Phytanoyl-CoA dioxygenase family protein

Overview
NamePhytanoyl-CoA dioxygenase family protein
Smed IDSMED30016885
Length (bp)2421
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phytanoyl-CoA dioxygenase family protein (SMED30016885) t-SNE clustered cells

Violin plots show distribution of expression levels for Phytanoyl-CoA dioxygenase family protein (SMED30016885) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phytanoyl-CoA dioxygenase family protein (SMED30016885) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phytanoyl-CoA dioxygenase family protein (SMED30016885) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016885

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30016885SMESG000077696.1 SMESG000077694.1 dd_Smed_v4_1292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30016885SMESG000077696.1 SMESG000077694.1 dd_Smed_v4_1292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016885SMESG000077696.1 SMESG000077694.1 dd_Smed_v4_1292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30016885SMESG000077696.1 SMESG000077694.1 dd_Smed_v4_1292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30016885SMESG000077696.1 SMESG000077694.1 dd_Smed_v4_1292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016885SMESG000077696.1 SMESG000077694.1 dd_Smed_v4_1292_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Human
Match: PHYHD1 (phytanoyl-CoA dioxygenase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:23396])

HSP 1 Score: 52.7582 bits (125), Expect = 1.234e-6
Identity = 31/103 (30.10%), Postives = 48/103 (46.60%), Query Frame = 3
Query: 1866 HSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGS-----NKEPLRPHRKYHPDKHIRTCDA--DESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRR 2153
            H D S+    P  R +  W+A++   +ENGC+WF+PGS     ++  +R      P       +   D S   P P+Q G +    G  +H S+ N  +DR R
Sbjct:  156 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSGVSRRMVRAPVGSAPGTSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQN-LSDRSR 257          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Human
Match: PHYHD1 (phytanoyl-CoA dioxygenase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:23396])

HSP 1 Score: 52.373 bits (124), Expect = 1.509e-6
Identity = 31/103 (30.10%), Postives = 48/103 (46.60%), Query Frame = 3
Query: 1866 HSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGS-----NKEPLRPHRKYHPDKHIRTCDA--DESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRR 2153
            H D S+    P  R +  W+A++   +ENGC+WF+PGS     ++  +R      P       +   D S   P P+Q G +    G  +H S+ N  +DR R
Sbjct:  135 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSGVSRRMVRAPVGSAPGTSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQN-LSDRSR 236          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Human
Match: PHYHD1 (phytanoyl-CoA dioxygenase domain containing 1 [Source:HGNC Symbol;Acc:HGNC:23396])

HSP 1 Score: 52.373 bits (124), Expect = 1.509e-6
Identity = 31/103 (30.10%), Postives = 48/103 (46.60%), Query Frame = 3
Query: 1866 HSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGS-----NKEPLRPHRKYHPDKHIRTCDA--DESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRR 2153
            H D S+    P  R +  W+A++   +ENGC+WF+PGS     ++  +R      P       +   D S   P P+Q G +    G  +H S+ N  +DR R
Sbjct:  135 HQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSGVSRRMVRAPVGSAPGTSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQN-LSDRSR 236          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Celegans
Match: Y105C5B.9 (Phytanoyl-CoA dioxygenase domain-containing protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q9NAM7])

HSP 1 Score: 51.2174 bits (121), Expect = 1.430e-6
Identity = 30/128 (23.44%), Postives = 54/128 (42.19%), Query Frame = 3
Query: 1866 HSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDA---------------DESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKAMVELERQ 2204
            H D ++    P       W+A+D   VENGC+ F+PGS+K+    + ++     +RT D                D+S+   VP+  G +    G  +H S  N++   R  + ++   +   +   Q
Sbjct:  149 HVDSTFLRVDPIDHLTGVWIAIDEASVENGCLSFIPGSHKDTSSANYRF-----VRTHDTSGGALLKFIGTRPTYDQSKFQHVPISKGSLILIHGLVVHKSEANTSEKSRHAYTIHVMERKNTKWSEQ 271          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Zebrafish
Match: zgc:174917 (zgc:174917 [Source:ZFIN;Acc:ZDB-GENE-070928-42])

HSP 1 Score: 60.4622 bits (145), Expect = 2.132e-9
Identity = 35/112 (31.25%), Postives = 57/112 (50.89%), Query Frame = 3
Query: 1863 WHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDAD------ESEGTPV-PLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRP 2177
            WH D  YW        +S W+ALD +  +NG +  +PGS+   L PH +     ++ + + +      E+E   + PL  G+M+ H G  +H S  N++  RR G+V+ Y P
Sbjct:  133 WHQDMKYW-GFEGGPVLSVWLALDDSLEDNGALQVIPGSHHYGLLPHHQSKRAGNMLSVNQEIPEELVETEKALLCPLLAGQMSVHDGLLVHASDPNTSNRRRCGYVIRYVP 243          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Zebrafish
Match: zgc:174917 (zgc:174917 [Source:ZFIN;Acc:ZDB-GENE-070928-42])

HSP 1 Score: 60.4622 bits (145), Expect = 2.132e-9
Identity = 35/112 (31.25%), Postives = 57/112 (50.89%), Query Frame = 3
Query: 1863 WHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDAD------ESEGTPV-PLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRP 2177
            WH D  YW        +S W+ALD +  +NG +  +PGS+   L PH +     ++ + + +      E+E   + PL  G+M+ H G  +H S  N++  RR G+V+ Y P
Sbjct:  133 WHQDMKYW-GFEGGPVLSVWLALDDSLEDNGALQVIPGSHHYGLLPHHQSKRAGNMLSVNQEIPEELVETEKALLCPLLAGQMSVHDGLLVHASDPNTSNRRRCGYVIRYVP 243          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Zebrafish
Match: zgc:174917 (zgc:174917 [Source:ZFIN;Acc:ZDB-GENE-070928-42])

HSP 1 Score: 60.4622 bits (145), Expect = 2.132e-9
Identity = 35/112 (31.25%), Postives = 57/112 (50.89%), Query Frame = 3
Query: 1863 WHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDAD------ESEGTPV-PLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRP 2177
            WH D  YW        +S W+ALD +  +NG +  +PGS+   L PH +     ++ + + +      E+E   + PL  G+M+ H G  +H S  N++  RR G+V+ Y P
Sbjct:  133 WHQDMKYW-GFEGGPVLSVWLALDDSLEDNGALQVIPGSHHYGLLPHHQSKRAGNMLSVNQEIPEELVETEKALLCPLLAGQMSVHDGLLVHASDPNTSNRRRCGYVIRYVP 243          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Zebrafish
Match: zgc:174917 (zgc:174917 [Source:ZFIN;Acc:ZDB-GENE-070928-42])

HSP 1 Score: 60.4622 bits (145), Expect = 2.132e-9
Identity = 35/112 (31.25%), Postives = 57/112 (50.89%), Query Frame = 3
Query: 1863 WHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDAD------ESEGTPV-PLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRP 2177
            WH D  YW        +S W+ALD +  +NG +  +PGS+   L PH +     ++ + + +      E+E   + PL  G+M+ H G  +H S  N++  RR G+V+ Y P
Sbjct:  133 WHQDMKYW-GFEGGPVLSVWLALDDSLEDNGALQVIPGSHHYGLLPHHQSKRAGNMLSVNQEIPEELVETEKALLCPLLAGQMSVHDGLLVHASDPNTSNRRRCGYVIRYVP 243          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Zebrafish
Match: phyhd1 (phytanoyl-CoA dioxygenase domain containing 1 [Source:NCBI gene;Acc:492804])

HSP 1 Score: 52.7582 bits (125), Expect = 5.415e-7
Identity = 29/102 (28.43%), Postives = 44/102 (43.14%), Query Frame = 3
Query: 1866 HSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHI-------RTCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRR 2150
            H D ++    P  R +  WVAL+    ENGC+WF+PGS+ + +       P           R  D D+    P P++ G      G  +H S  N++   R
Sbjct:  121 HQDATFLYTQPLGRVMGVWVALEDAMQENGCLWFIPGSHNDGITRRMVRTPKGTFPLTDFIGREKDYDDKLFVPAPVKKGGAVLIHGEVVHRSAANTSDASR 222          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Xenopus
Match: tmem163 (transmembrane protein 163 [Source:Xenbase;Acc:XB-GENE-5808413])

HSP 1 Score: 71.2478 bits (173), Expect = 5.234e-13
Identity = 44/145 (30.34%), Postives = 66/145 (45.52%), Query Frame = 3
Query: 1788 LFGDDMIEDFNFLICKEPFKDIP--------TFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDAD-------ESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRP 2177
            + G ++I   +  ICK P  D+P          WH D  YW         S W+A D    ENG +  +PGS+K+ +  HR      ++ T + +         +    PL+ G+M+ H G T+H S  N +  RR GFV+ Y P
Sbjct:   78 VLGPNVILLDSRFICKYPSSDVPHKDNTVPYVAWHQDIKYW-GFEGGPVASVWLAFDDVDAENGVLQVIPGSHKQGILEHRVAEIPGNLLTANQEIPRHLVQVEDLVECPLKAGQMSIHDGLTVHASEPNMSERRRCGFVIRYVP 221          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Xenopus
Match: tmem163 (transmembrane protein 163 [Source:Xenbase;Acc:XB-GENE-5808413])

HSP 1 Score: 71.2478 bits (173), Expect = 5.483e-13
Identity = 44/145 (30.34%), Postives = 66/145 (45.52%), Query Frame = 3
Query: 1788 LFGDDMIEDFNFLICKEPFKDIP--------TFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDAD-------ESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRP 2177
            + G ++I   +  ICK P  D+P          WH D  YW         S W+A D    ENG +  +PGS+K+ +  HR      ++ T + +         +    PL+ G+M+ H G T+H S  N +  RR GFV+ Y P
Sbjct:   78 VLGPNVILLDSRFICKYPSSDVPHKDNTVPYVAWHQDIKYW-GFEGGPVASVWLAFDDVDAENGVLQVIPGSHKQGILEHRVAEIPGNLLTANQEIPRHLVQVEDLVECPLKAGQMSIHDGLTVHASEPNMSERRRCGFVIRYVP 221          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Xenopus
Match: tmem163 (transmembrane protein 163 [Source:Xenbase;Acc:XB-GENE-5808413])

HSP 1 Score: 71.2478 bits (173), Expect = 6.669e-13
Identity = 44/145 (30.34%), Postives = 66/145 (45.52%), Query Frame = 3
Query: 1788 LFGDDMIEDFNFLICKEPFKDIP--------TFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDAD-------ESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRP 2177
            + G ++I   +  ICK P  D+P          WH D  YW         S W+A D    ENG +  +PGS+K+ +  HR      ++ T + +         +    PL+ G+M+ H G T+H S  N +  RR GFV+ Y P
Sbjct:   78 VLGPNVILLDSRFICKYPSSDVPHKDNTVPYVAWHQDIKYW-GFEGGPVASVWLAFDDVDAENGVLQVIPGSHKQGILEHRVAEIPGNLLTSNQEIPRHLVQVEDLVECPLKAGQMSVHDGLTVHASEPNMSNRRRCGFVIRYVP 221          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Xenopus
Match: tmem163 (transmembrane protein 163 [Source:Xenbase;Acc:XB-GENE-5808413])

HSP 1 Score: 71.2478 bits (173), Expect = 6.669e-13
Identity = 44/145 (30.34%), Postives = 66/145 (45.52%), Query Frame = 3
Query: 1788 LFGDDMIEDFNFLICKEPFKDIP--------TFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDAD-------ESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRP 2177
            + G ++I   +  ICK P  D+P          WH D  YW         S W+A D    ENG +  +PGS+K+ +  HR      ++ T + +         +    PL+ G+M+ H G T+H S  N +  RR GFV+ Y P
Sbjct:   78 VLGPNVILLDSRFICKYPSSDVPHKDNTVPYVAWHQDIKYW-GFEGGPVASVWLAFDDVDAENGVLQVIPGSHKQGILEHRVAEIPGNLLTSNQEIPRHLVQVEDLVECPLKAGQMSVHDGLTVHASEPNMSNRRRCGFVIRYVP 221          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Xenopus
Match: tmem163 (transmembrane protein 163 [Source:Xenbase;Acc:XB-GENE-5808413])

HSP 1 Score: 71.2478 bits (173), Expect = 6.795e-13
Identity = 44/145 (30.34%), Postives = 66/145 (45.52%), Query Frame = 3
Query: 1788 LFGDDMIEDFNFLICKEPFKDIP--------TFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDAD-------ESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRP 2177
            + G ++I   +  ICK P  D+P          WH D  YW         S W+A D    ENG +  +PGS+K+ +  HR      ++ T + +         +    PL+ G+M+ H G T+H S  N +  RR GFV+ Y P
Sbjct:   78 VLGPNVILLDSRFICKYPSSDVPHKDNTAPYVAWHQDIKYW-GFEGGPVASVWLAFDDVDAENGVLQVIPGSHKQGILEHRVAEIPGNLLTSNQEIPRHLVQVEDLVECPLKAGQMSVHDGLTVHASEPNMSNRRRCGFVIRYVP 221          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Mouse
Match: Phyhd1 (phytanoyl-CoA dioxygenase domain containing 1 [Source:MGI Symbol;Acc:MGI:3612860])

HSP 1 Score: 53.1434 bits (126), Expect = 2.688e-7
Identity = 44/178 (24.72%), Postives = 70/178 (39.33%), Query Frame = 3
Query: 1752 PIHARTEFLAK-------------YLFGDDMIEDF----------NFLICKEPFKDIPTFWH----SDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGS-----NKEPLRPHRKYHPDKHIRTCDADESEG--TPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKA 2183
            P+H RTEF  +             +L   D I  F          NFL+   P K I    H     D ++    P  R +  W+A++   +ENGC+WF+PGS     ++  +R      P       D   +     P+P++ G +    G  +H S  N +   R+ + V+    A
Sbjct:   46 PLHCRTEFSTQEDEQLQTQGKTDYFLSSGDKIRFFFEKGVFDEKGNFLV--PPEKSINKIGHVSPHQDATFLYTEPLGRVLGLWIAMEDAMLENGCLWFIPGSHTRGVSRRMIRAPSDSGPGTSFLGSDPAWASNLFVPLPVRRGGLVLIHGEVVHKSEQNHSDHSRQAYTVHLMEAA 221          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Mouse
Match: Phyhd1 (phytanoyl-CoA dioxygenase domain containing 1 [Source:MGI Symbol;Acc:MGI:3612860])

HSP 1 Score: 51.9878 bits (123), Expect = 1.560e-6
Identity = 28/113 (24.78%), Postives = 50/113 (44.25%), Query Frame = 3
Query: 1866 HSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGS-----NKEPLRPHRKYHPDKHIRTCDADESEG--TPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKA 2183
            H D ++    P  R +  W+A++   +ENGC+WF+PGS     ++  +R      P       D   +     P+P++ G +    G  +H S  N +   R+ + V+    A
Sbjct:  156 HQDATFLYTEPLGRVLGLWIAMEDAMLENGCLWFIPGSHTRGVSRRMIRAPSDSGPGTSFLGSDPAWASNLFVPLPVRRGGLVLIHGEVVHKSEQNHSDHSRQAYTVHLMEAA 268          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Mouse
Match: Phyhd1 (phytanoyl-CoA dioxygenase domain containing 1 [Source:MGI Symbol;Acc:MGI:3612860])

HSP 1 Score: 51.9878 bits (123), Expect = 1.560e-6
Identity = 28/113 (24.78%), Postives = 50/113 (44.25%), Query Frame = 3
Query: 1866 HSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGS-----NKEPLRPHRKYHPDKHIRTCDADESEG--TPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKA 2183
            H D ++    P  R +  W+A++   +ENGC+WF+PGS     ++  +R      P       D   +     P+P++ G +    G  +H S  N +   R+ + V+    A
Sbjct:  156 HQDATFLYTEPLGRVLGLWIAMEDAMLENGCLWFIPGSHTRGVSRRMIRAPSDSGPGTSFLGSDPAWASNLFVPLPVRRGGLVLIHGEVVHKSEQNHSDHSRQAYTVHLMEAA 268          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Mouse
Match: Phyhd1 (phytanoyl-CoA dioxygenase domain containing 1 [Source:MGI Symbol;Acc:MGI:3612860])

HSP 1 Score: 51.6026 bits (122), Expect = 1.880e-6
Identity = 28/113 (24.78%), Postives = 50/113 (44.25%), Query Frame = 3
Query: 1866 HSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGS-----NKEPLRPHRKYHPDKHIRTCDADESEG--TPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKA 2183
            H D ++    P  R +  W+A++   +ENGC+WF+PGS     ++  +R      P       D   +     P+P++ G +    G  +H S  N +   R+ + V+    A
Sbjct:  176 HQDATFLYTEPLGRVLGLWIAMEDAMLENGCLWFIPGSHTRGVSRRMIRAPSDSGPGTSFLGSDPAWASNLFVPLPVRRGGLVLIHGEVVHKSEQNHSDHSRQAYTVHLMEAA 288          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Mouse
Match: Phyhd1 (phytanoyl-CoA dioxygenase domain containing 1 [Source:MGI Symbol;Acc:MGI:3612860])

HSP 1 Score: 51.2174 bits (121), Expect = 1.884e-6
Identity = 28/113 (24.78%), Postives = 50/113 (44.25%), Query Frame = 3
Query: 1866 HSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGS-----NKEPLRPHRKYHPDKHIRTCDADESEG--TPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKA 2183
            H D ++    P  R +  W+A++   +ENGC+WF+PGS     ++  +R      P       D   +     P+P++ G +    G  +H S  N +   R+ + V+    A
Sbjct:  135 HQDATFLYTEPLGRVLGLWIAMEDAMLENGCLWFIPGSHTRGVSRRMIRAPSDSGPGTSFLGSDPAWASNLFVPLPVRRGGLVLIHGEVVHKSEQNHSDHSRQAYTVHLMEAA 247          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. UniProt/SwissProt
Match: sp|Q5U3U0|PHYD1_DANRE (Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Danio rerio OX=7955 GN=phyhd1 PE=2 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 5.131e-6
Identity = 29/102 (28.43%), Postives = 44/102 (43.14%), Query Frame = 3
Query: 1866 HSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHI-------RTCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRR 2150
            H D ++    P  R +  WVAL+    ENGC+WF+PGS+ + +       P           R  D D+    P P++ G      G  +H S  N++   R
Sbjct:  156 HQDATFLYTQPLGRVMGVWVALEDAMQENGCLWFIPGSHNDGITRRMVRTPKGTFPLTDFIGREKDYDDKLFVPAPVKKGGAVLIHGEVVHRSAANTSDASR 257          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. TrEMBL
Match: A0A1S3JNQ5 (phytanoyl-CoA dioxygenase domain-containing protein 1 homolog OS=Lingula unguis OX=7574 GN=LOC106174551 PE=4 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 3.085e-54
Identity = 95/170 (55.88%), Postives = 114/170 (67.06%), Query Frame = 3
Query: 1740 IIQGPIHARTEFLAKYLFGDDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIR-TCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKAMVELERQKEFDHGKSGLSNIL 2246
            + QGP+H RT+ +A  + G+D   DF+ LI K P  +  T WH DESYW D+PDKRAVSFW A+D   VENGCMWFV GS+K PLR HR      HIR T D  E+EG P P+  G  TGH GRTLHY+RGNST   RR F+VNYRPK MV  ER+  FDHGK  + + +
Sbjct:   95 LAQGPLHQRTKAIANVIIGEDAEFDFDMLIAKSPHTETGTPWHQDESYWPDMPDKRAVSFWCAMDDATVENGCMWFVSGSHKRPLRTHRPVKVGHHIRMTDDCSEAEGQPQPIPAGSCTGHHGRTLHYTRGNSTDRWRRAFIVNYRPKDMVAWEREHNFDHGKESMESAI 264          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. TrEMBL
Match: A0A267F1N1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011863g1 PE=4 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 6.208e-53
Identity = 84/151 (55.63%), Postives = 112/151 (74.17%), Query Frame = 3
Query: 1794 GDDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKAMVELERQKEFDHGKSGLSNIL 2246
            G DM  DF+ ++ K P  + PT WH+D +YWLD+PDKRAVS W+A+D T+++NGCMWF PGS++ PL PHR      H+ TCD  E++G P  LQPG+ T HSG+TLHYSRGN++   RRG+V+N+RP AMVE ERQ+ +DHG++GL  I 
Sbjct:   29 GPDMDFDFDMMLAKPPQSNTPTPWHADAAYWLDMPDKRAVSCWLAVDATWLDNGCMWFGPGSHRRPLLPHRSAAAGTHVLTCDGSEADGVPCELQPGDCTLHSGQTLHYSRGNTSDCWRRGYVMNFRPLAMVEFERQRNYDHGQAGLGKIF 179          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. TrEMBL
Match: A0A172U2D1 (Uncharacterized protein OS=Flavisolibacter tropicus OX=1492898 GN=SY85_14135 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 8.490e-53
Identity = 89/172 (51.74%), Postives = 114/172 (66.28%), Query Frame = 3
Query: 1740 IIQGPIHARTEFLAKYLFGDDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKAMVELERQKEFDHGKSGLSNILLKH 2255
            ++  P H R   ++K L G D+  DF+ LI K P  +  T WH DE+YW+++PDKRA S W+ALD   VENGCMWFVPGSN+  +RPHR    +    TCDA E EG  V L+ G  T H GRTLHYSRGN+T+  RR F+VN+RP  M++LER+  FDHGKS  S   L++
Sbjct:   10 LVNMPFHQRALAISKELMGADLAMDFDMLINKAPVTNTITPWHQDEAYWVNVPDKRATSCWLALDDATVENGCMWFVPGSNQNAVRPHRFAAGNGGALTCDASEEEGLAVELKAGSCTFHHGRTLHYSRGNATSGHRRAFIVNFRPAEMIQLERELGFDHGKSDASKRELRN 181          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. TrEMBL
Match: A0A3B9AI63 (Phytanoyl-CoA dioxygenase family protein OS=Saprospirales bacterium OX=2026790 GN=DCF33_03535 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 1.579e-52
Identity = 87/164 (53.05%), Postives = 112/164 (68.29%), Query Frame = 3
Query: 1740 IIQGPIHARTEFLAKYLFGDDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKAMVELERQKEFDHGKSG 2231
            ++  P H +   +A+ L G+D+  DF+ LI K PF + PT WH D +YW+D+PDKRA S W+ALD   V+NGCMW+VP S+ +P+RPH          TCDA E+EG  V L  G    H G TLHYSRGNST  +RR F+VN+RP+AM+ELERQK FDHG+SG
Sbjct:   78 VLSMPYHQKALTIARLLMGEDIAMDFDMLINKAPFTNTPTPWHQDAAYWIDMPDKRAASCWLALDEATVDNGCMWYVPASHLKPVRPHHFAGKQGGALTCDAYEAEGVAVELPAGSCVFHHGGTLHYSRGNSTGSQRRAFIVNFRPQAMIELERQKGFDHGRSG 241          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. TrEMBL
Match: A0A1I8IXG9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 2.528e-52
Identity = 84/151 (55.63%), Postives = 112/151 (74.17%), Query Frame = 3
Query: 1794 GDDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKAMVELERQKEFDHGKSGLSNIL 2246
            G DM  DF+ ++ K P  + PT WH+D +YWLD+PDKRAVS W+A+D T+++NGCMWF PGS++ PL PHR      H+ TCD  E++G P  LQPG+ T HSG+TLHYSRGN++   RRG+V+N+RP AMVE ERQ+ +DHG++GL  I 
Sbjct:  116 GPDMDFDFDMMLAKPPQSNTPTPWHADAAYWLDMPDKRAVSCWLAVDATWLDNGCMWFGPGSHRRPLLPHRSAAAGTHVLTCDGSEADGVPCELQPGDCTLHSGQTLHYSRGNTSDCWRRGYVMNFRPLAMVEFERQRNYDHGQAGLGKIF 266          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Cavefish
Match: zgc:174917 (zgc:174917 [Source:ZFIN;Acc:ZDB-GENE-070928-42])

HSP 1 Score: 70.4774 bits (171), Expect = 6.269e-13
Identity = 44/143 (30.77%), Postives = 69/143 (48.25%), Query Frame = 3
Query: 1788 LFGDDMIEDFNFLICKEPFKD-----IP-TFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCD-------ADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRP 2177
            + G D++   +  ICK P  D     +P   WH D  YW  L     VS W+ALD +  +NG +  +PG++   L PHR+     ++ + +        ++      PL  G+M+ H G  +H S  N++  RR GFV+ Y P
Sbjct:   78 VLGPDVLMLDSRFICKYPETDESDPGLPYVAWHQDMKYW-GLDGGPVVSVWLALDDSLEDNGALQVIPGTHCSGLLPHRQAKRSGNMLSVNQEIPEELVEKENALLCPLLAGQMSIHDGLLVHASDPNTSQRRRCGFVIRYVP 219          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Sea Lamprey
Match: phyhd1 (phytanoyl-CoA dioxygenase domain containing 1 [Source:NCBI gene;Acc:492804])

HSP 1 Score: 53.9138 bits (128), Expect = 1.771e-8
Identity = 34/122 (27.87%), Postives = 52/122 (42.62%), Query Frame = 3
Query: 1818 NFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDADESEG-------TPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFV 2162
            +  I K+P        H D S+    P  R + FWVAL+   ++NGC+WF+PGS++E +       PD        + SE          VP++ G      G  +H S  N +   R  + 
Sbjct:   35 SMYIFKQPGIGGEVTPHQDASFLHTEPLGRVLGFWVALEDADLDNGCLWFLPGSHREGVSRRLVRRPDGEFPRTGFEGSEPPYPDEGFVAVPVKQGNQVLIHGEVVHRSSANRSPRSRHAYT 156          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Nematostella
Match: EDO48247 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJD8])

HSP 1 Score: 63.1586 bits (152), Expect = 2.305e-11
Identity = 35/106 (33.02%), Postives = 49/106 (46.23%), Query Frame = 3
Query: 1737 NIIQGPIHARTEFLAKYLFGDDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDADES 2054
            ++++GP+  R + + K + G D   DFN LI K                             VALD++ V+NGCMWFVPGS+K PLR H       H+  C+  E 
Sbjct:  103 SLMEGPLSERVQAINKIIIGPDAAFDFNMLISK-----------------------------VALDQSTVDNGCMWFVPGSHKLPLRKHWPASKGAHVLQCECTEG 179          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Nematostella
Match: EDO42949 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S038])

HSP 1 Score: 51.9878 bits (123), Expect = 4.048e-7
Identity = 33/106 (31.13%), Postives = 50/106 (47.17%), Query Frame = 3
Query: 1866 HSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNK------EPLR-PHRKYHPDKHIRTCDA-DESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGF 2159
            H D +Y    P   A+ FW+ L+    ENGC+WF+PGS+K        +R P  K H   HI   +  +E++  P   + G +    G  LH S  N ++  R  +
Sbjct:  152 HRDSTYLYTEP-ISAIGFWIPLEDCTTENGCLWFIPGSHKVDKIERRLIRTPGSKEHVVLHIGPQEEYNEAQSVPALTKKGSLVVIHGSVLHRSFPNKSSKSRHAY 256          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Nematostella
Match: EDO28287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6W8])

HSP 1 Score: 49.6766 bits (117), Expect = 1.108e-6
Identity = 39/141 (27.66%), Postives = 64/141 (45.39%), Query Frame = 3
Query: 1764 RTEFLAKYLFG-DDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNK-EPL--RPHRKYHPDKHIRTC-----DADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGF 2159
            + + +AKY+ G  + I   +  I K+P        H D +Y    P    V FW+ L+    ENGC+WF+PGS+K E +  R  R    +  + +      + D+S+  P+    G +    G  LH S  N ++  R  +
Sbjct:   52 KVQEIAKYVAGLKNPIVPQSMYIFKQPGIGDEVAPHRDSTYLYTEPPT-VVGFWIPLEDCTTENGCLWFIPGSHKVEKIERRMVRSLESEGRLVSHIGPDEEYDDSKSVPLCTNKGALVIIHGSVLHRSFPNKSSKSRHAY 191          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Nematostella
Match: EDO42948 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S036])

HSP 1 Score: 46.9802 bits (110), Expect = 7.662e-6
Identity = 38/141 (26.95%), Postives = 63/141 (44.68%), Query Frame = 3
Query: 1764 RTEFLAKYLFG-DDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNK-EPL--RPHRKYHPDKHIRTC-----DADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGF 2159
            + + +AK + G  + I   +  I K+P        H D +Y    P    V FW+ L+    ENGC+WF+PGS+K E +  R  R    +  + +      + D+S+  P+    G +    G  LH S  N ++  R  +
Sbjct:   17 KVQEIAKSVAGLKNPIVPQSMYIFKQPGIGDEVAPHRDSTYLYTEPPT-VVGFWIPLEDCTTENGCLWFIPGSHKVEKIERRMVRSLESEGRLVSHIGPDEEYDDSKSVPLCTNKGALVIIHGSVLHRSFPNKSSKSRHAY 156          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Medaka
Match: zgc:174917 (probable alpha-ketoglutarate-dependent hypophosphite dioxygenase [Source:NCBI gene;Acc:101169464])

HSP 1 Score: 66.2402 bits (160), Expect = 1.692e-11
Identity = 45/168 (26.79%), Postives = 69/168 (41.07%), Query Frame = 3
Query: 1758 HARTEFLAKYLFGDDMIEDFNFLICKEPFKDIPTF---------------------WHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSN-------KEPLRPHRKYHPDKHIRTCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRP 2177
            H +   + + + G D+I   +  ICK P     T                      WH D  YW  +     +S W+ALD +  ENG +  +PGS+       ++ +RP      ++ I        E    PL+ G+M+ H G  +H S  N +  RR GFV+ Y P
Sbjct:   68 HPQILKVVQAVLGADVILLDSRFICKYPALKAETIHEGNQSKPDGNDEGDALPYVAWHQDMRYW-GIDGGPVLSVWLALDDSLKENGALQVIPGSHCAGMLQHRQAVRPGNMLSVNQEIPEELVQVEEAVFCPLKAGQMSIHDGLLVHASDSNMSQRRRCGFVIRYVP 234          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Medaka
Match: zgc:174917 (probable alpha-ketoglutarate-dependent hypophosphite dioxygenase [Source:NCBI gene;Acc:101169464])

HSP 1 Score: 65.4698 bits (158), Expect = 3.676e-11
Identity = 45/168 (26.79%), Postives = 69/168 (41.07%), Query Frame = 3
Query: 1758 HARTEFLAKYLFGDDMIEDFNFLICKEPFKDIPTF---------------------WHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSN-------KEPLRPHRKYHPDKHIRTCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRP 2177
            H +   + + + G D+I   +  ICK P     T                      WH D  YW  +     +S W+ALD +  ENG +  +PGS+       ++ +RP      ++ I        E    PL+ G+M+ H G  +H S  N +  RR GFV+ Y P
Sbjct:   68 HPQILKVVQAVLGADVILLDSRFICKYPALKAETIHEGNQSKPDGNDEGDALPYVAWHQDMRYW-GIDGGPVLSVWLALDDSLKENGALQVIPGSHCAGMLQHRQAVRPGNMLSVNQEIPEELVQVEEAVFCPLKAGQMSIHDGLLVHASDSNMSQRRRCGFVIRYVP 234          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Medaka
Match: phyhd1 (phytanoyl-CoA dioxygenase domain containing 1 [Source:NCBI gene;Acc:101166234])

HSP 1 Score: 49.6766 bits (117), Expect = 6.484e-6
Identity = 34/137 (24.82%), Postives = 55/137 (40.15%), Query Frame = 3
Query: 1761 ARTEFLAKYLFGDDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCD-------ADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRR 2150
            A+ + +AK L     +   +  I K+P        H D ++    P  R +  W+AL+   V NGC+WF+PGS++  +       P       D         E      P+Q G +    G  +H S  N + + R
Sbjct:  121 AKVQGIAKKLGLVSPVILQSMYIFKQPGIGGEVTAHQDATFLHTEPLGRVMGLWIALEDATVNNGCLWFIPGSHRSGISRRMVRTPKGSFPLTDFIGREQAYQEDTFVAAPVQKGGVVLIHGEVVHRSAENISEESR 257          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Planmine SMEST
Match: SMESG000077696.1 (SMESG000077696.1)

HSP 1 Score: 362.073 bits (928), Expect = 2.720e-120
Identity = 170/175 (97.14%), Postives = 173/175 (98.86%), Query Frame = 3
Query: 1731 ICNIIQGPIHARTEFLAKYLFGDDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKAMVELERQKEFDHGKSGLSNILLKH 2255
            + N+ +GPIHARTEFLAKYLFGDDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKAMVELERQKEFDHGKSGLSNILLKH
Sbjct:   52 VENLDKGPIHARTEFLAKYLFGDDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKAMVELERQKEFDHGKSGLSNILLKH 226          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Planmine SMEST
Match: SMESG000077696.1 (SMESG000077696.1)

HSP 1 Score: 363.229 bits (931), Expect = 4.843e-120
Identity = 170/175 (97.14%), Postives = 173/175 (98.86%), Query Frame = 3
Query: 1731 ICNIIQGPIHARTEFLAKYLFGDDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKAMVELERQKEFDHGKSGLSNILLKH 2255
            + N+ +GPIHARTEFLAKYLFGDDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKAMVELERQKEFDHGKSGLSNILLKH
Sbjct:   94 VENLDKGPIHARTEFLAKYLFGDDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKAMVELERQKEFDHGKSGLSNILLKH 268          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Planmine SMEST
Match: SMESG000077696.1 (SMESG000077696.1)

HSP 1 Score: 363.229 bits (931), Expect = 6.268e-120
Identity = 170/173 (98.27%), Postives = 172/173 (99.42%), Query Frame = 3
Query: 1737 NIIQGPIHARTEFLAKYLFGDDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKAMVELERQKEFDHGKSGLSNILLKH 2255
            N+ +GPIHARTEFLAKYLFGDDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKAMVELERQKEFDHGKSGLSNILLKH
Sbjct:  104 NLDKGPIHARTEFLAKYLFGDDMIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHIRTCDADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRRRGFVVNYRPKAMVELERQKEFDHGKSGLSNILLKH 276          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Planmine SMEST
Match: SMESG000004910.1 (SMESG000004910.1)

HSP 1 Score: 53.1434 bits (126), Expect = 3.953e-7
Identity = 31/104 (29.81%), Postives = 49/104 (47.12%), Query Frame = 3
Query: 1866 HSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHI-----RTC----DADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRR 2150
            H D S+    P+ R + FW+AL+   +ENGC+W V GS+K  L  + ++  D  +     R C    +  + E  PV +  G +    G  +H S  N +   R
Sbjct:  157 HQDASFLWTEPECRILGFWIALEDAKIENGCLWAVQGSHKNGLLNNVRFIRDPSMGKYVTRLCSEYPEIKDEEYVPVEVSKGSLVLIHGYVMHKSLPNISNKTR 260          
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Planmine SMEST
Match: SMESG000004909.1 (SMESG000004909.1)

HSP 1 Score: 53.1434 bits (126), Expect = 4.781e-7
Identity = 31/104 (29.81%), Postives = 49/104 (47.12%), Query Frame = 3
Query: 1866 HSDESYWLDLPDKRAVSFWVALDRTYVENGCMWFVPGSNKEPLRPHRKYHPDKHI-----RTC----DADESEGTPVPLQPGEMTGHSGRTLHYSRGNSTADRR 2150
            H D S+    P+ R + FW+AL+   +ENGC+W V GS+K  L  + ++  D  +     R C    +  + E  PV +  G +    G  +H S  N +   R
Sbjct:  209 HQDASFLWTEPECRILGFWIALEDAKIENGCLWAVQGSHKNGLLNNVRFIRDPSMGKYVTRLCSEYPEIKDEEYVPVEVSKGSLVLIHGYVMHKSLPNISNKTR 312          
The following BLAST results are available for this feature:
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
PHYHD11.234e-630.10phytanoyl-CoA dioxygenase domain containing 1 [Sou... [more]
PHYHD11.509e-630.10phytanoyl-CoA dioxygenase domain containing 1 [Sou... [more]
PHYHD11.509e-630.10phytanoyl-CoA dioxygenase domain containing 1 [Sou... [more]
back to top
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y105C5B.91.430e-623.44Phytanoyl-CoA dioxygenase domain-containing protei... [more]
back to top
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1749172.132e-931.25zgc:174917 [Source:ZFIN;Acc:ZDB-GENE-070928-42][more]
zgc:1749172.132e-931.25zgc:174917 [Source:ZFIN;Acc:ZDB-GENE-070928-42][more]
zgc:1749172.132e-931.25zgc:174917 [Source:ZFIN;Acc:ZDB-GENE-070928-42][more]
zgc:1749172.132e-931.25zgc:174917 [Source:ZFIN;Acc:ZDB-GENE-070928-42][more]
phyhd15.415e-728.43phytanoyl-CoA dioxygenase domain containing 1 [Sou... [more]
back to top
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem1635.234e-1330.34transmembrane protein 163 [Source:Xenbase;Acc:XB-G... [more]
tmem1635.483e-1330.34transmembrane protein 163 [Source:Xenbase;Acc:XB-G... [more]
tmem1636.669e-1330.34transmembrane protein 163 [Source:Xenbase;Acc:XB-G... [more]
tmem1636.669e-1330.34transmembrane protein 163 [Source:Xenbase;Acc:XB-G... [more]
tmem1636.795e-1330.34transmembrane protein 163 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Phyhd12.688e-724.72phytanoyl-CoA dioxygenase domain containing 1 [Sou... [more]
Phyhd11.560e-624.78phytanoyl-CoA dioxygenase domain containing 1 [Sou... [more]
Phyhd11.560e-624.78phytanoyl-CoA dioxygenase domain containing 1 [Sou... [more]
Phyhd11.880e-624.78phytanoyl-CoA dioxygenase domain containing 1 [Sou... [more]
Phyhd11.884e-624.78phytanoyl-CoA dioxygenase domain containing 1 [Sou... [more]
back to top
BLAST of Phytanoyl-CoA dioxygenase family protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q5U3U0|PHYD1_DANRE5.131e-628.43Phytanoyl-CoA dioxygenase domain-containing protei... [more]
back to top
BLAST of Phytanoyl-CoA dioxygenase family protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JNQ53.085e-5455.88phytanoyl-CoA dioxygenase domain-containing protei... [more]
A0A267F1N16.208e-5355.63Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A172U2D18.490e-5351.74Uncharacterized protein OS=Flavisolibacter tropicu... [more]
A0A3B9AI631.579e-5253.05Phytanoyl-CoA dioxygenase family protein OS=Sapros... [more]
A0A1I8IXG92.528e-5255.63Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zgc:1749176.269e-1330.77zgc:174917 [Source:ZFIN;Acc:ZDB-GENE-070928-42][more]
back to top
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
phyhd11.771e-827.87phytanoyl-CoA dioxygenase domain containing 1 [Sou... [more]
back to top
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO482472.305e-1133.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429494.048e-731.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282871.108e-627.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429487.662e-626.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:1749171.692e-1126.79probable alpha-ketoglutarate-dependent hypophosphi... [more]
zgc:1749173.676e-1126.79probable alpha-ketoglutarate-dependent hypophosphi... [more]
phyhd16.484e-624.82phytanoyl-CoA dioxygenase domain containing 1 [Sou... [more]
back to top
BLAST of Phytanoyl-CoA dioxygenase family protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077696.12.720e-12097.14SMESG000077696.1[more]
SMESG000077696.14.843e-12097.14SMESG000077696.1[more]
SMESG000077696.16.268e-12098.27SMESG000077696.1[more]
SMESG000004910.13.953e-729.81SMESG000004910.1[more]
SMESG000004909.14.781e-729.81SMESG000004909.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016885 ID=SMED30016885|Name=Phytanoyl-CoA dioxygenase family protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2421bp
TATAAAAATGCATAACCCTGTAAATTGAATTACATTATCAATAAAATTAA
AATTTCTATGTTTTAAATTAATGTTTTTTAATCAATATTTTCTATGTACT
CTGTTTACAATTTATTAAAGTTTATTTGCTTTTTCCAAATATTTAAATTT
CAAAATAAAATATTACAAAGTTATTCGATAGAATTTATTAGGGCTGTACC
GAGTATCGGTTCGACTACTCGGCATCGGGCGATTTTGGCATACTCGGCAC
ACCAATGGCAACGATGCCAAGTATTGAAAAAAACAAAAAAAATAGCTGGC
GGTGGAGGACTAGGTCAGTAGAGATACACATAGATTATTACCATAACTTA
ATAATACTAAGTATACCACGACTTTATAAAATTTGGTAGCGTTGATTTAA
TACTCATACATGTGAGGTAAATAATAATTCAAAATATATGCTTCACAATT
CTTGAACTTGAAGTGACGTACTATTGTTAACATTGCTATGACGTTGTTAT
ACCGATTCAAATACTTGGTATCGGTATCGGTACTCGACAAAAAGCCTACT
CGGTACAGACCTAGTAATAACCAATTTTTACAAAATTATATTTAAATGGT
AAAACTAAAAGACTTAATTTTTGTTCTTAGATAATCATCAAGGGTTGACT
TGCTACAAATTTAGGCTTGGTGAATTTTTGAAAATGGTCCACAGATGTTA
TGAGGTACAATCGAAGCAAAAGATATTGGATTGAAGAGATAGACCGAATA
TACCAGAAGCGTTCTCTTTACTTGTTTACTTTCTAGTCTGGCGCATGTGT
AATTTTCACTTTATTTTGAATTCTGTAATATTTAGCGACTGCATCGCAAA
TATTCATGCTTGGAAATTTAATTACAACTGTTTTTTTCTAAATCAAAGCA
ATGCTTGACCAAATTACAAAAAATATGTAAGATATTTCGATCATACTCGC
GGTATGCCGTCATTCTAGTCAGCTCATGTTGACCATTTTTCTGCAAAATG
AATTCAATTGTATTTAACATCAAATTTATTTAAATTATTTAAGATCAAAA
ACGACTGGACTTTAATATTTATATAAAAATGTAAATAAAATATTTCATAT
TTGTTAAATAAACTGTTTATATTTAAAATTCATCTGATGAATTTATGTTA
CAATTCCAATCTGATATTTCTAAAAATTGTTGTGTTCTTCATTAATTTTA
ATAAAATCATTAAATATTTTTCAGAATTTTTAATAATTTTTATCTCGCAG
TTTTCGGATATAAGACTCTGTCAGTTACTGCCGTATTTTAAATAAAGGCT
GTCAGATTTATATGATTCGAAAGCAGGACACTTTTTGTGGTTCAAGATTC
AGGCAGGCATATTTAAAAATAAATTTCTGCATTAAAAATGTATATCTTTT
ATAAAAATAAAATAGCAACGATTTTGGAATTTAATAAATATCAATATAAA
CGACAAAGCTGCATGAATTTGGGTGCTTCCATATATTGAAGGGAAACACA
ATGTAAGTTAGATTAAAAAAAACTATTTGAATAGAAAGATTTGGATTATT
TTTAAATGCTATATTTTAATTCTAATTTTTGGTTAATCTTTTTTAACAGA
TTATCCTATGCAGTAACTGTAATATTTTGATATGAAGTTTCATTTCATTA
AACAAATTTTAGGATTCAGAATACATCTTAAACTTTAAATACATATTAAT
TTTTTTTAATTTTATATTTTCCTCACTACTATTTGTAATATTATTCAGGG
TCCAATTCACGCTCGAACAGAATTCTTAGCGAAATATCTATTTGGAGATG
ATATGATTGAAGATTTTAATTTTCTTATTTGTAAGGAACCATTTAAAGAC
ATTCCAACATTTTGGCATTCTGATGAATCTTATTGGTTGGACTTGCCAGA
TAAAAGAGCGGTGTCTTTTTGGGTGGCTTTAGATCGAACATATGTTGAAA
ATGGATGCATGTGGTTTGTCCCTGGATCAAATAAAGAACCATTAAGACCT
CATCGAAAATATCATCCGGATAAGCATATTCGAACTTGTGATGCAGATGA
ATCAGAAGGAACTCCAGTACCTTTACAGCCAGGAGAAATGACTGGACATA
GCGGAAGAACTTTACATTATAGTCGTGGAAATTCAACAGCTGACCGAAGG
CGGGGATTCGTTGTAAATTACCGCCCTAAAGCCATGGTAGAACTAGAGCG
ACAAAAGGAATTCGACCATGGAAAATCTGGCCTATCTAATATATTATTAA
AACATTAAAAAACCAAAAAACAATGATATTGATTTTATTCTATGAAAAAA
TATTTTAAATGAACACTTTCATAAATAAATAGAAAAATATTATTTTCATT
AAATTATATTTATAGACATGTTACAAGTTTATTCTTTTTGTTAACAATAA
TTTTGAACCGGCAGATCGGAA
back to top

protein sequence of SMED30016885-orf-1

>SMED30016885-orf-1 ID=SMED30016885-orf-1|Name=SMED30016885-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=152bp
MIEDFNFLICKEPFKDIPTFWHSDESYWLDLPDKRAVSFWVALDRTYVEN
GCMWFVPGSNKEPLRPHRKYHPDKHIRTCDADESEGTPVPLQPGEMTGHS
GRTLHYSRGNSTADRRRGFVVNYRPKAMVELERQKEFDHGKSGLSNILLK
H*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008775Phytyl_CoA_dOase
Vocabulary: molecular function
TermDefinition
GO:0051213dioxygenase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008775Phytanoyl-CoA dioxygenasePFAMPF05721PhyHcoord: 7..118
e-value: 5.4E-23
score: 82.4
NoneNo IPR availableGENE3DG3DSA:2.60.120.620coord: 2..138
e-value: 5.3E-41
score: 142.9
NoneNo IPR availablePANTHERPTHR20883PHYTANOYL-COA DIOXYGENASE DOMAIN CONTAINING 1coord: 2..139
NoneNo IPR availablePANTHERPTHR20883:SF32coord: 2..139
NoneNo IPR availableSUPERFAMILYSSF51197Clavaminate synthase-likecoord: 7..135