SMED30016897

Overview
NameSMED30016897
Smed IDSMED30016897
Length (bp)1105
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30016897 (SMED30016897) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30016897 (SMED30016897) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30016897 (SMED30016897) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30016897 (SMED30016897) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016897

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30016897SMESG000023253.1 dd_Smed_v4_1757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30016897SMESG000023253.1 dd_Smed_v4_1757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016897SMESG000023253.1 dd_Smed_v4_1757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016897SMESG000023253.1 dd_Smed_v4_1757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016897SMESG000023253.1 dd_Smed_v4_1757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016897SMESG000023253.1 dd_Smed_v4_1757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30016897SMESG000023253.1 dd_Smed_v4_1757_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016897SMESG000023253.1 Contig48317newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016897SMESG000023253.1 Contig48317uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
intestinal phagocyteSMED30016897SMESG000023253.1 dd_Smed_v6_1757_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30016897 vs. Ensembl Zebrafish
Match: pjvk (pejvakin [Source:ZFIN;Acc:ZDB-GENE-110411-133])

HSP 1 Score: 48.521 bits (114), Expect = 7.699e-6
Identity = 44/183 (24.04%), Postives = 84/183 (45.90%), Query Frame = -2
Query:  535 MLKLAASHYLKSVGDK-YFHPNPDYAEWDNVDCLDVAIKRRPRWFWQKNTYIYDHFGINDLLDTPFSIDKSLYLKKPEPLNPGFSYSNKHDIK--GKFGAHIXXXXXXXXXXXDKITVSMEIDGIMKQSIDFXXXXXXXXXXXXXXXXKYLQRLAKSSHNVICLVTQYIYITKPATIKISLNV 1074
            M   A  +++K VGD     P P  +E D    L +  +++ R FW+K  Y    F + D+L     I     +   + LN    Y +K D+   G+ G H+   + +++S  D + V      + K  ++   +  EL  +KV+L +  +++  +S   V+C+V + I  T+  ++ +   V
Sbjct:    1 MFAAATKNFVKQVGDTGRLVPVPSLSEADRYQPLSLVTRKKKRHFWKKTKYATTPFSLKDILVGEKEITAG--VSSYQLLN----YEDKSDVALNGRLGNHLIHEVGVNVSGSDSVAVKASFGIVTKHEVEVPTLLRELNARKVDLDHCLIRQSKESGRTVLCVVMESIRTTRQCSLTVHAGV 177          
BLAST of SMED30016897 vs. Ensembl Zebrafish
Match: pjvk (pejvakin [Source:ZFIN;Acc:ZDB-GENE-110411-133])

HSP 1 Score: 48.521 bits (114), Expect = 8.024e-6
Identity = 44/183 (24.04%), Postives = 84/183 (45.90%), Query Frame = -2
Query:  535 MLKLAASHYLKSVGDK-YFHPNPDYAEWDNVDCLDVAIKRRPRWFWQKNTYIYDHFGINDLLDTPFSIDKSLYLKKPEPLNPGFSYSNKHDIK--GKFGAHIXXXXXXXXXXXDKITVSMEIDGIMKQSIDFXXXXXXXXXXXXXXXXKYLQRLAKSSHNVICLVTQYIYITKPATIKISLNV 1074
            M   A  +++K VGD     P P  +E D    L +  +++ R FW+K  Y    F + D+L     I     +   + LN    Y +K D+   G+ G H+   + +++S  D + V      + K  ++   +  EL  +KV+L +  +++  +S   V+C+V + I  T+  ++ +   V
Sbjct:    1 MFAAATKNFVKQVGDTGRLVPVPSLSEADRYQPLSLVTRKKKRHFWKKTKYATTPFSLKDILVGEKEITAG--VSSYQLLN----YEDKSDVALNGRLGNHLIHEVGVNVSGSDSVAVKASFGIVTKHEVEVPTLLRELNARKVDLDHCLIRQSKESGRTVLCVVMESIRTTRQCSLTVHAGV 177          
BLAST of SMED30016897 vs. TrEMBL
Match: C3ZVN8 (Gasdermin domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_96254 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 3.135e-8
Identity = 50/200 (25.00%), Postives = 94/200 (47.00%), Query Frame = -2
Query:  475 MLKLAASHYLKSVGDKYFHPNPDYAEWDNVDCLDVAIKRRPRWFWQKNTYIYDHFGINDLLDTPFSIDKSLYLKKPEPLNPGFSYSNKHDIKGKFGAHIXXXXXXXXXXXDKITVSMEIDGIMKQSIDFXXXXXXXXXXXXXXXXKYLQRLAKSSHNVICLVTQYIYITKPATIKISLNVDCDEKNDDKPNKTLNISDSG 1074
            M + A S ++K+VG     P PD    +    L VA+K+ P+WFWQ   Y+   F I+ +L     ID ++  +     N    +S    +KG  G+ I   + LD+S    +++      + K  +D   + + L K+ V+ ++ ++Q + ++  NV+C+V        P+ +    +V+ ++K       T NI+  G
Sbjct:    6 MFEAAVSGFVKAVGKDSLLPVPDLNSANKCRPLHVAVKKNPKWFWQSAKYLPTSFKIHQILTKTEEIDVNVACRTLVEYNKTSHFS----VKGSVGSKIMKEVDLDVSGSGMVSIKASFGKVNKCDVDVPTLMQALDKRFVDFRHDFVQEVRQNPRNVLCVVVGTACTINPSVLSSEEDVEGNQKATIALGTTANINQEG 201          
BLAST of SMED30016897 vs. TrEMBL
Match: A0A1S3HNR1 (pejvakin-like OS=Lingula unguis OX=7574 GN=LOC106156804 PE=4 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 4.656e-7
Identity = 47/185 (25.41%), Postives = 93/185 (50.27%), Query Frame = -2
Query:  520 MLKLAASHYLKSVGDKYFHPNPDYAEWDNVDCLDVAIKRRPRWFWQKNTYIYDHFGINDLLDTPFSIDKSLYLKKPEPLNPGFSYSNKHDIKGKFGAHIXXXXXXXXXXXDKITVSMEIDGIMKQSIDFXXXXXXXXXXXXXXXXKYLQRLAKSSHNVICLVTQYIYITKPATIKISLNVDCDEK 1074
            M + A + ++KSVG     P P   E +    L V IK++ RWFWQ + Y    F +++LL    + + +L LK        ++ +++   KG  GA +  L  ++LS  D + V  +   + K+ +D   + + L  + + L +++++++ ++   V+C++T     TK  TI   ++ D  +K
Sbjct:    1 MFEAAVTKFVKSVGQGSLLPVPSLDEAEKCRPLAVVIKKKRRWFWQCSKYEPTPFFLHELL----TDETTLGLKSETRDLVTYNRTSRFSAKGSIGAKLKVLFDVELSGSDTVLVEAKFGDVTKEEVDVPTLLDVLSHRNLQLDHEFIKQVQENPRKVLCVITGTAVTTKDCTIHSHIDWDLKDK 181          
BLAST of SMED30016897 vs. TrEMBL
Match: A0A2B4SD93 (Pejvakin OS=Stylophora pistillata OX=50429 GN=DFNB59 PE=4 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 4.204e-6
Identity = 58/212 (27.36%), Postives = 96/212 (45.28%), Query Frame = -2
Query:  478 LLMLKLAASHYLKSVGDKYFHPNPDYAEWDNVDCLDVAIKRRPRWFWQKNTYIYDHFGINDLLDTPF----SIDKSLYLK--KPEPLNPGFSYSNKHDIKGKFGAHIXXXXXXXXXXXDKITVSMEIDGIMKQSIDFXXXXXXXXXXXXXXXXKYLQRLAKSSHNVICLVTQYIYITKPATIKISLNVDCDEKND-----DKPNKTLNISDS 1080
            + + +  +  ++K  G     P  D         L V  K+R RWFW+ +TY    F +N+LL  P      I+KS ++   K EP         K  I GK G  IAS   +D SA D  T+SM++  ++K+ + ++ + + L    +NL ++Y+Q +       +C+    IY T        L  D  E+ D      KP  ++++S S
Sbjct:    1 MALFEACSKQFVKDTGRSTLRPILDLNTSTRSSILCVVTKKRSRWFWKTDTYKSTPFTLNELLTKPVHIKGHIEKSTFISNYKNEP---------KFHISGKLGGKIASEFGIDASAVDSFTISMDVGTVLKREVTWVNLKKALADTTLNLGHEYVQYICTKQRRSLCI----IYETVATQGDTDLASDSREEGDASVSTGKPKFSISLSGS 199          
BLAST of SMED30016897 vs. Ensembl Nematostella
Match: EDO30320 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T146])

HSP 1 Score: 57.3806 bits (137), Expect = 3.378e-9
Identity = 46/185 (24.86%), Postives = 88/185 (47.57%), Query Frame = -2
Query:  526 LLMLKLAASHYLKSVGDKYFHPNPDYAEWDNVDCLDVAIKRRPRWFWQKNTYIYDHFGINDLLDTPFSIDKSLYLKKPEPLNPGFSYSNKHDIKGKFGAHIXXXXXXXXXXXDKITVSMEIDGIMKQSIDFXXXXXXXXXXXXXXXXKYLQRLAKSSHNVICLVTQYIYITKPATIKISLNVDCD 1080
            + + + A+  ++K  G +  H  PD    +    L V  +++ RWFW+   Y+   F +N+LL  P  + +    +K E     +  + +  + GK GA IA  L +D+S  D   V M I  + K  I +  +   LK K++N+ ++++Q +  S    + +V + +  T    ++  L V+ D
Sbjct:    1 MALFESASKQFVKDTGRRSLHAVPDLNSSECCRILCVIERKKSRWFWRSTKYLTTPFVLNELLTEPVDLKEK---QKEEVFITDYQNNPQFHVSGKLGAKIAKDLGIDVSTTDSFVVKMNIGAVNKTEIRWQDMFSALKGKRLNVDHEFVQAIIASKRRSLSVVCEMLATTGDTKMESELQVEGD 182          
BLAST of SMED30016897 vs. Planmine SMEST
Match: SMESG000023253.1 (SMESG000023253.1)

HSP 1 Score: 350.903 bits (899), Expect = 3.116e-118
Identity = 198/200 (99.00%), Postives = 200/200 (100.00%), Query Frame = -2
Query:  475 MLKLAASHYLKSVGDKYFHPNPDYAEWDNVDCLDVAIKRRPRWFWQKNTYIYDHFGINDLLDTPFSIDKSLYLKKPEPLNPGFSYSNKHDIKGKFGAHIXXXXXXXXXXXDKITVSMEIDGIMKQSIDFXXXXXXXXXXXXXXXXKYLQRLAKSSHNVICLVTQYIYITKPATIKISLNVDCDEKNDDKPNKTLNISDSG 1074
            MLKLAASHYLKSVGDKYFHPNPDYAEWDNVDCLDVAIKRRPRWFWQKNTYIYDHFGINDLLDTPFSIDKSLYLKKPEPLNPGFSYSNKHDIKGKFGAHIASLLSLDLSADDKITV+MEIDGIMKQSIDFLVVAEEL+KKKVNLKNKYLQRLAKSSHNVICLVTQYIYITKPATIKISLNVDCDEKNDDKPNKTLNISDSG
Sbjct:    1 MLKLAASHYLKSVGDKYFHPNPDYAEWDNVDCLDVAIKRRPRWFWQKNTYIYDHFGINDLLDTPFSIDKSLYLKKPEPLNPGFSYSNKHDIKGKFGAHIASLLSLDLSADDKITVNMEIDGIMKQSIDFLVVAEELRKKKVNLKNKYLQRLAKSSHNVICLVTQYIYITKPATIKISLNVDCDEKNDDKPNKTLNISDSG 200          

HSP 2 Score: 174.096 bits (440), Expect = 7.678e-50
Identity = 86/86 (100.00%), Postives = 86/86 (100.00%), Query Frame = -1
Query:    2 GDIGELSKCLANMGNNNKLGITRDLLVLAQENKADIKKLESFFMDCLQDLKTKQTEIALSTYELKQIDHPNLLNLFKQVGLDKKNF 259
            GDIGELSKCLANMGNNNKLGITRDLLVLAQENKADIKKLESFFMDCLQDLKTKQTEIALSTYELKQIDHPNLLNLFKQVGLDKKNF
Sbjct:  271 GDIGELSKCLANMGNNNKLGITRDLLVLAQENKADIKKLESFFMDCLQDLKTKQTEIALSTYELKQIDHPNLLNLFKQVGLDKKNF 356          
BLAST of SMED30016897 vs. Planmine SMEST
Match: SMESG000062818.1 (SMESG000062818.1)

HSP 1 Score: 124.79 bits (312), Expect = 3.193e-35
Identity = 55/91 (60.44%), Postives = 71/91 (78.02%), Query Frame = -2
Query:  802 MLKLAASHYLKSVGDKYFHPNPDYAEWDNVDCLDVAIKRRPRWFWQKNTYIYDHFGINDLLDTPFSIDKSLYLKKPEPLNPGFSYSNKHDI 1074
            MLKLAA  YL+S+GD YF PNPD+AEW NV+CLD+ IKR+P++ W K +Y YDH  I+DLLD+  S D SLY+K PEPL   F++S+KH+I
Sbjct:    1 MLKLAAKQYLQSLGDNYFLPNPDFAEWVNVNCLDIVIKRKPKYKWHKASYSYDHLSIDDLLDSSISTDSSLYIKNPEPLTSNFAWSSKHNI 91          
The following BLAST results are available for this feature:
BLAST of SMED30016897 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016897 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016897 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016897 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pjvk7.699e-624.04pejvakin [Source:ZFIN;Acc:ZDB-GENE-110411-133][more]
pjvk8.024e-624.04pejvakin [Source:ZFIN;Acc:ZDB-GENE-110411-133][more]
back to top
BLAST of SMED30016897 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016897 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016897 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016897 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 3
Match NameE-valueIdentityDescription
C3ZVN83.135e-825.00Gasdermin domain-containing protein OS=Branchiosto... [more]
A0A1S3HNR14.656e-725.41pejvakin-like OS=Lingula unguis OX=7574 GN=LOC1061... [more]
A0A2B4SD934.204e-627.36Pejvakin OS=Stylophora pistillata OX=50429 GN=DFNB... [more]
back to top
BLAST of SMED30016897 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016897 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016897 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016897 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO303203.378e-924.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30016897 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016897 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000023253.13.116e-11899.00SMESG000023253.1[more]
SMESG000062818.13.193e-3560.44SMESG000062818.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016897 ID=SMED30016897|Name=SMED30016897|organism=Schmidtea mediterranea sexual|type=transcript|length=1105bp
TAAAATTTTTTTTATCAAGTCCGACTTGTTTAAACAAATTCAAAAGATTT
GGGTGATCAATTTGTTTTAATTCATATGTAGATAAAGCGATTTCAGTTTG
TTTGGTTTTTAAATCTTGCAAACAATCCATGAAAAATGATTCCAATTTCT
TTATATCTGCTTTATTTTCTTGGGCTAAAACTAAAAGGTCTCTAGTAATT
CCCAATTTATTATTGTTTCCCATGTTTGCCAAACATTTTGATAATTCTCC
TATATCACCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNTACCAGAATCGGAAATGTTCAATGTTT
TATTAGGTTTGTCATCGTTTTTCTCATCGCAATCAACGTTGAGAGATATT
TTAATTGTAGCTGGCTTGGTAATGTAAATGTATTGCGTTACCAGACAGAT
TACATTATGAGAGCTTTTTGCCAGTCTCTGTAGATATTTATTCTTCAGGT
TGACTTTTTTTTTCTTTAATTCTTCGGCGACAACTAAGAAATCAATTGAT
TGTTTCATGATTCCATCTATTTCCATGCTTACTGTAATTTTATCATCGGC
GGATAAATCTAGCGATAATAATGATGCAATATGAGCTCCGAATTTCCCTT
TAATATCATGTTTGTTGGAGTAGGAAAAACCGGGATTCAATGGTTCTGGT
TTTTTCAAATAAAGTGATTTATCTATCGAGAATGGAGTATCTAGTAAATC
ATTTATTCCAAAATGATCATAAATATAAGTATTCTTTTGCCAAAACCATC
TTGGTCGCCTTTTAATAGCAACATCTAAGCAATCGACATTGTCCCATTCA
GCATAATCGGGATTTGGATGAAAATATTTATCCCCAACAGACTTCAGATA
ATGCGAAGCAGCTAATTTAAGCATTAATAAGGATGCAAAATTTGTTTTCT
GGACG
back to top

protein sequence of SMED30016897-orf-1

>SMED30016897-orf-1 ID=SMED30016897-orf-1|Name=SMED30016897-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=285bp
VQKTNFASLLMLKLAASHYLKSVGDKYFHPNPDYAEWDNVDCLDVAIKRR
PRWFWQKNTYIYDHFGINDLLDTPFSIDKSLYLKKPEPLNPGFSYSNKHD
IKGKFGAHIASLLSLDLSADDKITVSMEIDGIMKQSIDFLVVAEELKKKK
VNLKNKYLQRLAKSSHNVICLVTQYIYITKPATIKISLNVDCDEKNDDKP
NKTLNISDSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR040460Gasdermin_pore
IPR042377GSDME
IPR001641Spumavirus_A9
Vocabulary: biological process
TermDefinition
GO:0008219cell death
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0004190aspartic-type endopeptidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR040460Gasdermin, pore forming domainPFAMPF04598Gasdermincoord: 35..186
e-value: 1.3E-7
score: 31.3
IPR042377Gasdermin-EPANTHERPTHR15207NONSYNDROMIC HEARING IMPAIRMENT PROTEINcoord: 8..188