  V   A    DGS YFVLLI+T+G + D  +TK A++ A+ LP+SII+VG+G   F  M  LD D   +    + A RD VQFVP R +  M   G+  +   +  LAK+VLAE+PDQL+ YMK   ++
Sbjct:   23 TKVEITVSCRNLLDRDTFSKSDPLCILYTQ------GAES-KQWREFGRTEVIDNTLNPDFVRKYILDYFFEEKQNLRFDIYDIDSKSPDLAKHDFLGQTFCTLGEIVGSPGSRLEKPLGGIPG-----KNCGTIILTAEELGNCRDCATMQFCANKLDKKDFFGRSDPFMVFYRSNEDGTFTICHKTEVVKNTLNPIWQPFTIPVRALCNGDYDRSIKVEVYDWD--------RDGSHD-FIGEFTTSYRELSRGQSQFNVYEVVNPKKKLKKRRYINSGTVTLLSFLVEAEHTFLDYIKAGLQIHFTVAIDFTASNGN-PSQSTSLHYMN-PYQMNAYAMALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNVDNPYCNGMEGILEAYHESLKTVQLYGPTNFAPVINHVARYAAAVQDGSQYFVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDY--MDRTGNHVLSMAR--LAKDVLAEIPDQLILYMKSRGIK 544          
BLAST of Copine-3 vs. Ensembl Zebrafish
Match: cpne5b (copine Vb [Source:ZFIN;Acc:ZDB-GENE-040426-1398])

HSP 1 Score: 330.872 bits (847), Expect = 2.910e-105
Identity = 199/550 (36.18%), Postives = 310/550 (56.36%), Query Frame = 1
Query:   13 SKVIISVGCRHL----------PLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQN-YTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +KV I+V CR+L          PL V+    V            ++  +TE ++ T NPDF  + +++Y FEEKQ L   ++  DS S    +    G  F  +G I+ +  S +E P+   S      KN  T ++  +E    +++  M+     LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W+   I +  LC+GD ++ I    +DWD         D   D  IGE   + + L   ++   + +++N KK+ KK+ Y+NSG + +++ FS+++  TFLDY+  G  +NF VA+D +    N   Q  S+   N   Q N Y +A+KAV EI+Q+YD+D +FPA GFGA++PPD +  HE+PLNG+ +N +C G++G+L AY  +LKTV+      F PV+  V   A    DGS YF+LLI+T+G + D  +TK A++ A+ LP+SII+VG+G   F  M  LD D   +    + A RD VQFVP R +  M   G+  +   +  LAK+VLAE+PDQ ++YMK   ++
Sbjct:   23 TKVEITVSCRNLLDRDTFSKSDPLCVLYTQGVET-------KQWREFGRTEVIDNTLNPDFVRKYILDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQMFCTLGEIVGSPASRLEKPLGGISG-----KNCGTIVLSAEELGNCRDSATMQFCANKLDKKDFFGKSDPFMVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFTIPVRALCNGDYDRTIKVEVYDWD--------RDGSHD-FIGEFTTSYRELARGQSQFNVYEVVNPKKKMKKKKYVNSGTVTLLS-FSVESESTFLDYIKGGTQINFTVAIDFTASNGN-PSQSTSLHYMN-PYQMNAYALALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNIENPYCNGIEGILEAYHQSLKTVQLYGPTNFAPVVNHVARYAAAVQDGSQYFILLIITDGVISDMSQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDIRISSRGKLAERDIVQFVPFRDY--MDRTGNHVLSMAR--LAKDVLAEIPDQFISYMKSRGIK 544          
BLAST of Copine-3 vs. Ensembl Zebrafish
Match: cpne5b (copine Vb [Source:ZFIN;Acc:ZDB-GENE-040426-1398])

HSP 1 Score: 328.561 bits (841), Expect = 3.371e-104
Identity = 200/556 (35.97%), Postives = 313/556 (56.29%), Query Frame = 1
Query:   13 SKVIISVGCRHL----------PLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQE-------KIY---GHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQN-YTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +KV I+V CR+L          PL V+    V            ++  +TE ++ T NPDF  + +++Y FEEKQ L   ++  DS S +       ++Y   G  F  +G I+ +  S +E P+   S      KN  T ++  +E    +++  M+     LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W+   I +  LC+GD ++ I    +DWD         D   D  IGE   + + L   ++   + +++N KK+ KK+ Y+NSG + +++ FS+++  TFLDY+  G  +NF VA+D +    N   Q  S+   N   Q N Y +A+KAV EI+Q+YD+D +FPA GFGA++PPD +  HE+PLNG+ +N +C G++G+L AY  +LKTV+      F PV+  V   A    DGS YF+LLI+T+G + D  +TK A++ A+ LP+SII+VG+G   F  M  LD D   +    + A RD VQFVP R +  M   G+  +   +  LAK+VLAE+PDQ ++YMK   ++
Sbjct:   28 TKVEITVSCRNLLDRDTFSKSDPLCVLYTQGVET-------KQWREFGRTEVIDNTLNPDFVRKYILDYFFEEKQNLRFDLYDVDSKSPDLSKHKPLELYDFLGQMFCTLGEIVGSPASRLEKPLGGISG-----KNCGTIVLSAEELGNCRDSATMQFCANKLDKKDFFGKSDPFMVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFTIPVRALCNGDYDRTIKVEVYDWD--------RDGSHD-FIGEFTTSYRELARGQSQFNVYEVVNPKKKMKKKKYVNSGTVTLLS-FSVESESTFLDYIKGGTQINFTVAIDFTASNGN-PSQSTSLHYMN-PYQMNAYALALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNIENPYCNGIEGILEAYHQSLKTVQLYGPTNFAPVVNHVARYAAAVQDGSQYFILLIITDGVISDMSQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDIRISSRGKLAERDIVQFVPFRDY--MDRTGNHVLSMAR--LAKDVLAEIPDQFISYMKSRGIK 555          
BLAST of Copine-3 vs. Ensembl Zebrafish
Match: cpne8 (copine VIII [Source:ZFIN;Acc:ZDB-GENE-100809-1])

HSP 1 Score: 322.783 bits (826), Expect = 5.102e-102
Identity = 197/575 (34.26%), Postives = 317/575 (55.13%), Query Frame = 1
Query:   13 SKVIISVGCRHL----------PLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQ----EKIYGHCFSNMGRIIHNGGSIEVPIKIESNELN-NMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVRLKFCDNSPVHKQYDNFKSP-KELQHQ 1686
            +KV I+V CR+L          P+ V+    V            ++  +TE ++ T NPDF  + +++Y FEE+Q L   ++  DS S+        G  +  +G ++ + GS     ++E + +    KN  T I+K +E    + + +M+  G  LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN L+P W++  I +  LC+GD ++ I    +DWD   G          + IGE   + + L +      + +++N KK+KKK+ Y+NSG + +++ F     TFLDY+  G  +NF VA+D +    N   Q  S+   +     N Y +A++AV EI+Q+YD+D LFPA GFGA++PPD +  HE+PLNG+  N +C G++GVL AY  +LK+V+      F+PVI  V   A    DGS YF+LLI+++G + D  +TK +++ ASSLP+SII+VG+G   F +M  LD D   +      A RD VQFVP R ++    D       +   LAK+VLAE+PDQ + Y++   ++ +   +S + K   +   P   LQ Q
Sbjct:   27 TKVEITVSCRNLLDRDTFSKSDPICVLYTQTV-------ANREWREFGRTEVIDNTLNPDFVHKFILDYFFEERQNLRFDLYDLDSKSENLSKHDFLGQMYCTLGEVVGSPGS-----RMERSLIGIPGKNCGTVIVKAEELGNCRESVLMQFCGNKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVVKNTLDPVWQAFKIPVRALCNGDYDRAIKIEVYDWDRDGGH---------DYIGEFSTSYRELSKGHTQFTVWEVLNPKKKKKKKKYLNSGTVTLLSCFIDVEVTFLDYIKGGTQINFTVAIDFTASNGN-PSQPTSLHYMS-PYHLNAYALALRAVGEIIQDYDSDKLFPALGFGAKLPPDGRVSHEFPLNGNPDNPYCSGIEGVLEAYYQSLKSVRLYGPTYFSPVINHVARYASLVKDGSEYFILLIISDGVISDMAQTKESIVNASSLPMSIIIVGVGPAEFDEMIELDGDEVRISSRGRFAERDIVQFVPFRDYI----DRRGNHILSMARLAKDVLAEIPDQFLQYVRSRGIKPQHSAHSTISKPPASLVHPIHHLQTQ 574          
BLAST of Copine-3 vs. Ensembl Zebrafish
Match: cpne1 (copine I [Source:ZFIN;Acc:ZDB-GENE-030131-3562])

HSP 1 Score: 307.375 bits (786), Expect = 1.356e-96
Identity = 197/544 (36.21%), Postives = 315/544 (57.90%), Query Frame = 1
Query:   13 SKVIISVGCRHLPLEVIRAYRVTLDVGFEGFSHHK--DTMKTEFLET-SNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNN-FMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAK---EHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLK-VGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDV 1608
            SKV +S+ C +L  + + +    L V  +     K  +  +TE ++   +P F+++L ++Y FE+ Q L   ++  D+ S     +   G     +G+I+ +   +  P+++++ +      K T  I  +E  VK N   +M++   +LDKKDLFGKSDP++  FK+ + GKW   +RTE+IKNNLNP WK   + L+  C+GD+NK I   C+D D      ED  +   ++IGE   T   L+E+++N V    I+ +KQKKK+SY NSG I+I        Y+FLDY+  G  +NF V +D +    +     +S+   N     N+Y  AI +V +++Q+YD+D LFPAFGFGAQ+PP+F+  HE+PLN +  + +C+GV+G++ AY++ L  ++      F+P+I  V  +A    +  + + YFVLLI+T+G + D  +T+++++ +S LP+SII+VG+G   F  M+ LD D G+LK +  E A RD VQFVP ++F              K ALA+ VLAE+P QLV Y K  ++
Sbjct:    7 SKVELSISCNNLLDKDVGSKSDPLCVLLQSVGDDKWTEVARTERVKNCQDPQFSTKLHIDYYFEKVQKLKFGVYDIDNKSVDLGDDDFLGGFEGTLGQIVSSR-KLTRPLQLKAAK---PAGKGTITITAEE--VKDNRAIVMEIEAKNLDKKDLFGKSDPFLEFFKQDEDGKWQLVHRTEVIKNNLNPSWKKFTVSLHTFCNGDLNKPIKVTCYDKD------EDTSS---DMIGEFTCTTAKLMEAKDNAVEFDCIHPEKQKKKKSYKNSGVIKIKDCKLETQYSFLDYVMGGCQINFTVGIDFTGSNGDPRSP-DSLHYLN-PNGVNQYLSAIWSVGQVVQDYDSDKLFPAFGFGAQVPPNFQVSHEFPLNFNPNSPYCQGVEGIVNAYRSVLPQLRLYGPTNFSPIINHVARIASGAAQQPNAAQYFVLLIITDGEITDLDQTRQSIVNSSKLPMSIIIVGVGEADFKAMEFLDGDNGVLKSITGESAVRDIVQFVPFKQFANAP----------KEALAQSVLAEVPSQLVTYFKMRNL 523          
BLAST of Copine-3 vs. Ensembl Xenopus
Match: acot11 (acyl-CoA thioesterase 11 [Source:Xenbase;Acc:XB-GENE-5864266])

HSP 1 Score: 335.109 bits (858), Expect = 1.006e-106
Identity = 210/557 (37.70%), Postives = 313/557 (56.19%), Query Frame = 1
Query:   13 SKVIISVGCRHLPLEVIRAYR----VTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSAS-----QEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKP--TFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVRLK-FCDNSPVH 1641
            +K+ I+V CR L L++    +    V L V   G     +  +TE ++ T NPDF  + V++Y FEEKQ L   +F  DS S      +   G  F  +G +I +  S +E P       L  +  K   T I+  +E S  ++   M++    LDKKD FGKSDP+++ ++ ++ G +   ++TE+IKN LNP W+   I +  LC+GD ++ +    +DWD   G   D        IGE   + + L   ++   + +++N KK+ KK+ YINSG + +++  +   YTF+DY+  G  LNF VA+D +    N   Q  S+   N   Q N Y +A+KAV EI+Q+YD+D LFPA+GFGA+IPPD K  HE+ LNGD +N  C G+ GVL AY  +L+TV+      F  VI QV   A +  DGS Y+VLLI+T+G + D ++TK A++ ASSLP+SII+VG+G   F  M+ LD D   +      A RD VQFVP R ++    D S     +   LAK+VLAE+P+Q ++YMK  D++ +    + PV 
Sbjct:   17 TKIEITVSCRSL-LDMDTFSKSDPVVVLYVQGVGNKEWTEFGRTEVIDNTLNPDFVRKFVLDYFFEEKQNLRFDVFNVDSRSCNISKHKDFLGQAFCTLGEVIGSPRSRLEKP-------LTGIPGKKCGTIILSAEELSNCRDIVTMQLCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVIKNTLNPVWQPFTIPVRALCNGDYDRTVKVDVYDWD--RGGSHD-------FIGEFTTSYRELSRGQSQFSVYEVLNPKKKCKKKKYINSGTVTLLSFKAESEYTFVDYIKGGTQLNFTVAIDFTASNGN-PSQPTSLHYMN-PYQLNAYGMALKAVGEIIQDYDSDKLFPAYGFGAKIPPDGKISHEFALNGDIENPNCVGIQGVLEAYFKSLRTVQLYGPTNFASVINQVARAAGDVTDGSQYYVLLIITDGVISDMVQTKEAIVNASSLPMSIIIVGVGPAEFDAMEELDGDEVRVSSRGRFAERDIVQFVPFRDYV----DRSGNQVLSMARLAKDVLAEIPEQFLSYMKSRDIKPRPLSQSGPVQ 550          
BLAST of Copine-3 vs. Ensembl Xenopus
Match: cpne9 (copine family member IX [Source:NCBI gene;Acc:100125077])

HSP 1 Score: 334.724 bits (857), Expect = 2.087e-106
Identity = 195/517 (37.72%), Postives = 297/517 (57.45%), Query Frame = 1
Query:  127 KTEFLETS-NPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKPT---------------FIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQN-YTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +TE ++ S NPDF  + V++Y FEEKQ L   ++  D+ S    +    G CF  +G I+ + GS +E  + I  N  N+   + T                II  +E S  ++   ++ S   LDKKD FGKSDP+++ ++ ++ G +   ++TE +KN L+P W+   I +  LC+GD ++ I    +DWD         D   D  IGE   + + L + ++   I ++IN +K+ KK+ YINSG + +++ FS+++ YTFLDY+  G  +NF VA+D +    N   Q  S+   N   Q N Y +A+KAV EI+Q+YD+D  FPA GFGA++PPD +  HE+PLNG  +N  C G++G+L AY  +LK+V+      F PV+ +V   A    DGSHYFVLLI+T+G + D  +TK A++ A+ LP+SII+VG+G   F  M  LD D   +    + A RD VQFVP R ++    D +     +   LAK+VLAE+PDQL++YMK   ++
Sbjct:   58 RTEVIDNSLNPDFVRKFVLDYFFEEKQNLRFDLYDVDAKSPDLSKHDFLGQCFCTLGEIVGSAGSRLEKSLIIGQNAPNSRSGRSTQSMSNGGIPSKKCGIIIISAEELSNCRDIATVQFSAHKLDKKDFFGKSDPFMVFYRSNEDGTYTICHKTEYVKNTLSPVWQKFSIPVRGLCNGDYDRTIKVEVYDWD--------RDGSHD-FIGEFSTSYRELSKGQSQFNIYEVINPRKKIKKKKYINSGTVTLLS-FSVESEYTFLDYIKGGTQINFTVAIDFTASNGN-PSQSTSLHYMN-PYQLNAYALALKAVGEIIQDYDSDKRFPALGFGAKLPPDGRVSHEFPLNGSIENPQCNGIEGILEAYHKSLKSVQLYGPTNFAPVVNRVARFAAAVQDGSHYFVLLIITDGVISDMSQTKEAIVNAAMLPMSIIIVGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYV----DRTGNHVLSMARLAKDVLAEIPDQLISYMKARGIK 558          
BLAST of Copine-3 vs. Ensembl Xenopus
Match: cpne9 (copine family member IX [Source:NCBI gene;Acc:100125077])

HSP 1 Score: 330.487 bits (846), Expect = 8.174e-105
Identity = 197/519 (37.96%), Postives = 296/519 (57.03%), Query Frame = 1
Query:  127 KTEFLETS-NPDFTSQLVVEYVFEEKQILAATIF---YQD---SASQEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKPT---------------FIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQN-YTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +TE ++ S NPDF  + V++Y FEEKQ L   +F   Y D   S       G CF  +G I+ + GS +E  + I  N  N+   + T                II  +E S  ++   ++ S   LDKKD FGKSDP+++ ++ ++ G +   ++TE +KN L+P W+   I +  LC+GD ++ I    +DWD         D   D  IGE   + + L + ++   I ++IN +K+ KK+ YINSG + +++ FS+++ YTFLDY+  G  +NF VA+D +    N   Q  S+   N   Q N Y +A+KAV EI+Q+YD+D  FPA GFGA++PPD +  HE+PLNG  +N  C G++G+L AY  +LK+V+      F PV+ +V   A    DGSHYFVLLI+T+G + D  +TK A++ A+ LP+SII+VG+G   F  M  LD D   +    + A RD VQFVP R ++    D +     +   LAK+VLAE+PDQL++YMK   ++
Sbjct:   53 RTEVIDNSLNPDFVRKFVLDYFFEEKQNLRFDLFAITYFDLNFSLFLFDFLGQCFCTLGEIVGSAGSRLEKSLIIGQNAPNSRSGRSTQSMSNGGIPSKKCGIIIISAEELSNCRDIATVQFSAHKLDKKDFFGKSDPFMVFYRSNEDGTYTICHKTEYVKNTLSPVWQKFSIPVRGLCNGDYDRTIKVEVYDWD--------RDGSHD-FIGEFSTSYRELSKGQSQFNIYEVINPRKKIKKKKYINSGTVTLLS-FSVESEYTFLDYIKGGTQINFTVAIDFTASNGN-PSQSTSLHYMN-PYQLNAYALALKAVGEIIQDYDSDKRFPALGFGAKLPPDGRVSHEFPLNGSIENPQCNGIEGILEAYHKSLKSVQLYGPTNFAPVVNRVARFAAAVQDGSHYFVLLIITDGVISDMSQTKEAIVNAAMLPMSIIIVGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYV----DRTGNHVLSMARLAKDVLAEIPDQLISYMKARGIK 555          
BLAST of Copine-3 vs. Ensembl Xenopus
Match: acot11 (acyl-CoA thioesterase 11 [Source:Xenbase;Acc:XB-GENE-5864266])

HSP 1 Score: 323.939 bits (829), Expect = 6.385e-103
Identity = 197/512 (38.48%), Postives = 291/512 (56.84%), Query Frame = 1
Query:  127 KTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDS----ASQEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKI--QIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVRLKFCDNSPV 1638
            +TE ++ T NPDF  + V++Y FEEKQ L   +F  DS     S+    G  F  +G +I +  S +E P+          K   T I+  +E S  ++   M++    LDKKD FGKSDP+++ ++ ++ G +   ++TE+IKN LNP W+   I +  LC+GD ++ +    +DWD   G   D        IGE   + + L   ++   + +++N KK+ KK+ YINSG +  ++  D ++   TFL + FS   LNF VA+D +    N   Q  S+   N   Q N Y +A+KAV EI+Q+YD+D LFPA+GFGA+IPPD K  HE+ LNGD +N  C G+ GVL AY  +L+TV+      F  VI QV   A +  DGS Y+VLLI+T+G + D ++TK A++ ASSLP+SII+VG+G   F  M+ LD D   +      A RD VQFVP R ++    D S     +   LAK+VLAE+P+Q ++YMK  D++       P+
Sbjct:   24 RTEVIDNTLNPDFVRKFVLDYFFEEKQNLRFDVFNVDSRSCNISKHDFLGQAFCTLGEVIGSPRSRLEKPLTGIPG-----KKCGTIILSAEELSNCRDIVTMQLCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVIKNTLNPVWQPFTIPVRALCNGDYDRTVKVDVYDWD--RGGSHD-------FIGEFTTSYRELSRGQSQFSVYEVLNPKKKCKKKKYINSGTVTEELDGDSAI---TFLSFFFSRTQLNFTVAIDFTASNGN-PSQPTSLHYMN-PYQLNAYGMALKAVGEIIQDYDSDKLFPAYGFGAKIPPDGKISHEFALNGDIENPNCVGIQGVLEAYFKSLRTVQLYGPTNFASVINQVARAAGDVTDGSQYYVLLIITDGVISDMVQTKEAIVNASSLPMSIIIVGVGPAEFDAMEELDGDEVRVSSRGRFAERDIVQFVPFRDYV----DRSGNQVLSMARLAKDVLAEIPEQFLSYMKSRDIKPPIRQPPPI 512          
BLAST of Copine-3 vs. Ensembl Xenopus
Match: acot11 (acyl-CoA thioesterase 11 [Source:Xenbase;Acc:XB-GENE-5864266])

HSP 1 Score: 316.62 bits (810), Expect = 2.782e-100
Identity = 195/510 (38.24%), Postives = 288/510 (56.47%), Query Frame = 1
Query:  127 KTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKI--QIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVRLK-FCDNSPVH 1641
            +TE ++ T NPDF  + V++Y FEEKQ L    F           G  F  +G +I +  S +E P+          K   T I+  +E S  ++   M++    LDKKD FGKSDP+++ ++ ++ G +   ++TE+IKN LNP W+   I +  LC+GD ++ +    +DWD   G   D        IGE   + + L   ++   + +++N KK+ KK+ YINSG +  ++  D ++   TFL + FS   LNF VA+D +    N   Q  S+   N   Q N Y +A+KAV EI+Q+YD+D LFPA+GFGA+IPPD K  HE+ LNGD +N  C G+ GVL AY  +L+TV+      F  VI QV   A +  DGS Y+VLLI+T+G + D ++TK A++ ASSLP+SII+VG+G   F  M+ LD D   +      A RD VQFVP R ++    D S     +   LAK+VLAE+P+Q ++YMK  D++ +    + PV 
Sbjct:   24 RTEVIDNTLNPDFVRKFVLDYFFEEKQNLRFDDFL----------GQAFCTLGEVIGSPRSRLEKPLTGIPG-----KKCGTIILSAEELSNCRDIVTMQLCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVIKNTLNPVWQPFTIPVRALCNGDYDRTVKVDVYDWD--RGGSHD-------FIGEFTTSYRELSRGQSQFSVYEVLNPKKKCKKKKYINSGTVTEELDGDSAI---TFLSFFFSRTQLNFTVAIDFTASNGN-PSQPTSLHYMN-PYQLNAYGMALKAVGEIIQDYDSDKLFPAYGFGAKIPPDGKISHEFALNGDIENPNCVGIQGVLEAYFKSLRTVQLYGPTNFASVINQVARAAGDVTDGSQYYVLLIITDGVISDMVQTKEAIVNASSLPMSIIIVGVGPAEFDAMEELDGDEVRVSSRGRFAERDIVQFVPFRDYV----DRSGNQVLSMARLAKDVLAEIPEQFLSYMKSRDIKPRPLSQSGPVQ 500          
BLAST of Copine-3 vs. Ensembl Mouse
Match: Cpne5 (copine V [Source:MGI Symbol;Acc:MGI:2385908])

HSP 1 Score: 330.872 bits (847), Expect = 8.303e-105
Identity = 204/563 (36.23%), Postives = 308/563 (54.71%), Query Frame = 1
Query:   13 SKVIISVGCRHL----------PLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKP---------------TFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDV 1608
            +KV I+V CR+L          PL V+         G E     ++  +TE ++ T NPDF  + +V+Y FEEKQ L   ++  DS S    +    G  F  +G I+ + GS +E P+ I +  LN+   KP               T I+  +E S  ++   M+     LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W++  I +  LC+GD ++ I    +DWD         D   D  IGE   + + L   ++   I ++IN KK+ KK+ Y+NSG + +++       TFLDY+  G  +NF VA+D +    N   Q  S+   +   Q N Y +A+ AV EI+Q YD+D +FPA GFGA++PPD +  HE+PLNG+ +N  C G+DG+L AY ++L+TV+      F PV+  V   A    DGS Y VLLI+T+G + D  +TK A++ A+ LP+SII+VG+G   F  M  LD D   +    + A RD VQFVP R ++    D +     +   LA++VLAE+PDQLV+YMK   +
Sbjct:   23 TKVEITVSCRNLLDKDMFSKSDPLCVMYTQ------GMEN-KQWREFGRTEVIDNTLNPDFVRKFIVDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQAFCTLGEIVGSSGSRLEKPLTIGTFSLNSRTGKPMPAVSNGGVPGKKCGTIILSAEELSNCRDVATMQFCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVMKNTLNPVWQTFSIPVRALCNGDYDRTIKVEVYDWD--------RDGSHD-FIGEFTTSYRELARGQSQFNIYEVINPKKKMKKKKYVNSGTVTLLSFAVESESTFLDYIKGGTQINFTVAIDFTASNGN-PSQSTSLHYMS-PYQLNAYALALTAVGEIIQHYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNQENPSCCGIDGILEAYHSSLRTVQLYGPTNFAPVVTHVARNAAAVQDGSQYSVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYV----DRTGNHVLSMARLARDVLAEIPDQLVSYMKAQGI 563          
BLAST of Copine-3 vs. Ensembl Mouse
Match: Cpne9 (copine family member IX [Source:MGI Symbol;Acc:MGI:2443052])

HSP 1 Score: 322.783 bits (826), Expect = 3.086e-102
Identity = 192/542 (35.42%), Postives = 308/542 (56.83%), Query Frame = 1
Query:   13 SKVIISVGCRHL-PLEVIRAY--RVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQ----EKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +K+ I+V CR+L  L+        V L          ++  +TE ++ T NPDF  + V++Y FEEKQ L   ++  DS +     +   G  F  +G +I   GS +E P+          K   T ++  +E S  ++   M++    LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W+   I +  LC+GD ++ +    +DWD         D   D  IGE   + + L +++N   + +++N +K+ KK+ Y NSG + +++      +TF+DY+  G  LNF VA+D +    N   Q  S+   +   Q + Y +A+KAV EI+Q+YD+D LFPA+GFGA++PP+ +  H++PLN + ++  C G++GVL +Y  +L+TV+      F PVI QV   A +  DGS Y+VLLI+T+G + D  +TK A++ ASSLP+SII+VG+G   F  M+ LD D   +      A RD VQFVP R ++    D S     +   LAK+VLAE+P+QL++YM+  D++
Sbjct:   14 TKIEITVSCRNLLDLDTFSKSDPMVVLHTQSRASQEWREFGRTEVIDNTLNPDFVRKFVLDYFFEEKQNLRFDVYNVDSKANISKPKDFLGQAFLALGEVIGGQGSRVERPLTGVPG-----KKCGTILLTAEELSNCRDIATMQLCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFSIPVRALCNGDYDRTVKIDVYDWD--------RDGSHD-FIGEFTTSYRELSKAQNQFTVYEVLNPRKKCKKKKYTNSGTVTLLSFSVDSEFTFVDYIKGGTQLNFTVAIDFTASNGN-PLQPTSLHYMS-PYQLSAYAMALKAVGEIIQDYDSDKLFPAYGFGAKLPPEGRISHQFPLNNNDEDPNCAGIEGVLESYFQSLRTVQLYGPTYFAPVINQVARAAAKISDGSQYYVLLIITDGVISDMTQTKEAIVSASSLPMSIIIVGVGPAMFEAMEELDGDDVRVSSRGRYAERDIVQFVPFRDYV----DRSGNQVLSMARLAKDVLAEIPEQLLSYMRTRDIQ 535          
BLAST of Copine-3 vs. Ensembl Mouse
Match: Cpne8 (copine VIII [Source:MGI Symbol;Acc:MGI:1914121])

HSP 1 Score: 320.857 bits (821), Expect = 3.399e-101
Identity = 193/550 (35.09%), Postives = 305/550 (55.45%), Query Frame = 1
Query:   13 SKVIISVGCRHL----------PLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGS-IEVPI-KIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            ++V +SV CR+L          P+ V+    V       G    ++  +TE ++ T NPDF  + +++Y FEE++ L   ++  DS S    +    G  F  +G I+ + GS +E PI  I   +        T I+  +E +  ++  +M+     LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W++  I +  LC+GD ++ I    +DWD         D   D  IGE   + + L   ++   + +++N KK+ KK+ Y NSG + +++       +FLDY+  G  +NF VA+D +    N   Q  S+   N   Q N Y +A+KAV EI+Q+YD+D +FPA GFGA++PPD +  HE+ LNG+ QN +C G++GV+ AY  +LK+V+      F PVI  V   A    DGS YFVLLI+T+G + D  +TK +++ AS LP+SII+VG+G   F  M  LD D   +    + A RD VQFVP R ++    D S     +   LAK+VLAE+P+Q ++YM+   ++
Sbjct:   37 TRVEVSVSCRNLLDRDTFSKSDPICVLYTQAV-------GNKEWREFGRTEVIDNTLNPDFVRKFILDYFFEERENLRFDLYDVDSKSPNLSKHDFLGQVFCTLGEIVGSQGSRLEKPIVGIPGRKCG------TIILTAEELNCCRDAVLMQFCANKLDKKDFFGKSDPFLVFYRSNEDGSFTICHKTEVVKNTLNPVWQAFKISVRALCNGDYDRTIKVEVYDWD--------RDGSHD-FIGEFTTSYRELARGQSQFNVYEVVNPKKKGKKKKYTNSGTVTLLSFLVETEVSFLDYIKGGTQINFTVAIDFTASNGN-PAQPTSLHYMN-PYQLNAYGMALKAVGEIVQDYDSDKMFPALGFGAKLPPDGRISHEFALNGNPQNPYCDGIEGVMEAYYRSLKSVQLYGPTNFAPVINHVARYASSVKDGSQYFVLLIVTDGVISDMAQTKESIVNASKLPMSIIIVGVGPAEFDAMVELDGDDVRVSSRGKYAERDIVQFVPFRDYI----DRSGNHILSMARLAKDVLAEIPEQFLSYMRARGIK 558          
BLAST of Copine-3 vs. Ensembl Mouse
Match: Cpne2 (copine II [Source:MGI Symbol;Acc:MGI:2387578])

HSP 1 Score: 299.671 bits (766), Expect = 1.935e-93
Identity = 195/493 (39.55%), Postives = 282/493 (57.20%), Query Frame = 1
Query:  151 NPDFTSQLVVEYVFEEKQILAATIFYQDSASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTF--IIKLKEDSVKKNNFM-MKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVI-IQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSL--AKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKV-GNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDV 1608
            NP F+ + V++Y FEE Q L   +F QD +S + +  H F  +G+   + G+I    KI +  L  M +KP    +I +    +  N  + + ++G  LDKKDLFGKSDP++  +K  D GKW+  +RTE+IK  L+P WK   + L  LCDGD+ K I   C+D+D   G          + IGE   +   + E+ +   + I+ IN KKQ+KK+SY NSG I + +    +NY+FLDY+  G  L F V +D +    N  D   S+   N    +NEY  AI AV +I+Q+YD+D +FPA GFGAQ+PPD+K  HE+ +N +  N FC GVDG+ +AY   L  ++      F+P++  V            + YF+LLI+T+G + D  ET+ AV++AS LP+SII+VG+G+  F  M+ LD D   L+    E+A+RD VQFVP R+F R AA         K  LAK VLAELP Q+V Y K  ++
Sbjct:   72 NPAFSKKFVLDYHFEEVQKLKFALFDQDKSSAQ-LDEHDF--LGQFSCSLGTIVSSKKI-TRPLLLMNDKPAGKGVITIAAQELSDNRVITLSLAGRKLDKKDLFGKSDPFLEFYKPGDDGKWMLVHRTEVIKYTLDPVWKPFTVPLVSLCDGDLEKPIQVMCYDYDSNGGH---------DFIGEFQTSVLQMSEARDGVPLEIECINPKKQRKKKSYKNSGIIILRSCKIHRNYSFLDYILGGCQLMFTVGIDFTASNGNPLDP-SSLHYIN-PMGTNEYLSAIWAVGQIIQDYDSDKMFPALGFGAQLPPDWKVSHEFAINFNPTNPFCSGVDGIAQAYSACLPHIRFYGPTNFSPIVNHVARFAAQATQQQTATYFILLIITDGVISDMEETRHAVVQASKLPMSIIIVGVGNADFAAMEFLDGDNRRLRSHTGEEAARDIVQFVPFREF-RNAA---------KETLAKAVLAELPQQVVQYFKHKNL 539          
BLAST of Copine-3 vs. Ensembl Mouse
Match: Cpne2 (copine II [Source:MGI Symbol;Acc:MGI:2387578])

HSP 1 Score: 299.286 bits (765), Expect = 2.791e-93
Identity = 196/494 (39.68%), Postives = 284/494 (57.49%), Query Frame = 1
Query:  151 NPDFTSQLVVEYVFEEKQILAATIFYQDSASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTF--IIKLKEDSVKKNNFM-MKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVI-IQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSL---AKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKV-GNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDV 1608
            NP F+ + V++Y FEE Q L   +F QD +S + +  H F  +G+   + G+I    KI +  L  M +KP    +I +    +  N  + + ++G  LDKKDLFGKSDP++  +K  D GKW+  +RTE+IK  L+P WK   + L  LCDGD+ K I   C+D+D   G          + IGE   +   + E+ +   + I+ IN KKQ+KK+SY NSG I + +    +NY+FLDY+  G  L F V +D +    N  D   S+   N    +NEY  AI AV +I+Q+YD+D +FPA GFGAQ+PPD+K  HE+ +N +  N FC GVDG+ +AY   L  ++      F+P++  V      A +    + YF+LLI+T+G + D  ET+ AV++AS LP+SII+VG+G+  F  M+ LD D   L+    E+A+RD VQFVP R+F R AA         K  LAK VLAELP Q+V Y K  ++
Sbjct:   72 NPAFSKKFVLDYHFEEVQKLKFALFDQDKSSAQ-LDEHDF--LGQFSCSLGTIVSSKKI-TRPLLLMNDKPAGKGVITIAAQELSDNRVITLSLAGRKLDKKDLFGKSDPFLEFYKPGDDGKWMLVHRTEVIKYTLDPVWKPFTVPLVSLCDGDLEKPIQVMCYDYDSNGGH---------DFIGEFQTSVLQMSEARDGVPLEIECINPKKQRKKKSYKNSGIIILRSCKIHRNYSFLDYILGGCQLMFTVGIDFTASNGNPLDP-SSLHYIN-PMGTNEYLSAIWAVGQIIQDYDSDKMFPALGFGAQLPPDWKVSHEFAINFNPTNPFCSGVDGIAQAYSACLPHIRFYGPTNFSPIVNHVARFAAQATQQQTATQYFILLIITDGVISDMEETRHAVVQASKLPMSIIIVGVGNADFAAMEFLDGDNRRLRSHTGEEAARDIVQFVPFREF-RNAA---------KETLAKAVLAELPQQVVQYFKHKNL 540          
BLAST of Copine-3 vs. UniProt/SwissProt
Match: sp|Q8JZW4|CPNE5_MOUSE (Copine-5 OS=Mus musculus OX=10090 GN=Cpne5 PE=1 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 5.808e-104
Identity = 204/563 (36.23%), Postives = 308/563 (54.71%), Query Frame = 1
Query:   13 SKVIISVGCRHL----------PLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKP---------------TFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDV 1608
            +KV I+V CR+L          PL V+         G E     ++  +TE ++ T NPDF  + +V+Y FEEKQ L   ++  DS S    +    G  F  +G I+ + GS +E P+ I +  LN+   KP               T I+  +E S  ++   M+     LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W++  I +  LC+GD ++ I    +DWD         D   D  IGE   + + L   ++   I ++IN KK+ KK+ Y+NSG + +++       TFLDY+  G  +NF VA+D +    N   Q  S+   +   Q N Y +A+ AV EI+Q YD+D +FPA GFGA++PPD +  HE+PLNG+ +N  C G+DG+L AY ++L+TV+      F PV+  V   A    DGS Y VLLI+T+G + D  +TK A++ A+ LP+SII+VG+G   F  M  LD D   +    + A RD VQFVP R ++    D +     +   LA++VLAE+PDQLV+YMK   +
Sbjct:   23 TKVEITVSCRNLLDKDMFSKSDPLCVMYTQ------GMEN-KQWREFGRTEVIDNTLNPDFVRKFIVDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQAFCTLGEIVGSSGSRLEKPLTIGTFSLNSRTGKPMPAVSNGGVPGKKCGTIILSAEELSNCRDVATMQFCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVMKNTLNPVWQTFSIPVRALCNGDYDRTIKVEVYDWD--------RDGSHD-FIGEFTTSYRELARGQSQFNIYEVINPKKKMKKKKYVNSGTVTLLSFAVESESTFLDYIKGGTQINFTVAIDFTASNGN-PSQSTSLHYMS-PYQLNAYALALTAVGEIIQHYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNQENPSCCGIDGILEAYHSSLRTVQLYGPTNFAPVVTHVARNAAAVQDGSQYSVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYV----DRTGNHVLSMARLARDVLAEIPDQLVSYMKAQGI 563          
BLAST of Copine-3 vs. UniProt/SwissProt
Match: sp|Q9HCH3|CPNE5_HUMAN (Copine-5 OS=Homo sapiens OX=9606 GN=CPNE5 PE=1 SV=2)

HSP 1 Score: 328.946 bits (842), Expect = 3.508e-103
Identity = 203/563 (36.06%), Postives = 307/563 (54.53%), Query Frame = 1
Query:   13 SKVIISVGCRHL----------PLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKP---------------TFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDV 1608
            +KV I+V CR+L          PL V+         G E     ++  +TE ++ T NPDF  + +V+Y FEEKQ L   ++  DS S    +    G  F  +G I+ + GS +E P+ I +  LN+   KP               T I+  +E S  ++   M+     LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W++  I +  LC+GD ++ I    +DWD         D   D  IGE   + + L   ++   I +++N KK+ KK+ Y+NSG + +++       TFLDY+  G  +NF VA+D +    N   Q  S+   +   Q N Y +A+ AV EI+Q YD+D +FPA GFGA++PPD +  HE+PLNG+ +N  C G+DG+L AY  +L+TV+      F PV+  V   A    DGS Y VLLI+T+G + D  +TK A++ A+ LP+SII+VG+G   F  M  LD D   +    + A RD VQFVP R ++    D +     +   LA++VLAE+PDQLV+YMK   +
Sbjct:   23 TKVEITVSCRNLLDKDMFSKSDPLCVMYTQ------GMEN-KQWREFGRTEVIDNTLNPDFVRKFIVDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQAFCTLGEIVGSPGSRLEKPLTIGAFSLNSRTGKPMPAVSNGGVPGKKCGTIILSAEELSNCRDVATMQFCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVMKNTLNPVWQTFSIPVRALCNGDYDRTIKVEVYDWD--------RDGSHD-FIGEFTTSYRELARGQSQFNIYEVVNPKKKMKKKKYVNSGTVTLLSFAVESECTFLDYIKGGTQINFTVAIDFTASNGN-PSQSTSLHYMS-PYQLNAYALALTAVGEIIQHYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYGPTNFAPVVTHVARNAAAVQDGSQYSVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDYV----DRTGNHVLSMARLARDVLAEIPDQLVSYMKAQGI 563          
BLAST of Copine-3 vs. UniProt/SwissProt
Match: sp|Q5BJS7|CPNE9_RAT (Copine-9 OS=Rattus norvegicus OX=10116 GN=Cpne9 PE=2 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 1.568e-101
Identity = 192/542 (35.42%), Postives = 308/542 (56.83%), Query Frame = 1
Query:   13 SKVIISVGCRHL-PLEVIRAY--RVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQ----EKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +K+ I+V CR+L  L+        V L          ++  +TE ++ T NPDF  + V++Y FEEKQ L   ++  DS +     +   G  F  +G +I   GS +E P+          K   T ++  +E S  ++   M++    LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W+   I +  LC+GD ++ +    +DWD         D   D  IGE   + + L +++N   + +++N +K+ KK+ Y NSG + +++      +TF+DY+  G  LNF VA+D +    N   Q  S+   +   Q + Y +A+KAV EI+Q+YD+D LFPA+GFGA++PP+ +  H++PLN + ++  C G++GVL +Y  +L+TV+      F PVI QV   A +  DGS Y+VLLI+T+G + D  +TK A++ ASSLP+SII+VG+G   F  M+ LD D   +      A RD VQFVP R ++    D S     +   LAK+VLAE+P+QL++YM+  D++
Sbjct:   14 TKIEITVSCRNLLDLDTFSKSDPMVVLHTQSRASQEWREFGRTEVIDNTLNPDFVRKFVLDYFFEEKQNLRFDVYNVDSKANISKPKDFLGQAFLALGEVIGGQGSRVERPLTGVPG-----KKCGTILLTAEELSNCRDIATMQLCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFSIPVRALCNGDYDRTVKIDVYDWD--------RDGSHD-FIGEFTTSYRELSKAQNQFTVYEVLNPRKKCKKKKYTNSGTVTLLSFSVDSEFTFVDYIKGGTQLNFTVAIDFTASNGN-PLQPTSLHYMS-PYQLSAYAMALKAVGEIIQDYDSDKLFPAYGFGAKLPPEGRISHQFPLNNNDEDPNCAGIEGVLESYFQSLRTVQLYGPTYFAPVINQVARAAAKISDGSQYYVLLIITDGVISDMTQTKEAIVSASSLPMSIIIVGVGPAMFEAMEELDGDDVRVSSRGRYAERDIVQFVPFRDYV----DRSGNQVLSMARLAKDVLAEIPEQLLSYMRTRDIQ 535          
BLAST of Copine-3 vs. UniProt/SwissProt
Match: sp|Q1RLL3|CPNE9_MOUSE (Copine-9 OS=Mus musculus OX=10090 GN=Cpne9 PE=1 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 1.879e-101
Identity = 192/542 (35.42%), Postives = 308/542 (56.83%), Query Frame = 1
Query:   13 SKVIISVGCRHL-PLEVIRAY--RVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQ----EKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +K+ I+V CR+L  L+        V L          ++  +TE ++ T NPDF  + V++Y FEEKQ L   ++  DS +     +   G  F  +G +I   GS +E P+          K   T ++  +E S  ++   M++    LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W+   I +  LC+GD ++ +    +DWD         D   D  IGE   + + L +++N   + +++N +K+ KK+ Y NSG + +++      +TF+DY+  G  LNF VA+D +    N   Q  S+   +   Q + Y +A+KAV EI+Q+YD+D LFPA+GFGA++PP+ +  H++PLN + ++  C G++GVL +Y  +L+TV+      F PVI QV   A +  DGS Y+VLLI+T+G + D  +TK A++ ASSLP+SII+VG+G   F  M+ LD D   +      A RD VQFVP R ++    D S     +   LAK+VLAE+P+QL++YM+  D++
Sbjct:   14 TKIEITVSCRNLLDLDTFSKSDPMVVLHTQSRASQEWREFGRTEVIDNTLNPDFVRKFVLDYFFEEKQNLRFDVYNVDSKANISKPKDFLGQAFLALGEVIGGQGSRVERPLTGVPG-----KKCGTILLTAEELSNCRDIATMQLCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFSIPVRALCNGDYDRTVKIDVYDWD--------RDGSHD-FIGEFTTSYRELSKAQNQFTVYEVLNPRKKCKKKKYTNSGTVTLLSFSVDSEFTFVDYIKGGTQLNFTVAIDFTASNGN-PLQPTSLHYMS-PYQLSAYAMALKAVGEIIQDYDSDKLFPAYGFGAKLPPEGRISHQFPLNNNDEDPNCAGIEGVLESYFQSLRTVQLYGPTYFAPVINQVARAAAKISDGSQYYVLLIITDGVISDMTQTKEAIVSASSLPMSIIIVGVGPAMFEAMEELDGDDVRVSSRGRYAERDIVQFVPFRDYV----DRSGNQVLSMARLAKDVLAEIPEQLLSYMRTRDIQ 535          
BLAST of Copine-3 vs. UniProt/SwissProt
Match: sp|Q8IYJ1|CPNE9_HUMAN (Copine-9 OS=Homo sapiens OX=9606 GN=CPNE9 PE=1 SV=3)

HSP 1 Score: 322.398 bits (825), Expect = 3.676e-101
Identity = 192/543 (35.36%), Postives = 310/543 (57.09%), Query Frame = 1
Query:   13 SKVIISVGCRHL-PLEVIRAY--RVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQ----EKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKP--TFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +K+ I+V CR+L  L+        V L          ++  +TE ++ T NPDF  + V++Y FEEKQ L   ++  DS +     +   G  F  +G +I   GS     ++E   L  +  K   T ++  +E S  ++   M++    LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W+   I +  LC+GD ++ +    +DWD         D   D  IGE   + + L +++N   + +++N +K+ KK+ Y+NSG + +++      +TF+DY+  G  LNF VA+D +    N   Q  S+   +   Q + Y +A+KAV EI+Q+YD+D LFPA+GFGA++PP+ +  H++PLN + ++  C G++GVL +Y  +L+TV+      F PVI QV   A +  DGS Y+VLLI+T+G + D  +TK A++ ASSLP+SII+VG+G   F  M+ LD D   +      A RD VQFVP R ++    D S     +   LAK+VLAE+P+QL++YM+  D++
Sbjct:   14 TKIEITVSCRNLLDLDTFSKSDPMVVLYTQSRASQEWREFGRTEVIDNTLNPDFVRKFVLDYFFEEKQNLRFDVYNVDSKTNISKPKDFLGQAFLALGEVIGGQGS-----RVERT-LTGVPGKKCGTILLTAEELSNCRDIATMQLCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFSIPVRALCNGDYDRTVKIDVYDWD--------RDGSHD-FIGEFTTSYRELSKAQNQFTVYEVLNPRKKCKKKKYVNSGTVTLLSFSVDSEFTFVDYIKGGTQLNFTVAIDFTASNGN-PLQPTSLHYMS-PYQLSAYAMALKAVGEIIQDYDSDKLFPAYGFGAKLPPEGRISHQFPLNNNDEDPNCAGIEGVLESYFQSLRTVQLYGPTYFAPVINQVARAAAKISDGSQYYVLLIITDGVISDMTQTKEAIVSASSLPMSIIIVGVGPAMFEAMEELDGDDVRVSSRGRYAERDIVQFVPFRDYV----DRSGNQVLSMARLAKDVLAEIPEQLLSYMRTRDIQ 535          
BLAST of Copine-3 vs. TrEMBL
Match: A0A4Z2DGU0 (Copine-8 OS=Schistosoma japonicum OX=6182 GN=EWB00_001084 PE=4 SV=1)

HSP 1 Score: 530.791 bits (1366), Expect = 7.556e-178
Identity = 258/537 (48.04%), Postives = 367/537 (68.34%), Query Frame = 1
Query:    1 MPTKSKVIISVGCRHLPLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLETS-NPDFTSQLVVEYVFEEKQILAATIFYQDSASQEK--IYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQN 1602
            MP K ++ I + CR++P ++++A      V + G+ H +   +TE +  + +P++T+++ +EY FEEKQI+   IF  +   +E   + G+    +GR+IH+GG + +PI    +   +       ++ ++ED   K N  +KM+G +LDKKD FGKSDPYVI+++++++GK  + YR+E+IKN L PDWK I ICL++LC G+I+ E+  RCFDWDGA GD ED+D E+D+LIGE   T   L+    N +  QLIN  K+K+K+ Y NSG + +   F+   ++FLDY+F G+ +N +VAVDMS           S +   +++   EYEVAI+AV+EILQEYD+D LFPAFGFGA++    K  H YPLNGD  N +CKG+ GVL AY+  L  + S     F P+IR+V+  AK      +Y+VLLILTNGTV+DWI+TK+AVIE S LP+SIIV+G+G G F++M+ LDQDFGLLKVG E+A RDNVQFV MR+FLR+AADGS +IRW+KVALAKEVLAELP Q++ Y+ +N
Sbjct:    1 MPHKPRIQIGISCRNIP-KLLKASYAKFSVSYGGYLHERHVTETELVYNNLSPNYTTRINLEYCFEEKQIITTEIFECEREDRENSILLGYIQCTVGRVIHSGGELILPIIWNEDVQVDRSTSTDVVVCIREDPFSKENIFIKMNGANLDKKDFFGKSDPYVIIYRRNERGKLQKCYRSEVIKNTLFPDWKPILICLDRLCGGNIDCELYFRCFDWDGAVGDSEDVDTEIDDLIGEFNTTVSRLLNCNENGIEFQLINMPKKKRKKYYQNSGLLTVKLYFAQSKFSFLDYIFGGLSINVVVAVDMSSHASMNSTTSTSSQQIELSQSHTEYEVAIQAVMEILQEYDSDQLFPAFGFGAKVSSAGKLSHRYPLNGDVNNCYCKGMVGVLSAYRRCLTDLYSSGPIFFAPIIREVSEAAKRSEAADNYYVLLILTNGTVDDWIDTKKAVIETSFLPISIIVLGVGGGKFSEMEILDQDFGLLKVGQEQACRDNVQFVQMRRFLRLAADGSDSIRWSKVALAKEVLAELPSQILEYLDKN 536          
BLAST of Copine-3 vs. TrEMBL
Match: A0A3Q0KS66 (Copine, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 524.242 bits (1349), Expect = 4.913e-175
Identity = 259/538 (48.14%), Postives = 370/538 (68.77%), Query Frame = 1
Query:    1 MPTKSKVIISVGCRHLPLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLETS-NPDFTSQLVVEYVFEEKQILAATIFYQDSASQEK--IYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSI-PKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQN 1602
            MP K ++ I + CR++P ++++A      V + G+ H K   +TE +  + +P++T++L +EY FEEKQI+   IF  +   +E   + G+    +GR+IH+GG + +PI    +   +       ++ ++ED   K N  +KM+G +LDKKD FGKSDPYVI+++++++GK  + YR+E+IKN L PDWK I ICL++LC G+I+ E+  RCFDWDGA GD ED+D E+D+LIGE   T   L+ S  N +  QLIN  K+K+K+ Y NSG + +   F+   ++FLDY+F G+ +N +VAVDMS    +N      S ++  +++   EYEVAI+AV+EILQEYD+D LFPAFGFGA++    K  H YPL  +  N +CKG+ GVL AY+  L  + S     F+P+IR+V+  AK      +Y+VLLILTNGTV+DWIETK++VIE S LP+SIIV+G+G G F++M+ LDQDFGLLKVG E+A RDNVQFV MR+FLR+AADGS +IRW+KVALAKEVLAELP Q++ Y+ +N
Sbjct:    1 MPHKPRIQIGISCRNIP-KLLKASYAKFSVSYGGYLHEKHVTETELVYNNLSPNYTTRLNLEYCFEEKQIITTEIFECEREDRENSVLLGYIQCTVGRVIHSGGELILPITWNEDIQVDRNTSTEVVVCIREDPFSKENIFIKMNGANLDKKDFFGKSDPYVIIYRRNERGKLQKCYRSEVIKNTLFPDWKPILICLDRLCGGNIDCELYFRCFDWDGAVGDSEDVDTEIDDLIGEFNTTVSRLLNSNENGIEFQLINMPKKKRKKCYQNSGLLTVKLYFAQSKFSFLDYIFGGLSINVVVAVDMSTHASMNSITNTPSQQI-ELSQSHTEYEVAIQAVMEILQEYDSDQLFPAFGFGAKVSSGGKLSHRYPL-VNVNNCYCKGMVGVLSAYRRCLTDLYSSGPILFSPIIREVSEAAKRSEAADNYYVLLILTNGTVDDWIETKKSVIETSFLPISIIVLGVGGGKFSEMEILDQDFGLLKVGQEQACRDNVQFVQMRRFLRLAADGSDSIRWSKVALAKEVLAELPSQILEYLDKN 535          
BLAST of Copine-3 vs. TrEMBL
Match: A0A267G9Y0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017750g6 PE=4 SV=1)

HSP 1 Score: 506.523 bits (1303), Expect = 6.272e-170
Identity = 267/547 (48.81%), Postives = 363/547 (66.36%), Query Frame = 1
Query:   13 SKVIISVGCRHLPLEVIRAYRV-TLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIF-----YQDSASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGK-----IQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVRLK 1617
            +KV+I V CR LP++  R++ V  L  G   +   KDT+ TE ++ T NP ++  L+  Y FEE+Q++   I      +   A+  K+ G C  ++G +IH+GGS++  +   S  +          I ++E +  K N ++K++G  LDKKDLFGKSDPY+I+ K++DKG+ +R YRTE+IKN L+PDWK I + +++LC GD+ +EI  RC+DWDGAEGD ED D E DE IGE   T + L  ++   V  +LIN +K KKK++Y NSG      I I ADFS     FLDYMFSG DL F VA+DM+        Q  S+  +      N+Y +A++AV+EI+Q+YD+D L PAFGFG + PPD++  HE+PLNGD  N FC+G  GVL AY+  L+ V+      F PVI+ V+ LA  H DGS Y+VLLILT+GT++DW E KRAVIEAS LPVSIIVVGIGSG FT+M+ LDQD  LL+ G +KA RD VQFV +RK+LR+AADGS  +RW+KVALAK+VL ELP Q++ YM++   RLK
Sbjct:   33 AKVVIGVKCRDLPVD--RSFAVIALHSG--SYMTEKDTVTTETVDKTHNPTYSIPLITSYKFEERQMIELEIHCAMDDHSSRAASRKVIGSCTVSLGHLIHSGGSLDCQLCSSSPAVCT--------IHVEEYAGNKENMLLKLNGRGLDKKDLFGKSDPYMIIDKRNDKGRLVRAYRTEVIKNTLDPDWKPIKVSVDRLCGGDLRREIRFRCYDWDGAEGDHEDKDIEFDEFIGEFATTPKELFSNDGREVTFELINPRKAKKKKNYRNSGTVTAKTIPIDADFS-----FLDYMFSGTDLCFTVAIDMTASN-GSPSQPTSLH-YTDPFTPNQYTIAMQAVLEIIQDYDSDQLLPAFGFGCRAPPDYRVSHEWPLNGDSANPFCQGAAGVLEAYRHCLEEVRLSGPTHFAPVIKHVSRLALNHQDGSRYYVLLILTDGTIDDWTECKRAVIEASYLPVSIIVVGIGSGNFTEMELLDQDVWLLEEGGQKACRDIVQFVELRKYLRVAADGSDGVRWSKVALAKDVLQELPSQILEYMRRR--RLK 558          
BLAST of Copine-3 vs. TrEMBL
Match: A0A267FGY6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017750g2 PE=4 SV=1)

HSP 1 Score: 503.827 bits (1296), Expect = 8.202e-169
Identity = 266/547 (48.63%), Postives = 362/547 (66.18%), Query Frame = 1
Query:   13 SKVIISVGCRHLPLEVIRAYRV-TLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIF-----YQDSASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGK-----IQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVRLK 1617
            +KV+I V CR LP++  R++ V  L  G   +   KDT+ TE ++ T NP ++  L+  Y FEE+Q++   I      +   A+  K+ G C  ++G +IH+GGS++  +   S  +          I ++E +  K N ++K++G  LDKKDLFGKSDPY+I+ K++DKG+ +R YRTE+IKN L+PDWK I + +++LC G+  +EI  RC+DWDGAEGD ED D E DE IGE   T + L  ++   V  +LIN +K KKK++Y NSG      I I ADFS     FLDYMFSG DL F VA+DM+        Q  S+  +      N+Y +A++AV+EI+Q+YD+D L PAFGFG + PPD++  HE+PLNGD  N FC+G  GVL AY+  L+ V+      F PVI+ V+ LA  H DGS Y+VLLILT+GT++DW E KRAVIEAS LPVSIIVVGIGSG FT+M+ LDQD  LL+ G +KA RD VQFV +RK+LR+AADGS  +RW+KVALAK+VL ELP Q++ YM++   RLK
Sbjct:   33 AKVVIGVKCRDLPVD--RSFAVIALHSG--SYMTEKDTVTTETVDKTHNPTYSIPLITSYKFEERQMIELEIHCAMDDHSSRAASRKVIGSCTVSLGHLIHSGGSLDCQLCSSSPAVCT--------IHVEEYAGNKENMLLKLNGRGLDKKDLFGKSDPYMIIDKRNDKGRLVRAYRTEVIKNTLDPDWKPIKVSVDRLCGGEFRREIRFRCYDWDGAEGDHEDKDIEFDEFIGEFATTPKELFSNDGREVTFELINPRKAKKKKNYRNSGTVTAKTIPIDADFS-----FLDYMFSGTDLCFTVAIDMTASN-GSPSQPTSLH-YTDPFTPNQYTIAMQAVLEIIQDYDSDQLLPAFGFGCRAPPDYRVSHEWPLNGDSANPFCQGAAGVLEAYRHCLEEVRLSGPTHFAPVIKHVSRLALNHQDGSRYYVLLILTDGTIDDWTECKRAVIEASYLPVSIIVVGIGSGNFTEMELLDQDVWLLEEGGQKACRDIVQFVELRKYLRVAADGSDGVRWSKVALAKDVLQELPSQILEYMRRR--RLK 558          
BLAST of Copine-3 vs. TrEMBL
Match: A0A4S2L3S0 (C2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009940 PE=4 SV=1)

HSP 1 Score: 500.745 bits (1288), Expect = 9.598e-166
Identity = 256/541 (47.32%), Postives = 371/541 (68.58%), Query Frame = 1
Query:    1 MPTKSKVIISVGCRHLPLEVIRAYRVTLDVGFEGFSHHKDTMKTEF-LETSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQEKI----YGHCFSNMGRIIHNGGSIEVPIKI--ESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQN 1602
            MP++ ++ I + C +LP ++  +Y     V   G  H K   +TE   +T NP F ++L +EY FEE+QI+ + IF  +   +E      +G C   +GR+IH+GG +E+P+    E   L +    P+  + ++ED   K N  +KM GF+LDKKD FGKSDPYV +++++++GK  + YR+E+IKN L PD++ I +CL++LC G+++ E+  RCFDWDGA GD E++D ELD+LIGE   T   L+ S+ + +  +LIN  K+K+K++Y +SG++++    +  N++FLDY+F G  +N ++ VD+S        Q+ + R   V +  NEY VAI+AV+EILQEYD+D LFPA+GFG+++    K CH+YPL+GD  N FCKG+ GVL AY+ + + +      CF+P+IR V+  A+ + D  +Y+VLLILTNGTV+DWIETK+AVIE S LP+SIIV+GIG G F DM+ LDQDFGLLKVG E+A RDNVQFV MR+FLR+AADGS  +RW+KV LAKEVLAELP Q++ Y ++N
Sbjct:    1 MPSRPRIQIGISCTNLPTKLPGSY-AKFSVAHGGTLHEKHVTETEIQRQTRNPIFLTRLNLEYFFEERQIITSEIFQCEREDREDSQLLGFGQC--TVGRVIHSGGELELPLICNDEQKNLLDPGRPPSVFVCIREDPFSKENIYLKMQGFNLDKKDFFGKSDPYVTIYRRNERGKLQKAYRSEVIKNTLFPDFRPILVCLDRLCGGNVDCELCFRCFDWDGALGDSEEVDTELDDLIGEFTTTISELLRSDESGLEFKLINPPKKKRKKNYQDSGQLKVRLSLAQSNFSFLDYIFGGTSINVVIGVDLS--NHISSKQMPASRQIEVAQSCNEYSVAIQAVMEILQEYDSDQLFPAYGFGSRLSSGGKICHKYPLSGDENNYFCKGMAGVLEAYRRSFEALHLSGPICFSPIIRDVSDTARRNKDTENYYVLLILTNGTVDDWIETKKAVIETSFLPISIIVIGIGGGKFADMEILDQDFGLLKVGQEQACRDNVQFVQMRRFLRLAADGSDNLRWSKVGLAKEVLAELPSQILDYFERN 536          
BLAST of Copine-3 vs. Ensembl Cavefish
Match: cpne5b (copine-5 [Source:NCBI gene;Acc:103046149])

HSP 1 Score: 328.946 bits (842), Expect = 1.612e-104
Identity = 199/551 (36.12%), Postives = 308/551 (55.90%), Query Frame = 1
Query:   13 SKVIISVGCRHL----------PLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKP--TFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQN-YTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +KV I+V CR+L          P+ V+    V            ++  +TE ++ T NPDF  + +++Y FEEKQ L   ++  DS S    +    G  F  +G I+   GS   P       L  +  K   T I+  +E    +++  M+     LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W+S  I +  LC+GD ++ I    +DWD         D   D  IGE   + + L   ++   + +++N KK+ KK+ Y+NSG + +++ FS+++ +TFLDY+  G  +NF VA+D +    N   Q  S+   N   Q N Y +A+KAV EI+Q+YD+D +FPA GFGA++PPD +  HE+PLNG+ +N +C G++G+L AY  +LKTV+      F PV+  V   A    DGS YFVLLI+T+G + D  +TK A++  + LP+SII+VG+G   F  M  LD D   +    + A RD VQFVP R +  M   G+  +   +  LAK+VLAE+PDQ ++YMK   ++
Sbjct:   28 TKVEITVSCRNLLDKDTFSKSDPMCVLYTQGVET-------KQWREFGRTEVIDNTLNPDFVRKFILDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQMFCTLGEIV---GS---PASRLDKPLGGIPGKKCGTIILSAEELGNCRDSATMQFCANKLDKKDFFGKSDPFMVFYRSNEDGTFTICHKTEVVKNTLNPVWQSFTIPVRALCNGDFDRTIKVEVYDWD--------RDGSHD-FIGEFTTSYRELARGQSQFNVYEVVNPKKKMKKKKYVNSGTVTLLS-FSVESEFTFLDYIKGGTQINFTVAIDFTASNGN-PSQSTSLHYMN-PYQMNAYAMALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNIENPYCNGIEGILEAYHQSLKTVQLYGPTNFAPVVNHVARYAAAVQDGSQYFVLLIITDGVISDMSQTKEAIVNGAKLPMSIIIVGVGQAEFDAMVELDGDDIRISSRGKLAERDIVQFVPFRDY--MDRTGNHVLSMAR--LAKDVLAEIPDQFISYMKSRGIK 549          
BLAST of Copine-3 vs. Ensembl Cavefish
Match: cpne5b (copine-5 [Source:NCBI gene;Acc:103046149])

HSP 1 Score: 326.635 bits (836), Expect = 1.432e-103
Identity = 199/556 (35.79%), Postives = 308/556 (55.40%), Query Frame = 1
Query:   13 SKVIISVGCRHL----------PLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQE---------KIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKP--TFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQN-YTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +KV I+V CR+L          P+ V+    V            ++  +TE ++ T NPDF  + +++Y FEEKQ L   ++  DS S +            G  F  +G I+   GS   P       L  +  K   T I+  +E    +++  M+     LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W+S  I +  LC+GD ++ I    +DWD         D   D  IGE   + + L   ++   + +++N KK+ KK+ Y+NSG + +++ FS+++ +TFLDY+  G  +NF VA+D +    N   Q  S+   N   Q N Y +A+KAV EI+Q+YD+D +FPA GFGA++PPD +  HE+PLNG+ +N +C G++G+L AY  +LKTV+      F PV+  V   A    DGS YFVLLI+T+G + D  +TK A++  + LP+SII+VG+G   F  M  LD D   +    + A RD VQFVP R +  M   G+  +   +  LAK+VLAE+PDQ ++YMK   ++
Sbjct:   28 TKVEITVSCRNLLDKDTFSKSDPMCVLYTQGVET-------KQWREFGRTEVIDNTLNPDFVRKFILDYFFEEKQNLRFDLYDVDSKSPDLSKHPSECNDFLGQMFCTLGEIV---GS---PASRLDKPLGGIPGKKCGTIILSAEELGNCRDSATMQFCANKLDKKDFFGKSDPFMVFYRSNEDGTFTICHKTEVVKNTLNPVWQSFTIPVRALCNGDFDRTIKVEVYDWD--------RDGSHD-FIGEFTTSYRELARGQSQFNVYEVVNPKKKMKKKKYVNSGTVTLLS-FSVESEFTFLDYIKGGTQINFTVAIDFTASNGN-PSQSTSLHYMN-PYQMNAYAMALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNIENPYCNGIEGILEAYHQSLKTVQLYGPTNFAPVVNHVARYAAAVQDGSQYFVLLIITDGVISDMSQTKEAIVNGAKLPMSIIIVGVGQAEFDAMVELDGDDIRISSRGKLAERDIVQFVPFRDY--MDRTGNHVLSMAR--LAKDVLAEIPDQFISYMKSRGIK 554          
BLAST of Copine-3 vs. Ensembl Cavefish
Match: CPNE9 (copine family member 9 [Source:HGNC Symbol;Acc:HGNC:24336])

HSP 1 Score: 310.071 bits (793), Expect = 1.780e-97
Identity = 185/502 (36.85%), Postives = 288/502 (57.37%), Query Frame = 1
Query:  127 KTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDS----ASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKP--TFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVT-RQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDV 1608
            +TE +E T NPDF  + V+++ FEEKQ L   ++  D+     S+    G  F  +G II + GS     ++E   L+ +  K     I   +E S  ++   M++    LDKKD FGKSDP+++ ++ ++ G +   ++TE+IKN LNP W+   I +  LC+GD ++ +    FDWD         D   D  IGE   + + L   ++   + +++N KK+ KK+ Y+NSG + +++      YTF+D++  G  L+      +  P L   +  +   L  ++  Q N Y +A+KAV EI+Q+YD+D LFPA+GFGA++PPD K  H +PLNG+ ++  C  ++GVL AY  +L+TV+      F PVI QV   A++  DGS YFVLL++T+G + D ++TK AV+ AS+LP+SII+VG+G   F  M+ LD D   +      A RD VQFVP R ++    D S     +   LAK+VLAE+PDQL+++MK   +
Sbjct:   45 RTEVIENTLNPDFVRKFVLDFFFEEKQNLRFDVYNVDTRSSNISKHDFLGQTFCTLGEIIGSTGS-----RMERT-LSGIPGKKCGNIIFTAEELSNCRDIATMQLCANKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVIKNTLNPVWQPFTIPVRALCNGDYDRTVKVDVFDWD--------RDGSHD-FIGEFTTSYRELSRGQSQFNVYEVLNPKKKGKKKKYVNSGTVTLLSFKVESEYTFVDFIRGGYSLDHTKIKCVPNPSLISGNPAQPTSLHYMSPYQMNTYAMALKAVGEIIQDYDSDKLFPAYGFGAKLPPDGKISHVFPLNGNSEDPNCVAIEGVLEAYFQSLRTVQLYGPTNFAPVINQVARSAQDVTDGSQYFVLLMITDGVISDMVQTKEAVVNASALPMSIIIVGVGPAEFDAMEELDGDDVRVSSRGRFAERDIVQFVPFRDYI----DRSGNQVLSMARLAKDVLAEIPDQLLSFMKSKGI 527          
BLAST of Copine-3 vs. Ensembl Cavefish
Match: CPNE8 (copine 8 [Source:HGNC Symbol;Acc:HGNC:23498])

HSP 1 Score: 309.686 bits (792), Expect = 2.880e-97
Identity = 192/551 (34.85%), Postives = 301/551 (54.63%), Query Frame = 1
Query:   13 SKVIISVGCRHL----------PLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKP--TFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +KV I+V CR+L          P+ V+    +       G    ++  +TE ++ T NP+F  + +++Y FEE+Q L   ++  DS S    +    G     +G I+ + GS +E P       L  +  K   T I+K +E +  + + MM+  G  LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W++  I +  LC+GD +                         + IGE   + + L   ++   + ++IN KK+ KK+ Y+NSG + +++     + TFLDY+  G  +NF VA+D +    N   Q  S+   +   Q N Y +A+KAV EI+Q+YD+D +FPA GFGA++PPD +  HE+ LNG+ QN +C G+DGV+ AY  +LK+V+      F+PVI  V   A    DGS YFVLLI+T+G + D  +TK +++ AS LP+SII+VG+G   F  M  LD D   +      A RD VQFVP R ++    D +     +   LAK+VLAE+PDQ ++YMK   ++
Sbjct:   30 TKVEITVSCRNLLDRDTFSKSDPICVLYTQGI-------GNKEWREFGRTEVIDNTLNPEFVRKFILDYFFEERQNLRFDLYDVDSKSSNLSKHDFLGQAQCTLGEIVGSMGSRLEKP-------LGGIPGKKCGTIIVKAEELNNCRESVMMQFCGNKLDKKDFFGKSDPFLVFYRSNEDGTFTICHKTEVVKNTLNPVWQAFKIPVRALCNGDYDSH-----------------------DFIGEFSTSYRELSRGQSQFNVYEVINPKKKGKKKKYLNSGTVTLLSFLVDIDVTFLDYIKGGTQINFTVAIDFTASNGN-PAQPTSLHYMS-PYQLNAYAMALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFALNGNPQNPYCNGIDGVMEAYYQSLKSVQLYGPTNFSPVINHVARYAASVKDGSQYFVLLIITDGVISDMAQTKESIVNASCLPMSIIIVGVGPAEFDAMVELDGDEVRISSRGRYAERDIVQFVPFRDYI----DRTGNHILSMARLAKDVLAEIPDQFLSYMKTRGIK 537          
BLAST of Copine-3 vs. Ensembl Cavefish
Match: cpne1 (copine-3-like [Source:NCBI gene;Acc:103034615])

HSP 1 Score: 305.449 bits (781), Expect = 3.630e-95
Identity = 197/545 (36.15%), Postives = 306/545 (56.15%), Query Frame = 1
Query:   16 KVIISVGCRHLPLEVIRAYRVTLDVGFE--GFSHHKDTMKTEFLET-SNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTF--IIKLKEDSVKKNN-FMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSL---AKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKV-GNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDV 1608
            KV +++ C++L  + + +    L V  +  G     +  +TE ++   +P+F+ +L V+Y FE+ Q L   ++  D+ S     +   G     +G+I+          K  +N L   K KP     I +  D VK N   ++++   +LDKKD+FGKSDP++  FK++D G W   +RTE+IKNNLNP WK   + +   C+ D NK +   C+D D      ED  ++L   IGE   T  +L+E+ +  V    I+ +KQKKK+SY NSG ++I        YTFLDY+  G  +NF V +D +    +     ES+   +    +N+Y  AI +V +++++YD D LFPAFGFGAQ+PPDFK  HE+ LN +  + FC+G++G+++AY+ AL  V+      F+P+I  V  +   A +  + + YFVLLI+T+G + D  +TK+A++ +S LP+SII+VG+G   F  M+ LD D G+LK    E  SRD VQFVP + F     +          ALA+ VLAE+P QLV+Y K  ++
Sbjct:   70 KVELTISCKNLLDKDVGSKSDPLCVLLQSTGNDQWTEVDRTERVKNCQDPEFSKRLCVDYHFEKVQKLKLGVYDIDNKSVDLKDDDYLGGFECTLGQIVST--------KKVTNPLELKKGKPAGKGTITIVADEVKDNRAIVLEVEARNLDKKDMFGKSDPFLEFFKQADDGSWTLVHRTEVIKNNLNPSWKKFTVSVGTFCNADFNKPLKVACYDKD------EDTSSDL---IGEFSCTTANLLEARDQGVEFDCIHPEKQKKKKSYKNSGVVRIKNCKIEAQYTFLDYVMGGCQINFTVGIDFTGSNGDPRSP-ESLHYLS-PDGTNQYLNAIWSVGQVIKDYDTDKLFPAFGFGAQVPPDFKVSHEFALNFNPNSPFCQGIEGIVQAYRAALPQVRLYGPTNFSPIINHVARIAAGAAQQSNAAQYFVLLIITDGEITDLDQTKQAIVNSSKLPMSIIIVGVGEADFKAMEVLDGDNGVLKAPSGEPVSRDIVQFVPFKSFASAPRE----------ALAQTVLAEVPGQLVSYFKMRNI 585          
BLAST of Copine-3 vs. Ensembl Sea Lamprey
Match: cpne2 (copine II [Source:ZFIN;Acc:ZDB-GENE-030131-7896])

HSP 1 Score: 306.22 bits (783), Expect = 9.759e-97
Identity = 197/507 (38.86%), Postives = 292/507 (57.59%), Query Frame = 1
Query:  118 DTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTF--IIKLKEDSVKKNNFM-MKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQL--INHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKE---HCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKV-GNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDV 1608
            +  +TE ++ T  PDF+ +LV+EY FEE Q L   +F +D+ S  K+  H F  +G I    G I V  +  +  L    ++P     I +  + +  N  + + M+G  LDK DLFGKSDPY+ ++K+S  G W+  +RTE+++N L+P WK   + L  LC+GD+ K I A C+DWD   G P        +LIGE       L E+  +  +++   IN+KK++KK+SY NSG I   +    ++YTFLDY+F G  L+F V +D +    N  D   S+   + T   N+Y  AI AV +I+Q+YD D LFPA GFGAQ+PPD K  H++ LN +  N FC G++G++ AY   L+ ++      F+P+I  V S A         S Y+VLLI+T+G + D   T+ A+++AS LP+S+I+VG+G+  F  M+ LD D  +L     E A+RD VQFVP R+F   + D     +  K  LAK VLAELP Q+V Y +Q ++
Sbjct:   55 EVARTETIKNTLCPDFSRKLVMEYRFEEVQKLKFALFDEDAPSA-KLVDHDF--LGEITSTLGQI-VSHRTLTRPLLMQDDRPAGRGTITISAEEITDNRIITLSMAGRKLDKMDLFGKSDPYLEIYKQSPDGTWMLVHRTEVVRNTLDPTWKPFTLHLQVLCNGDLEKNINAVCYDWD-RHGSP--------DLIGEFYANIIRLKEATGSMEVVEFECINNKKKQKKKSYKNSGIIICKSCKISRDYTFLDYIFGGCQLHFTVGIDFTASNGNPRDA-SSLHYISPTGM-NDYLAAIWAVGQIIQDYDTDKLFPALGFGAQLPPDCKVHHDFALNFNPSNPFCTGIEGIVAAYHFCLQNIRLYGPTNFSPIINHVASFAHTASGSASASEYYVLLIITDGVISDMEATREAIVKASRLPMSVIIVGVGNADFEAMEVLDSDDRVLTAPSGEAATRDIVQFVPFRQF--RSVDRLLINKAAKEELAKSVLAELPGQVVQYFRQRNL 544          
BLAST of Copine-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007777.1 (pep scaffold:Pmarinus_7.0:GL477373:3581:22444:1 gene:ENSPMAG00000006999.1 transcript:ENSPMAT00000007777.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 251.906 bits (642), Expect = 3.249e-76
Identity = 172/506 (33.99%), Postives = 275/506 (54.35%), Query Frame = 1
Query:   13 SKVIISVGCRHLPLEVIRAYRVTLDVGF-EGFSHHKDTMKTEFLETSN-PDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFM-MKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRL--FNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSL---AKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKV-GNEKASRDNVQFVPMRKF 1491
            SKV ++V C+ L  + + +    L V   E      +  +TE ++    P F+ +L ++Y FE+ Q L   ++  D+ +     +   G    N+ +++ +   +  P+      L N K      I +  D +K N  + +++   +LDKKD+FGKSDPY+  FK +D G W   +RTE+IKNNLNP W+   I L  LC+GD+ +++   C+D+D ++G          +LIGE     ++L ++E   V   +I+ +K+KKK++Y  SG + + +  +   Y+FLDY+  G  +NF V   +    L + D I  I L   ++         A+ +   I   +  D LFPAFGFGAQIPP+++  HE+PLN +  N +C GV G++  Y+  L  V+      F+P+I  V      A +    + YFVLLI+T+G + D  ET+ AV++AS LP+S+I+VG+G+  F+ M+ LD D G+LK    E A+RD VQFVP R F
Sbjct:   38 SKVELTVSCKDLLDKDVGSKSDPLCVVLIEAGGTWSEVDRTEQIQNCQEPAFSKRLQIDYCFEQVQKLRFGVYDIDNKTYDLTDDDFLGQLECNLAQVV-SSKKMTRPLL-----LKNGKPAGKGQITIVADEIKDNRVLALQVDARNLDKKDMFGKSDPYLEFFKMADDGTWQMVHRTEVIKNNLNPTWRPFSIPLQALCNGDLERDVRVVCYDYD-SDGS--------HDLIGEFKTNVKNLQQAEKGQVEFAVIHPEKKKKKKNYKGSGLVIVKSCRTEVEYSFLDYIMGGCQINFTVRSALR-SCLTLGD-IHRINLLTLHIPWPLLPLNNALSSFNGIKSHHLQDKLFPAFGFGAQIPPNWQVSHEFPLNFNPANPYCNGVQGIVDMYKVCLPQVRLYGPTNFSPIINHVARFAAAALQQPAATQYFVLLIVTDGVISDMDETRLAVVQASRLPMSLIIVGVGNADFSAMEFLDGDGGVLKAPSGEPAARDIVQFVPFRDF 526          
BLAST of Copine-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000748.1 (pep scaffold:Pmarinus_7.0:GL477446:179420:193439:1 gene:ENSPMAG00000000673.1 transcript:ENSPMAT00000000748.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 239.965 bits (611), Expect = 2.041e-73
Identity = 148/398 (37.19%), Postives = 219/398 (55.03%), Query Frame = 1
Query:  445 KDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWD-GAEGDPEDMDAELDELIGESVFTCQHLIESE-NNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRL--FNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKE---HCDGSH-YFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKV-GNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +D FGKSDP++ L+K++  GKW   YRTE+ KN LNP WK+I + L  LCDG+I K I   C DW+     +P          IGE + T   L +++ NNTV+  L+      K  +Y NSG++ ++     + YTFLDY+  G  L F +A+D +        Q++S+    FN    +N+Y + I+AV   LQ YD D  FPA+GFGAQ+P + K   ++PL  +  N  C GV  +++AY++ L  VK    A   PVI +V + AK        +H Y +L I+T+G V+D   T+ A+++AS LP+SI++VG+GS  F D+  LD D  +L     E A RD VQFVP   F R   +             ++V+ E+P Q+  Y  Q D++
Sbjct:    1 QDWFGKSDPFLELYKQTSIGKWKLVYRTEVHKNTLNPRWKNIVLNLQSLCDGNIAKPIKVVCADWNRNGRSNP----------IGECIVTVMQLNQAKLNNTVMFDLV-LPGNVKNSNYKNSGQLVVVLCTICRQYTFLDYIRGGCKLQFSMAIDFTASN-KPPSQLDSLHHTGFN---DANQYLMVIRAVGGTLQYYDADKQFPAYGFGAQLPSEEKVSQDFPLTLNANNPNCDGVQALIKAYKSCLTKVKLSEPANLAPVINRVATAAKRIKFQSKLAHEYHILFIITDGEVKDMPATREAIVQASKLPLSIVLVGVGSNDFRDLVELDSDDAILTAPSGENAFRDIVQFVPYLDFARDPVE----------KFLEQVMEEIPHQVEQYFHQMDLQ 373          
BLAST of Copine-3 vs. Ensembl Sea Lamprey
Match: cpne2 (copine II [Source:ZFIN;Acc:ZDB-GENE-030131-7896])

HSP 1 Score: 176.792 bits (447), Expect = 2.021e-51
Identity = 98/213 (46.01%), Postives = 136/213 (63.85%), Query Frame = 1
Query:  973 SNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQV---NSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKV-GNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQ 1599
            +NEY  A+ AV +++Q+YD D  FPA GFGAQ+PP+++  HE+ LN +  N FC GV+G+++AY   L  V+      F+P+I  V    + A +    + YFVLLI+T+G + D  ET+ AV++AS LP+S+I+VG+GS  F+ M+ LD D G+LK    E A+RD VQFVP R F R A          K ALAK VLAE+P Q+V Y KQ
Sbjct:   26 TNEYLAAVWAVGQVIQDYDADKQFPALGFGAQLPPEWEVSHEFALNFNPLNPFCTGVEGIVQAYMACLPQVRLYGPTNFSPIINHVARFAAAAAQQPAATQYFVLLIVTDGVISDMDETRLAVVQASRLPMSLIIVGVGSADFSAMEFLDGDGGVLKAPSGEPAARDIVQFVPFRDF-RNAP---------KEALAKAVLAEVPGQVVTYFKQ 228          
BLAST of Copine-3 vs. Ensembl Sea Lamprey
Match: cpne2 (copine II [Source:ZFIN;Acc:ZDB-GENE-030131-7896])

HSP 1 Score: 111.309 bits (277), Expect = 9.689e-28
Identity = 80/261 (30.65%), Postives = 132/261 (50.57%), Query Frame = 1
Query:   13 SKVIISVGCRHLPLEVIRAYRVTLDVGFE--GFSHHKDTMKTEFLETS-NPDFTSQLVVEYVFEEKQILAATIFYQDSASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTF--IIKLKEDSVKKNNFM-MKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQ 777
            +KV +SV C +L  + I +    L V +   G  +  +  +TE ++   NP F  +  ++Y FEE Q L   I+  DS S+ ++  H F  +G +    G + V  K  S  L     +P    II++  + +K N  + +   G  LDKKD FGKSDPY+  FKK D G W+  +RTE++ N LNP W+   + +  LC GD+++ +   C+D+D   G          + IGE   +   ++E+++   +   +N KK+
Sbjct:    6 TKVEMSVSCTNLLDKDITSKSDPLCVLYMECGPGNWMELGRTESMKNDLNPVFAHKFQIDYHFEEVQKLRFAIYDLDSPSK-RLQDHDF--LGDLTLTLGQV-VSSKKLSRALVLKDGRPAGKGIIQVLAEEMKDNRHLQLLFEGIKLDKKDFFGKSDPYLEFFKKGDDGSWVLVHRTEVVLNTLNPSWRPFTLAVQSLCGGDLDRSVRVTCYDYDSDGG---------HDFIGEFQTSVTQMLEAQSGKQVRTCMNVKKK 253          
BLAST of Copine-3 vs. Ensembl Nematostella
Match: EDO44352 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW53])

HSP 1 Score: 301.212 bits (770), Expect = 1.030e-94
Identity = 202/546 (37.00%), Postives = 300/546 (54.95%), Query Frame = 1
Query:   13 SKVIISVGCRHLPLEVIRAYRVTLDVGFE---GFSHHKDTMKTEFLETS-NPDFTSQLVVEYVFEEKQILAATIFYQDSASQE----KIYGHCFSNMGRII-HNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKE---HCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFL-RMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            ++V ISV CR+L    + +    + V F    G    ++  +TE +  + NPDF  +  + Y FEE Q L   ++  D  S         G     +G I+  NGG +E  +  E  E++  K+  T                ++  G  LDKKD FGKSDP+++ ++ ++   +   +RTE++KN LNP WK   +    LC+GDI++ I   C+DWD         D   D LIG    T + L  + N T   +L N KKQ KK+SY NSG I ++     Q  TFLD++  G  ++FIVA+D +    N ++   S+   N   + N+Y  A+ +V  I Q+YD+D LFPAFGFGA++PP+++  HE+ LNG+ QN FC+ V+GV+ +Y  +++ V+      F+P+IR+  +LAKE      G  YFVLLILT+G + D  +TK A+++A+SLPVSII+VG+G   F  M+ LD D   L      A RD VQFVP R +L +   D +   R     LAK+VL ELPDQL  YMK+ +++
Sbjct:   12 TQVEISVSCRNLADMDVFSKSDPMVVMFTQGMGTKEWREFGRTEVIMNNLNPDFVKKFTIHYFFEEIQKLRFQVYDIDKKSSRLQDHDFIGEIECTLGSIVGENGGQLEKALLCE--EVSQCKDVAT----------------LQFRGHKLDKKDFFGKSDPFLVFYRCNEDNSFTAVHRTEVVKNTLNPTWKPFSVPARALCNGDIDRSIRIECYDWD--------RDGSHD-LIGIFSTTLRELTSNPNLT--FELKNPKKQAKKKSYKNSGTIILLQSKLEQQPTFLDFIKGGTQISFIVAIDFTASNGNPQNS-NSLHFLN-PYEPNQYVKALTSVGAICQDYDSDKLFPAFGFGARLPPNWEVSHEFALNGNPQNPFCERVEGVISSYFHSIQRVQLYGPTNFSPIIRRTVALAKESERQKPGEEYFVLLILTDGIISDMEQTKAAIVDAASLPVSIIIVGVGGADFEAMEELDGDEVRLSSRGRLAERDIVQFVPFRDYLDKCYGDITSGAR-----LAKDVLEELPDQLTDYMKKRNIK 521          
BLAST of Copine-3 vs. Ensembl Nematostella
Match: EDO39500 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9X6])

HSP 1 Score: 290.812 bits (743), Expect = 1.191e-90
Identity = 184/495 (37.17%), Postives = 270/495 (54.55%), Query Frame = 1
Query:  151 NPDFTSQLVVEYVFEEKQILAATIFYQDSASQE----KIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMS--GFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHC-DGS--HYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDV 1608
            NPDF+  + V+Y FE  Q L  ++F  D+A+++       G     +G+I+          K    +   +K +    I +  + +K  N ++K++    +LD KD  GKSDP++ L K    G  +  +RTE+IKNNLNP WK   + +  LC  D +  I   C D+DG        D   D LIG +  + + L+E   +   + LIN KK+ KK+ Y+NSG + I     + + TFLDY+  G  +NF V VD +    N     +S+   N   + NEY  A+ +V E+ Q+YD+D LFPAFGFGA+IPP+F+  HE+ LN +  N +C+G+ GV+ AYQ  ++ V+       +P+I  V S A+    DG+   YFVLL++T+G + D   TK A++ AS LP+S+I+VG+GS  FTDM  LD D G L+ G+E+A RD VQFVP R F        KT       LAK VLAE+P Q   Y     +
Sbjct:   55 NPDFSKAISVDYYFELVQKLKFSVFDVDNATKQLDDDDFLGSIECTLGQIVS---------KKSFTKHLEIKGRQVGTITIYAEEMKGANEIVKLTFRATNLDNKDFMGKSDPFLELLKLKPDGGTLLVHRTEVIKNNLNPTWKVFSLPIQSLCSADYDATIRIDCHDYDG--------DGSHD-LIGIANTSLRQLLELRQSGSGLDLINPKKKAKKKKYVNSGVLYISGCEVIHHNTFLDYVMGGCQINFTVGVDFTASNGN-PSTPQSLHYIN-PYEPNEYVNALVSVGEVCQDYDSDKLFPAFGFGAKIPPNFQVSHEFALNFNPSNPYCEGIPGVVAAYQACIRQVQLYGPTNASPIINHVASFAQRAAQDGTAGAYFVLLLITDGVLSDMEATKLAIVRASRLPMSLIIVGVGSADFTDMNELDADEGTLRAGHERAERDIVQFVPFRDF--------KT--QPPAMLAKHVLAEVPKQAQEYFNSRGI 519          
BLAST of Copine-3 vs. Ensembl Nematostella
Match: EDO45927 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRD6])

HSP 1 Score: 269.626 bits (688), Expect = 1.227e-82
Identity = 189/553 (34.18%), Postives = 284/553 (51.36%), Query Frame = 1
Query:   13 SKVIISVGCRHL----------PLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQ--LINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGS----HYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDV 1608
            S+V +++ C++L          PL V+   R          ++ ++  +TE LE T NP+F++ +VV+Y FEE Q L   ++  DSAS         G     +G+++ +                      T+   LK  S K    M           D FGKSDPY+   +  + G ++  +RTE++ NNLNP WK I I   +LC+GD ++ +   C+DWD         D    +LIG    T + L   +     +Q   IN KK+KKK++Y NSG I + +   ++  +FLD++  G  +NF V +D +    N      S+   N     NEY  A+ AV EI+Q+YD+D LFPAFGFGA++PP+    H++ LN +  N FC G+ G++ AYQ  ++ V         P+I  V   A+          +Y++LLILT+G + D  +TKRA+++AS LP+SII+VG+GS  F  M+ LD D GLL+     A RD VQFVP RKF  +++           ALAKEVLAE+P Q+  Y K  ++
Sbjct:   25 SRVQLNISCKNLIDKDVMSKSDPLVVVMMLR---------HNNWEEVGRTERLENTLNPNFSTTIVVDYFFEELQKLKFMVYDIDSASGSLKNADFLGEMQCTLGQLVSSA---------------------TYTHNLKIPSGKPAGNM----------TDFFGKSDPYLEFSRAKEDGSFVVVHRTEVVSNNLNPKWKPIHISSQQLCNGDYDRVLKVNCYDWD---------DDGSHDLIGTFTTTLRELSTCQQGGAELQWPCINEKKRKKKKNYKNSGVIFLSSCQVVRVASFLDFIQGGCQINFTVGIDFTGSNGNPASPT-SLHYIN-PYAPNEYCQALTAVGEIIQDYDSDKLFPAFGFGAKVPPNNMVSHQFALNFNHTNPFCAGLQGLIEAYQQCVRQVTLYGPTNIAPIISNVAMYAQAAAQQPYASLNYYILLILTDGVISDMDQTKRAIVQASGLPMSIIIVGVGSADFEMMEELDADDGLLRSEGSTAQRDIVQFVPFRKFKNLSS----------AALAKEVLAEVPGQVTGYYKMRNI 516          
BLAST of Copine-3 vs. Ensembl Nematostella
Match: EDO49902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF64])

HSP 1 Score: 149.443 bits (376), Expect = 4.146e-39
Identity = 93/336 (27.68%), Postives = 163/336 (48.51%), Query Frame = 1
Query:  403 NNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTV-IIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHC--DGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDM 1401
             N   ++SG +L+K+ L  K D +  L +    G +   YR+EI+   L+P W    I L KLC+ ++ +E +  C+ +  +           + LI  +     HLI   N ++ ++QL+  +K +K R    +G ++I      ++++ +DY+  G D+    A+D ++   +   +  S+   +   Q NEY  A++A+  +L  YD D   P F FGA+       C  + LNGD        ++ ++  Y  +L T+K        PVI+++   A      D  HY V +++ +G   D  +TK  +I+ S LP+SI+VVG+G   FT M
Sbjct:  133 TNVRFQISGVNLEKRSLLSKWDVFFELERLLPGGFYHPVYRSEIVARTLDPRWSPFDIYLQKLCNEEVTREAVISCWHYSSSGA---------NTLIASARCPVGHLI---NRSIKVLQLVKPQKTQKARRAGTAGSLRIDHCHVDKHFSLVDYIRGGCDVTIACAIDFTLSNGDPSCR-SSLHTLSCLYQ-NEYIGALRALGPVLMHYDEDKQIPTFAFGAKSKHGIPYC--FALNGDESEPEISSIETLIDTYTRSLTTIKLGGPTYLVPVIKRLADYATRELSQDSQHYLVAMVIMDGVANDLDDTKEQIIQVSGLPLSIVVVGVGPADFTAM 452          
BLAST of Copine-3 vs. Ensembl Nematostella
Match: EDO26801 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TB16])

HSP 1 Score: 99.3673 bits (246), Expect = 4.492e-23
Identity = 72/202 (35.64%), Postives = 108/202 (53.47%), Query Frame = 1
Query:  430 FDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQ--LINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYD 1029
            +D   KD FGKSDPY+   +  + G ++  +RTE++ NNLNP WK I I   +LC+GD ++ +   C+DWD         D    +LIG    T + L   +     +Q   IN KK+KKK++Y NSG I + +   ++  +FLD++  G  +NF V +D +    N      S+   N     NEY  A+ AV EI+Q+YD
Sbjct:  101 YDRVLKDFFGKSDPYLEFSRAKEDGSFVVVHRTEVVSNNLNPKWKPIHISSQQLCNGDYDRVLKVNCYDWD---------DDGSHDLIGTFTTTLRELSTCQQGGAELQWPCINEKKRKKKKNYKNSGVIFLSSCQVVRVASFLDFIQGGCQINFTVGIDFTGSNGNPASPT-SLHYIN-PYAPNEYCQALTAVGEIIQDYD 291          
BLAST of Copine-3 vs. Ensembl Medaka
Match: cpne5b (copine-8 [Source:NCBI gene;Acc:101170754])

HSP 1 Score: 334.339 bits (856), Expect = 7.285e-106
Identity = 202/552 (36.59%), Postives = 311/552 (56.34%), Query Frame = 1
Query:   13 SKVIISVGCRHL----------PLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKP--TFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQN-YTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +KV I+V CRHL          P+ V+    V            ++  +TE ++ T NPDF  + +++Y FEEKQ L   ++  DS S    +    G  F  +G I+ +  S +E P       L  +  K   T I+  +E S  +++  M+     LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W+   I +  LC+GD ++ I    +DWD         D   D  IG+   + + L   ++   + ++IN KK+ KK+ Y+NSG + +++ FS+++ +TFLDY+  G  +NF VA+D +    N   Q  S+   N   Q N Y +A+KAV EI+Q+YD+D +FPA GFGA++PPD +  HE+PLNG+ +N +C G++G+L AY  +LKTV+      F PV+  V   A    DGS YFVLLI+T+G + D  +TK A++ A+ LP+SII+VG+G   F  M  LD D   +    + A RD VQFVP R +  M   G+  +   +  LAK+VLAE+PDQ ++YMK   V+
Sbjct:   86 TKVEITVSCRHLLDKDTFSKSDPMCVLYTQGVET-------KQWREFGRTEVIDNTLNPDFVRKYILDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQVFCTLGEIVGSPASRLEKP-------LGGIPGKKCGTIILSAEELSNCRDSATMQFCANKLDKKDFFGKSDPFMVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFTIPVRALCNGDYDRTIKVEVYDWD--------RDGSHD-FIGDFTTSYRELARGQSQFNVYEVINTKKKMKKKKYVNSGTVTLLS-FSVESEFTFLDYIKGGTQINFTVAIDFTASNGN-PSQSTSLHYMN-PYQLNAYAMALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNLENPYCNGIEGILEAYHESLKTVQLYGPTNFAPVVNHVARYAAAVQDGSQYFVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDIRVSSRGKLAERDIVQFVPFRDY--MDRTGNHVLSMAR--LAKDVLAEIPDQFISYMKSRGVK 607          
BLAST of Copine-3 vs. Ensembl Medaka
Match: cpne5b (copine-8 [Source:NCBI gene;Acc:101170754])

HSP 1 Score: 328.946 bits (842), Expect = 4.793e-105
Identity = 191/504 (37.90%), Postives = 294/504 (58.33%), Query Frame = 1
Query:  127 KTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKP--TFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQN-YTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +TE ++ T NPDF  + +++Y FEEKQ L   ++  DS S    +    G  F  +G I+ +  S +E P       L  +  K   T I+  +E S  +++  M+     LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W+   I +  LC+GD ++ I    +DWD         D   D  IG+   + + L   ++   + ++IN KK+ KK+ Y+NSG + +++ FS+++ +TFLDY+  G  +NF VA+D +    N   Q  S+   N   Q N Y +A+KAV EI+Q+YD+D +FPA GFGA++PPD +  HE+PLNG+ +N +C G++G+L AY  +LKTV+      F PV+  V   A    DGS YFVLLI+T+G + D  +TK A++ A+ LP+SII+VG+G   F  M  LD D   +    + A RD VQFVP R +  M   G+  +   +  LAK+VLAE+PDQ ++YMK   V+
Sbjct:   19 RTEVIDNTLNPDFVRKYILDYFFEEKQNLRFDLYDVDSKSPDLSKHDFLGQVFCTLGEIVGSPASRLEKP-------LGGIPGKKCGTIILSAEELSNCRDSATMQFCANKLDKKDFFGKSDPFMVFYRSNEDGTFTICHKTEVVKNTLNPVWQPFTIPVRALCNGDYDRTIKVEVYDWD--------RDGSHD-FIGDFTTSYRELARGQSQFNVYEVINTKKKMKKKKYVNSGTVTLLS-FSVESEFTFLDYIKGGTQINFTVAIDFTASNGN-PSQSTSLHYMN-PYQLNAYAMALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNLENPYCNGIEGILEAYHESLKTVQLYGPTNFAPVVNHVARYAAAVQDGSQYFVLLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDIRVSSRGKLAERDIVQFVPFRDY--MDRTGNHVLSMAR--LAKDVLAEIPDQFISYMKSRGVK 499          
BLAST of Copine-3 vs. Ensembl Medaka
Match: cpne8 (copine-8 [Source:NCBI gene;Acc:101173626])

HSP 1 Score: 328.946 bits (842), Expect = 1.519e-104
Identity = 187/503 (37.18%), Postives = 294/503 (58.45%), Query Frame = 1
Query:  127 KTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIF----YQDSASQEKIYGHCFSNMGRIIHNGGS-IEVP-IKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLIN-HKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +TE ++ T NPDF  + +++Y FEE+Q L   ++      D+ S+    G  F  +G I+ + GS +E P I I        K   T I++ +E S  + + M++  G  LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN L+P W++  I +  LC+GD ++ I    +DWD   G          + IGE   + + +  S++   I +++N  KK KKK+ Y+NSG + +++       +FLDY+  G  +NF VA+D +    N   Q  S+   +   Q N+Y +A++AV EI+Q+YD+D LFPA GFGA++PPD +  HE+PLNG+ QN +C G+DGVL AY  +LK+V+      F+PVI  V   A    DGS YF+LLI+++G + D  +TK +++ A+SLP+SII+VG+G   F +M  LD D   +      A RD VQFVP R ++    D       +   LAKEVLAE+PDQ ++YM+   ++
Sbjct:   60 RTEVIDNTLNPDFVRKFILDYFFEERQNLRFDLYDLDCKSDNLSKHDFLGQAFCTLGEIVGSLGSRLEKPLIGIPG------KKCGTIIVRAEELSNCRESVMLQFCGNKLDKKDFFGKSDPFLVFYRSNEDGSYTICHKTEVVKNTLDPVWQAFKIPVRALCNGDYDRSIKVEVYDWDRDGGH---------DFIGEFSTSYREMSRSQSQFHIYEVLNPKKKGKKKKKYLNSGTVTLLSCLVDTELSFLDYIRGGTQINFTVAIDFTASNGN-PSQPTSLHYMS-PYQLNDYAMALRAVGEIIQDYDSDKLFPALGFGAKLPPDGRVSHEFPLNGNPQNPYCNGIDGVLEAYYQSLKSVRLYGPTHFSPVINHVARYASAVTDGSQYFILLIISDGVITDMAQTKESIVNAASLPMSIIIVGVGPAEFDEMIELDGDEERISSQGRYAERDIVQFVPFRDYI----DRRGNHILSMARLAKEVLAEIPDQFLSYMRTRGIK 541          
BLAST of Copine-3 vs. Ensembl Medaka
Match: CPNE8 (copine 8 [Source:NCBI gene;Acc:101158741])

HSP 1 Score: 325.865 bits (834), Expect = 2.516e-103
Identity = 199/551 (36.12%), Postives = 306/551 (55.54%), Query Frame = 1
Query:   13 SKVIISVGCRHL----------PLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKP--TFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVR 1611
            +KV I+V CR+L          P+ V+    +       G    ++  +TE ++ T NPDF  + +++Y FEE+Q L   ++  DS S    +    G  +  +G I+ + GS +E P       L  +  K   T I+K +E +  + + MM+  G  LDKKD FGKSDP++I ++ ++ G +   ++TE++KN LNP W++  I +  LC+GD ++ I    +DWD         D   D  IGE   + + L   ++   + +++N KK+ KK+ Y+NSG + +++       TFLDY+  G  +NF VA+D +    N   Q  S+   +   Q N Y +A+KAV EI+Q+YD+D +FPA GFGA++PPD +  HE+ LNG+ QN +C G+DGV+ AY   LK+V+      F PVI  V   A    DGS YFVLLI+T+G + D   TK A++ AS LP+SI++VG+G   F  M  LD D   +      A RD VQFVP R +  M   G+  +   +  LAK+VLAE+PDQ ++YM+   ++
Sbjct:   24 TKVEITVSCRNLLDMDTFSKSDPICVLYTQAI-------GNKEWREFGRTEVIDNTLNPDFVRKFILDYFFEERQNLRLDLYDVDSKSANLSKHDFLGQAYCTLGEIVGSLGSRLEKP-------LGGIPGKKCGTIIVKAEELNNCRESVMMQFCGNKLDKKDFFGKSDPFLIFYRSNEDGTFTICHKTEVVKNTLNPVWQAFKIPVRALCNGDYDRTIKVEVYDWD--------RDGSHD-FIGEFSTSYRELSRGQSQFNVYEVVNPKKKGKKKKYLNSGTVTLLSFLVDIEVTFLDYIKGGTQINFTVAIDFTASNGN-PAQPTSLHYMS-PYQLNTYAMALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFALNGNPQNPYCDGIDGVMEAYYQTLKSVQLYGPTNFAPVINHVARYAASVKDGSQYFVLLIITDGVITDMALTKEAIVNASGLPMSILIVGVGPAEFDAMVELDGDEVRISSRGRLAERDIVQFVPFRDY--MDRTGNHVLSMAR--LAKDVLAEIPDQFLSYMRTRGIK 545          
BLAST of Copine-3 vs. Ensembl Medaka
Match: cpne5a (copine-5 [Source:NCBI gene;Acc:101166794])

HSP 1 Score: 325.479 bits (833), Expect = 4.039e-103
Identity = 202/572 (35.31%), Postives = 318/572 (55.59%), Query Frame = 1
Query:   13 SKVIISVGCRHL----------PLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLE-TSNPDFTSQLVVEYVFEEKQILAATIFYQDSAS----QEKIYGHCFSNMGRIIHNGGS-IEVPIKIESNELNNMKNKP--TFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQN-YTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVRLKFCDNSPVHKQYDNFKSPK 1671
            +KV I+V CR+L          P+ V+         G E     ++  +TE ++ T NPDF  + +++Y FEEKQ L   ++  DS S    +    G  +  +G I+ +  S +E P       L  +  K   T I+  +E    ++   M+     LDKKD FGKSDP+++ ++ ++ G +   ++TE++KN LNP W+   I +  LC+GD ++ I    +DWD         D   D  IGE   + + L   ++ + + +++N KK+ KK+ YINSG + +++ FS+++ +TFLDY+  G  ++F VA+D +    N   Q  S+   N   Q N Y +A+KAV EI+Q+YD+D +FPA GFGA++PPD +  HE+PLNG+ +N +C G++G+L AY  +LK V+      F PV+  V   A    DGS YF+LLI+T+G + D  +TK A++ A+ LP+SII+VG+G   F  M  LD D   +    + A RD VQFVP R +  M   G+  +   +  LAK+VLAE+PDQL++YMK   ++      +PV   Y    +P+
Sbjct:   28 TKVEITVSCRNLLDRDTFSKSDPMVVLYTQ------GVES-KQWREFGRTEVIKNTLNPDFVRKYILDYFFEEKQNLRFDVYDIDSKSPDLGKHDFLGQVYCTLGEIVGSPASRLEKP-------LGGIPGKTCGTIILSAEELGNCRDYATMQFCANKLDKKDFFGKSDPFMVFYRSNEDGTFTICHKTEVVKNTLNPMWQPFSIPVRALCNGDYDRTIKVEVYDWD--------RDGSHD-FIGEFSTSYKELCRGQSESNVYEVVNAKKKLKKKRYINSGTVSLLS-FSVESEHTFLDYIKGGTQIHFTVAIDFTASNGN-PSQSTSLHYMN-PYQMNAYAMALKAVGEIIQDYDSDKMFPALGFGAKLPPDGRVSHEFPLNGNVENPYCNGMEGILEAYHQSLKLVQLYGPTNFAPVVNHVARYAAAVEDGSQYFILLIITDGVISDMAQTKEAIVNAAKLPMSIIIVGVGQAEFDAMVELDGDDVRISSRGKLAERDIVQFVPFRDY--MDRTGNHVLSMAR--LAKDVLAEIPDQLISYMKSRAIK-----PNPVPPPYSTCNNPE 564          
BLAST of Copine-3 vs. Planmine SMEST
Match: SMESG000043402.1 (SMESG000043402.1)

HSP 1 Score: 1075.08 bits (2779), Expect = 0.000e+0
Identity = 536/604 (88.74%), Postives = 539/604 (89.24%), Query Frame = 1
Query:    1 MPTKSKVIISVGCRHLPLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLETSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEY-PLNGDF------------------------------------------QNAFC--KGVDG------------VLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVRLKFCDNSPVH 1641
            MPTKSKVIISVGCRHLPLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLETSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEY  + G F                                             FC  K ++G            VLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVRLKFCDNSPV 
Sbjct:    1 MPTKSKVIISVGCRHLPLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLETSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYLCIIGSFIRNTDLHVDIRPTFTTAAHLKSQLRKSQTSDLYRKDCLCHSSTKCFCFSKNINGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVRLKFCDNSPVQ 604          

HSP 2 Score: 167.933 bits (424), Expect = 6.271e-44
Identity = 81/83 (97.59%), Postives = 83/83 (100.00%), Query Frame = 2
Query: 1643 NSMTISNLRKNYSIKSYVVASPHMSISDRILDLMSKAGEINRIPCHILISFPIEAYERSQLILFIKTMTGRIKFYQIKENNLR 1891
            NSMTISNLRKNYSIKSYVVASPHMSISDRILDLMSKAGEI+RIPCHILISFPIEAYERSQL+LFIKTMTGRIKFYQIKENNLR
Sbjct:  605 NSMTISNLRKNYSIKSYVVASPHMSISDRILDLMSKAGEISRIPCHILISFPIEAYERSQLMLFIKTMTGRIKFYQIKENNLR 687          
BLAST of Copine-3 vs. Planmine SMEST
Match: SMESG000043402.1 (SMESG000043402.1)

HSP 1 Score: 760.37 bits (1962), Expect = 0.000e+0
Identity = 367/367 (100.00%), Postives = 367/367 (100.00%), Query Frame = 1
Query:    1 MPTKSKVIISVGCRHLPLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLETSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEY 1101
            MPTKSKVIISVGCRHLPLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLETSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEY
Sbjct:    1 MPTKSKVIISVGCRHLPLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLETSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEY 367          
BLAST of Copine-3 vs. Planmine SMEST
Match: SMESG000029196.1 (SMESG000029196.1)

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 320/609 (52.55%), Postives = 412/609 (67.65%), Query Frame = 1
Query:   10 KSKVIISVGCRHLPLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLETSNPDFTSQLVVEYVFEEKQILAATIFYQDSASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESN--ELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVRLKFCDNSPVHKQYDNFK-SPKELQHQKLRRCVTAHVNIRPNSGSDVEGRRDKQDSMSHSDFFSNRSLRKKSTD 1827
            K KVI+ +GC +LP +   +Y     V   G+ H KD MKTE     NP F  QL ++Y FEEKQ +   IF     S+    G   S +GR+IH+GG + + I I+ +    NN  + P  I  ++EDS  K N  +KM GF+LDKKDLFGKSDPYVI++KK+++GK ++TYR+EIIKN LNPDW+SI + + KLC+ ++  EI  +CFDWDGA+GDPEDMD E DE+IGE     +  +         +LIN +K+KKK+ Y NSG + +  +   ++ +F+DYMF G DLNFIVA+D++    +I D   S   F     SNEY +AI+AV+EILQEYDND LFPAFGFGA++ PDFK CHEYPL GDF N FC GV+GV+ AY   L+ +K      F PVIRQV +LAK++CDGSHYFVLLILT+GTV+DWIETK+AVIEAS LP+SIIVVG+G G F DMKTLDQDFGLLKVGNE+A RDNVQFVPMRKFLR AADGS  ++W+KVALAKEVLAELP+QL+ YM +++++    + S +    DN K + KE   QKLRRC TA+   + N       R+   D ++   F   R  RK S D
Sbjct:    3 KPKVIVGIGCLNLP-DTFLSYYAEFSVATGGYIHDKDVMKTENQTDQNPIFKCQLNLDYFFEEKQCIKVEIFGLSKDSKISKIGCAESTIGRVIHSGGELFLQINIDKDLSYGNNESHSPICIFYVREDSDCKENIEIKMQGFNLDKKDLFGKSDPYVIMYKKNERGKLVKTYRSEIIKNTLNPDWRSIMVSVEKLCNKNLQSEIYVKCFDWDGAKGDPEDMDNEFDEIIGEFSIPAKEFLYPYIQERKFELINSRKKKKKKGYSNSGIVTVRTNQVSKDNSFIDYMFGGTDLNFIVAIDLTSSNGDIHD--PSSLHFIDENSSNEYSIAIQAVLEILQEYDNDELFPAFGFGARVAPDFKICHEYPLTGDFSNPFCHGVEGVINAYHEVLQNIKLSGPTYFAPVIRQVINLAKQYCDGSHYFVLLILTDGTVDDWIETKKAVIEASFLPISIIVVGVGGGKFLDMKTLDQDFGLLKVGNEQACRDNVQFVPMRKFLRPAADGSDNVKWSKVALAKEVLAELPEQLLDYMNKHNLKPIGENKSLLSATLDNSKLNAKEFVQQKLRRCATAYGMTKSN-------RQGSTDGLNGRGF---RGTRKCSVD 598          
BLAST of Copine-3 vs. Planmine SMEST
Match: SMESG000007275.1 (SMESG000007275.1)

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 304/579 (52.50%), Postives = 411/579 (70.98%), Query Frame = 1
Query:    1 MPTKSKVIISVGCRHLPLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLETS-NPDFTSQLVVEYVFEEKQILAAT---IFYQDSASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVRLKFCDNSPVHKQYDNFKSPKEL-----QHQKLRRCVTA 1710
            M  KSKV+IS+ CR+LP E    Y  TL V   G+ H KDT+ TE ++ S + DF  +L +EY+FEEKQI+      I++ +SA    +   C  ++GRIIH+GG +    +       ++  +   I K+ ED+  K+N  +KM G+ LDKKD+FGKSDPYVI+++++DKGK IRTYR+E++KN LNPDWK++   L +LC  D++ E++ +CFDWDGA GDPEDMD E DELIGE   T ++L+ +       +L+N +K+KKK++Y +SG I I    ++ + +FLDYMF G DLNFIVA+D++    ++ED   S+   +V   +NEY VAI+AV+EILQEYDND +FPAFGFGA++PPDFK  HEYPLNGD+ N FCKGV+GV++AY+ AL  VK      F PVIRQV++L+KEH DGSHYF+LLILT+G+V+DW+ETKRAVIEAS LPVSIIV+G+G   F+DM+ LDQDF LL+VGN++A RDNVQFVPMR+FLR AADGS +IRWNKV+LAKEVLAELP Q++ YM ++   L      P   ++  + S K+L     Q  +LRRC T+
Sbjct:    1 MTEKSKVLISLSCRNLPTESFEMYYATLRVATGGYFHDKDTISTEKVKDSKDIDFIQKLQLEYIFEEKQIIRIELHGIYFGESACVATL--EC--SVGRIIHSGGELS---RFTEWCWKSITCEIEIIYKVTEDAASKDNLEIKMQGYGLDKKDIFGKSDPYVIIYRRNDKGKLIRTYRSEVVKNTLNPDWKAVVASLERLCGNDLDCELIFKCFDWDGANGDPEDMDTEFDELIGEFTTTTRYLLSANGEQKKFELVNSRKKKKKKNYQHSGLITIRTIQTITDLSFLDYMFGGTDLNFIVAIDLTSSNGDVEDPT-SLHYMDVN-NTNEYSVAIQAVLEILQEYDNDEMFPAFGFGARVPPDFKISHEYPLNGDYSNPFCKGVEGVMKAYREALLQVKLSGPTHFAPVIRQVSNLSKEHRDGSHYFILLILTDGSVDDWVETKRAVIEASYLPVSIIVIGVGGRKFSDMEILDQDFKLLRVGNDQACRDNVQFVPMRRFLRAAADGSDSIRWNKVSLAKEVLAELPVQVLHYMSRHKGAL-----GPRRSEHYRYCSMKDLLRQFSQDTRLRRCATS 565          
BLAST of Copine-3 vs. Planmine SMEST
Match: SMESG000064685.1 (SMESG000064685.1)

HSP 1 Score: 509.605 bits (1311), Expect = 7.709e-174
Identity = 268/581 (46.13%), Postives = 377/581 (64.89%), Query Frame = 1
Query:   10 KSKVIISVGCRHLPLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLETSNPDFTSQLVVEYVFEEKQILAATIF-YQDSASQEKIYGHCFSNMGRIIHNGGSIEVPIKIESNELNNMKN--KPTFIIKLKEDSVKKNNFMMKMSGFDLDKKDLFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDGDINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESEN-NTVIIQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAVDMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPAFGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNTACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSLPVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRMAADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVRLKFCDNSPVHKQYDNFKSPKELQHQKLRRCVTAHVNIRPNSGS 1740
            K KV+IS+   +L     + Y   + V   G+ H +DT+KTE     +  F ++L +EY+FEEKQ++   IF Y  +   + + G    ++GR+IH+GG I  P++I +NE         P   I ++ED   K N  +K+ G  L K ++FGK+DPY+++F+ +++ ++++ YRTE++KN  NPDW  I +   +LC+ D+N  +  R +  DG   + E++D   D+L+GE   T + LI+         +LIN KK+KKK+SY+NSG I + A  +    TFLD+MF G++LNFIVA+D+++   N +  + S   F     +NEY VAI+AV+EILQEYDND LFPAFGFGA++PPD+K CHEYPLNGDF+N +C+G +GV+ AYQ  LK VK     CF+PVIR ++ LAK    G HYFVLLILT+G+V+DW+ETK+AV+E S LPVSIIVVG+G G F+DM+TLDQDFGLL V NEKA RDNVQFV MR++LR+AADGS  IRW+KVALAK+VLAELP Q+  YM +      + +N P  +    F S           C+  + +  PNS S
Sbjct:    6 KPKVLISLIVNNLSGTEGKLYWANISVETGGYIHSRDTIKTERKSGHDITFDAKLCIEYLFEEKQMIIIEIFEYDITQDGDNLLGEVDCSIGRVIHSGGVILKPLEI-TNEFKTTLGPLSPEVGIYVEEDLTAKENIELKIRGIGLAKTEIFGKTDPYLMIFRCNNRSRYVQCYRTEVLKNTQNPDWSPIVVSYERLCNNDLNSVLCLRVYCGDGTLKESEEVDIACDQLVGEIKVTARELIQMRRMEEKQFELINPKKKKKKKSYLNSGIISVRAQKTNSEPTFLDFMFQGLELNFIVAIDLTLS--NGDSSLPSSLHFMDCSLTNEYSVAIQAVLEILQEYDNDELFPAFGFGARVPPDYKICHEYPLNGDFENPYCRGAEGVIHAYQQTLKEVKLAGPTCFSPVIRHISRLAKASESGKHYFVLLILTDGSVDDWVETKKAVVETSYLPVSIIVVGVGGGKFSDMETLDQDFGLLMVSNEKACRDNVQFVKMRRYLRVAADGSDNIRWSKVALAKDVLAELPYQVNEYMHRKTKLTNYLENLPTQRSTAVFSS-----------CLRQNCSSDPNSLS 572          
The following BLAST results are available for this feature:
BLAST of Copine-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CPNE57.306e-10436.06copine 5 [Source:HGNC Symbol;Acc:HGNC:2318][more]
CPNE97.655e-10235.36copine family member 9 [Source:HGNC Symbol;Acc:HGN... [more]
CPNE87.689e-10135.15copine 8 [Source:HGNC Symbol;Acc:HGNC:23498][more]
CPNE81.017e-9936.53copine 8 [Source:HGNC Symbol;Acc:HGNC:23498][more]
CPNE21.637e-9438.87copine 2 [Source:HGNC Symbol;Acc:HGNC:2315][more]
back to top
BLAST of Copine-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nra-16.015e-7033.92Nicotinic receptor-associated protein 1 [Source:U... [more]
nra-13.067e-6833.73Nicotinic receptor-associated protein 1 [Source:U... [more]
gem-46.573e-6732.87Gon-2 Extragenic Modifier [Source:UniProtKB/TrEMB... [more]
gem-46.573e-6732.87Gon-2 Extragenic Modifier [Source:UniProtKB/TrEMB... [more]
cpna-54.287e-4827.40Copine family protein 5 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Copine-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Copine-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpne5a1.941e-10936.79copine Va [Source:ZFIN;Acc:ZDB-GENE-081105-9][more]
cpne5b2.910e-10536.18copine Vb [Source:ZFIN;Acc:ZDB-GENE-040426-1398][more]
cpne5b3.371e-10435.97copine Vb [Source:ZFIN;Acc:ZDB-GENE-040426-1398][more]
cpne85.102e-10234.26copine VIII [Source:ZFIN;Acc:ZDB-GENE-100809-1][more]
cpne11.356e-9636.21copine I [Source:ZFIN;Acc:ZDB-GENE-030131-3562][more]
back to top
BLAST of Copine-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acot111.006e-10637.70acyl-CoA thioesterase 11 [Source:Xenbase;Acc:XB-GE... [more]
cpne92.087e-10637.72copine family member IX [Source:NCBI gene;Acc:1001... [more]
cpne98.174e-10537.96copine family member IX [Source:NCBI gene;Acc:1001... [more]
acot116.385e-10338.48acyl-CoA thioesterase 11 [Source:Xenbase;Acc:XB-GE... [more]
acot112.782e-10038.24acyl-CoA thioesterase 11 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Copine-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cpne58.303e-10536.23copine V [Source:MGI Symbol;Acc:MGI:2385908][more]
Cpne93.086e-10235.42copine family member IX [Source:MGI Symbol;Acc:MGI... [more]
Cpne83.399e-10135.09copine VIII [Source:MGI Symbol;Acc:MGI:1914121][more]
Cpne21.935e-9339.55copine II [Source:MGI Symbol;Acc:MGI:2387578][more]
Cpne22.791e-9339.68copine II [Source:MGI Symbol;Acc:MGI:2387578][more]
back to top
BLAST of Copine-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8JZW4|CPNE5_MOUSE5.808e-10436.23Copine-5 OS=Mus musculus OX=10090 GN=Cpne5 PE=1 SV... [more]
sp|Q9HCH3|CPNE5_HUMAN3.508e-10336.06Copine-5 OS=Homo sapiens OX=9606 GN=CPNE5 PE=1 SV=... [more]
sp|Q5BJS7|CPNE9_RAT1.568e-10135.42Copine-9 OS=Rattus norvegicus OX=10116 GN=Cpne9 PE... [more]
sp|Q1RLL3|CPNE9_MOUSE1.879e-10135.42Copine-9 OS=Mus musculus OX=10090 GN=Cpne9 PE=1 SV... [more]
sp|Q8IYJ1|CPNE9_HUMAN3.676e-10135.36Copine-9 OS=Homo sapiens OX=9606 GN=CPNE9 PE=1 SV=... [more]
back to top
BLAST of Copine-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DGU07.556e-17848.04Copine-8 OS=Schistosoma japonicum OX=6182 GN=EWB00... [more]
A0A3Q0KS664.913e-17548.14Copine, putative OS=Schistosoma mansoni OX=6183 PE... [more]
A0A267G9Y06.272e-17048.81Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FGY68.202e-16948.63Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A4S2L3S09.598e-16647.32C2 domain-containing protein OS=Opisthorchis felin... [more]
back to top
BLAST of Copine-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpne5b1.612e-10436.12copine-5 [Source:NCBI gene;Acc:103046149][more]
cpne5b1.432e-10335.79copine-5 [Source:NCBI gene;Acc:103046149][more]
CPNE91.780e-9736.85copine family member 9 [Source:HGNC Symbol;Acc:HGN... [more]
CPNE82.880e-9734.85copine 8 [Source:HGNC Symbol;Acc:HGNC:23498][more]
cpne13.630e-9536.15copine-3-like [Source:NCBI gene;Acc:103034615][more]
back to top
BLAST of Copine-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpne29.759e-9738.86copine II [Source:ZFIN;Acc:ZDB-GENE-030131-7896][more]
ENSPMAT00000007777.13.249e-7633.99pep scaffold:Pmarinus_7.0:GL477373:3581:22444:1 ge... [more]
ENSPMAT00000000748.12.041e-7337.19pep scaffold:Pmarinus_7.0:GL477446:179420:193439:1... [more]
cpne22.021e-5146.01copine II [Source:ZFIN;Acc:ZDB-GENE-030131-7896][more]
cpne29.689e-2830.65copine II [Source:ZFIN;Acc:ZDB-GENE-030131-7896][more]
back to top
BLAST of Copine-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Copine-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO443521.030e-9437.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395001.191e-9037.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459271.227e-8234.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499024.146e-3927.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268014.492e-2335.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Copine-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpne5b7.285e-10636.59copine-8 [Source:NCBI gene;Acc:101170754][more]
cpne5b4.793e-10537.90copine-8 [Source:NCBI gene;Acc:101170754][more]
cpne81.519e-10437.18copine-8 [Source:NCBI gene;Acc:101173626][more]
CPNE82.516e-10336.12copine 8 [Source:NCBI gene;Acc:101158741][more]
cpne5a4.039e-10335.31copine-5 [Source:NCBI gene;Acc:101166794][more]
back to top
BLAST of Copine-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043402.16.271e-4488.74SMESG000043402.1[more]
SMESG000043402.10.000e+0100.00SMESG000043402.1[more]
SMESG000029196.10.000e+052.55SMESG000029196.1[more]
SMESG000007275.10.000e+052.50SMESG000007275.1[more]
SMESG000064685.17.709e-17446.13SMESG000064685.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016898 ID=SMED30016898|Name=Copine-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1922bp
ATGCCAACCAAATCAAAGGTTATAATAAGTGTGGGATGCAGACATCTTCC
ACTGGAGGTTATTCGGGCGTATCGAGTGACGCTTGATGTTGGATTTGAAG
GATTTTCACATCACAAAGATACCATGAAAACGGAATTCCTAGAAACATCG
AATCCCGACTTCACTAGTCAGTTGGTTGTCGAATATGTTTTTGAAGAAAA
ACAAATATTAGCAGCAACAATATTTTACCAAGATTCGGCAAGCCAGGAGA
AAATCTACGGTCATTGCTTTTCCAATATGGGAAGGATTATTCATAACGGA
GGAAGTATTGAAGTACCAATCAAAATAGAGAGCAATGAATTGAACAATAT
GAAGAATAAACCAACATTCATCATAAAACTTAAAGAAGATTCTGTGAAAA
AAAACAATTTCATGATGAAAATGAGTGGATTTGATTTGGATAAAAAAGAT
TTATTTGGCAAATCTGATCCCTATGTAATTCTTTTCAAGAAATCTGATAA
GGGAAAATGGATCAGAACTTACAGAACAGAAATAATCAAAAATAATTTAA
ATCCTGATTGGAAATCTATTCCAATTTGTTTAAATAAGCTCTGTGATGGT
GACATAAACAAAGAGATATTAGCAAGATGCTTTGATTGGGATGGCGCGGA
AGGAGACCCAGAGGATATGGATGCAGAGTTAGATGAGCTAATTGGCGAGT
CCGTATTCACCTGTCAACATTTAATTGAATCGGAAAACAATACAGTTATA
ATCCAACTTATCAATCACAAGAAGCAAAAGAAAAAACGATCCTATATTAA
CTCTGGAAAGATCCAGATAATTGCCGACTTTTCAATGCAGAATTACACGT
TTCTCGATTACATGTTTTCTGGTATTGATTTGAATTTCATTGTCGCCGTT
GATATGTCCATTCCGAAACTGAACATTGAGGATCAGATCGAGTCCATTCG
CCTTTTCAACGTCACAAGGCAATCTAACGAATATGAAGTGGCTATCAAAG
CTGTTATTGAAATTTTACAAGAATATGATAATGACAACCTTTTTCCAGCC
TTTGGTTTCGGTGCTCAAATTCCACCAGATTTCAAAGAATGCCACGAGTA
TCCTCTGAATGGAGATTTTCAAAACGCATTCTGTAAAGGAGTAGACGGAG
TTTTGAGAGCTTATCAAACTGCTTTGAAGACGGTAAAATCCATGAATACA
GCTTGTTTCACTCCGGTAATTCGACAAGTTAACAGTTTAGCAAAAGAACA
TTGCGATGGAAGTCACTATTTCGTACTGTTAATTTTAACAAATGGAACCG
TTGAAGACTGGATTGAAACTAAGCGGGCTGTTATTGAAGCCTCTTCATTG
CCAGTCTCTATAATTGTTGTTGGTATAGGCTCAGGAGCATTCACAGATAT
GAAAACTTTAGACCAAGACTTTGGATTACTGAAGGTTGGAAATGAAAAGG
CATCTAGAGACAATGTTCAATTTGTTCCAATGAGGAAATTTCTTCGAATG
GCAGCAGACGGCTCAAAAACGATCCGATGGAACAAAGTAGCCCTTGCTAA
AGAAGTACTAGCGGAACTACCAGATCAATTAGTAGCCTACATGAAACAAA
ACGATGTTCGTTTGAAGTTTTGTGACAATTCTCCTGTGCATAAACAGTAT
GACAATTTCAAATCTCCGAAAGAATTACAGCATCAAAAGTTACGTCGTTG
CGTCACCGCACATGTCAATATCAGACCGAATTCTGGATCTGATGTCGAAG
GCAGGAGAGATAAACAGGATTCCATGTCACATTCTGATTTCTTTTCCAAT
CGAAGCTTACGAAAGAAGTCAACTGATATTATTTATAAAAACAATGACGG
GCCGGATAAAATTTTATCAAATAAAAGAAAATAATTTACGTCTAATTTTA
TGAGATTTATTAATTGACATCG
back to top

protein sequence of SMED30016898-orf-1

>SMED30016898-orf-1 ID=SMED30016898-orf-1|Name=SMED30016898-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=628bp
MPTKSKVIISVGCRHLPLEVIRAYRVTLDVGFEGFSHHKDTMKTEFLETS
NPDFTSQLVVEYVFEEKQILAATIFYQDSASQEKIYGHCFSNMGRIIHNG
GSIEVPIKIESNELNNMKNKPTFIIKLKEDSVKKNNFMMKMSGFDLDKKD
LFGKSDPYVILFKKSDKGKWIRTYRTEIIKNNLNPDWKSIPICLNKLCDG
DINKEILARCFDWDGAEGDPEDMDAELDELIGESVFTCQHLIESENNTVI
IQLINHKKQKKKRSYINSGKIQIIADFSMQNYTFLDYMFSGIDLNFIVAV
DMSIPKLNIEDQIESIRLFNVTRQSNEYEVAIKAVIEILQEYDNDNLFPA
FGFGAQIPPDFKECHEYPLNGDFQNAFCKGVDGVLRAYQTALKTVKSMNT
ACFTPVIRQVNSLAKEHCDGSHYFVLLILTNGTVEDWIETKRAVIEASSL
PVSIIVVGIGSGAFTDMKTLDQDFGLLKVGNEKASRDNVQFVPMRKFLRM
AADGSKTIRWNKVALAKEVLAELPDQLVAYMKQNDVRLKFCDNSPVHKQY
DNFKSPKELQHQKLRRCVTAHVNIRPNSGSDVEGRRDKQDSMSHSDFFSN
RSLRKKSTDIIYKNNDGPDKILSNKRK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005544calcium-dependent phospholipid binding
GO:0048306calcium-dependent protein binding
GO:0005515protein binding
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005925focal adhesion
GO:0016020membrane
GO:0030054cell junction
GO:0042995cell projection
GO:0043005neuron projection
GO:0043025neuronal cell body
GO:0043204perikaryon
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0030335positive regulation of cell migration
GO:0038128ERBB2 signaling pathway
GO:0071277cellular response to calcium ion
GO:0071363cellular response to growth factor stimulus
GO:0030154cell differentiation
GO:1903861positive regulation of dendrite extension
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000008C2_dom
IPR010734Copine
IPR002035VWF_A