Zinc finger Ran-binding domain-containing protein 2

Overview
NameZinc finger Ran-binding domain-containing protein 2
Smed IDSMED30016880
Length (bp)1254
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger Ran-binding domain-containing protein 2 (SMED30016880) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger Ran-binding domain-containing protein 2 (SMED30016880) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger Ran-binding domain-containing protein 2 (SMED30016880) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger Ran-binding domain-containing protein 2 (SMED30016880) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016880

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30016880SMESG000017096.1 SmedASXL_008305SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30016880SMESG000017096.1 SmedASXL_008305SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30016880SMESG000017096.1 dd_Smed_v4_1397_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016880SMESG000017096.1 dd_Smed_v4_1397_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016880SMESG000017096.1 dd_Smed_v4_1397_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016880SMESG000017096.1 dd_Smed_v4_1397_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016880SMESG000017096.1 dd_Smed_v4_1397_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016880SMESG000017096.1 dd_Smed_v4_1397_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016880SMESG000017096.1 dd_Smed_v4_1397_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016880SMESG000017096.1 Contig46142uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016880SMESG000017096.1 Contig46142newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30016880SMESG000017096.1 OX_Smed_1.0.21171ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Human
Match: ZRANB2 (zinc finger RANBP2-type containing 2 [Source:HGNC Symbol;Acc:HGNC:13058])

HSP 1 Score: 157.147 bits (396), Expect = 5.437e-44
Identity = 75/128 (58.59%), Postives = 96/128 (75.00%), Query Frame = 2
Query:   38 MSSKT-SLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKV----GIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEF 406
            MS+K   ++ G+W+CPD+ CGN+NF +R  CNRCG++K    K+    G EIGK +AEKS+GLFSA+DW CK+C N+NWARR+ CN+CNT K     +RTGYGGGF ERE  VEYI+R +SD EYDEF
Sbjct:    1 MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNEREN-VEYIEREESDGEYDEF 127          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Human
Match: ZRANB2 (zinc finger RANBP2-type containing 2 [Source:HGNC Symbol;Acc:HGNC:13058])

HSP 1 Score: 157.147 bits (396), Expect = 5.437e-44
Identity = 75/128 (58.59%), Postives = 96/128 (75.00%), Query Frame = 2
Query:   38 MSSKT-SLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKV----GIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEF 406
            MS+K   ++ G+W+CPD+ CGN+NF +R  CNRCG++K    K+    G EIGK +AEKS+GLFSA+DW CK+C N+NWARR+ CN+CNT K     +RTGYGGGF ERE  VEYI+R +SD EYDEF
Sbjct:    1 MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNEREN-VEYIEREESDGEYDEF 127          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Human
Match: ZRANB2 (zinc finger RANBP2-type containing 2 [Source:HGNC Symbol;Acc:HGNC:13058])

HSP 1 Score: 156.762 bits (395), Expect = 1.021e-43
Identity = 75/128 (58.59%), Postives = 96/128 (75.00%), Query Frame = 2
Query:   38 MSSKT-SLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKV----GIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEF 406
            MS+K   ++ G+W+CPD+ CGN+NF +R  CNRCG++K    K+    G EIGK +AEKS+GLFSA+DW CK+C N+NWARR+ CN+CNT K     +RTGYGGGF ERE  VEYI+R +SD EYDEF
Sbjct:    1 MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNEREN-VEYIEREESDGEYDEF 127          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Celegans
Match: Y25C1A.8 (Zinc finger Ran-binding domain-containing protein 2 [Source:UniProtKB/TrEMBL;Acc:Q8ITV3])

HSP 1 Score: 124.79 bits (312), Expect = 4.926e-32
Identity = 64/127 (50.39%), Postives = 85/127 (66.93%), Query Frame = 2
Query:   47 KTSLTKGNWLCPDESCGNMNFPKRDKCNRCGKKK-KDVTKVGIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEFGMKKKK 424
            + +L  G W C D  C  +N      C+  GK K +  +K+G E+GK  AEKSKGLF+A+DW+C  CGN+NWARR  CN+CN  K+    +RTGYGGG+ +R+  VEY+ R D D+E+DEFG KKKK
Sbjct:   13 RRALKDGEWACVDSKCAKVNEESLLVCDEYGKPKPRAKSKIGKELGKEQAEKSKGLFAAEDWVCSKCGNVNWARRRTCNVCNAPKLADLERRTGYGGGYNDRQN-VEYVKR-DYDEEFDEFGRKKKK 137          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Fly
Match: CG3732 (gene:FBgn0034750 transcript:FBtr0071936)

HSP 1 Score: 129.798 bits (325), Expect = 1.879e-34
Identity = 65/155 (41.94%), Postives = 88/155 (56.77%), Query Frame = 2
Query:   56 LTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTK----------------------------VGIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEFGMKKKKYRGH 436
             + G+W+CPD  C ++NF +R +CN+C + +    K                            +G EIGK  A+KS+GLFSA+DW C  C N+NWARR  CN+CN  K +   +RTG+GGG+ +R   VEY DR DSD EYDEFG +KK+  G 
Sbjct:   19 ASPGDWICPDYDCRHLNFARRLQCNKCDRDRDGSDKPERDRDRDRERERGNGSSSSSSSSSKKKLGTEIGKAAADKSRGLFSAEDWQCSKCANVNWARRQTCNMCNAPKFSDVEERTGFGGGYNDR-GVVEYKDRQDSDSEYDEFGRRKKRKHGE 172          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Zebrafish
Match: zranb2 (zinc finger, RAN-binding domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2743])

HSP 1 Score: 155.606 bits (392), Expect = 1.448e-43
Identity = 75/129 (58.14%), Postives = 96/129 (74.42%), Query Frame = 2
Query:   38 MSSKT-SLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKV----GIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEFG 409
            MS K+  ++ G+W+CPD+ CGN+NF +R  CNRCG++K    K+    G EIGK +AEKS+GLFSA+DW CK+CGN+NWARR+ CN+CNT K     +RTGYGGGF ERE  V Y +R +SD EYDEFG
Sbjct:    1 MSGKSFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCGNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENLV-YNEREESDGEYDEFG 128          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Xenopus
Match: thoc5 (THO complex 5 [Source:Xenbase;Acc:XB-GENE-1015168])

HSP 1 Score: 158.303 bits (399), Expect = 4.547e-44
Identity = 76/128 (59.38%), Postives = 97/128 (75.78%), Query Frame = 2
Query:   38 MSSKT-SLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKV----GIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEF 406
            MS+K   ++ G+W+CPD+ CGN+NF +R  CNRCG++K    K+    G EIGK +AEKS+GLFSA+DW CK+CGN+NWARR+ CN+CNT K     +RTGYGGGF ERE  VEYI+R +SD EYDEF
Sbjct:    1 MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTDAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCGNVNWARRSECNMCNTPKYAKLEERTGYGGGFNEREN-VEYIEREESDGEYDEF 127          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Mouse
Match: Zranb2 (zinc finger, RAN-binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1858211])

HSP 1 Score: 157.147 bits (396), Expect = 4.459e-44
Identity = 75/128 (58.59%), Postives = 96/128 (75.00%), Query Frame = 2
Query:   38 MSSKT-SLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKV----GIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEF 406
            MS+K   ++ G+W+CPD+ CGN+NF +R  CNRCG++K    K+    G EIGK +AEKS+GLFSA+DW CK+C N+NWARR+ CN+CNT K     +RTGYGGGF ERE  VEYI+R +SD EYDEF
Sbjct:    1 MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNEREN-VEYIEREESDGEYDEF 127          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Mouse
Match: Zranb2 (zinc finger, RAN-binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1858211])

HSP 1 Score: 157.147 bits (396), Expect = 5.569e-44
Identity = 75/128 (58.59%), Postives = 96/128 (75.00%), Query Frame = 2
Query:   38 MSSKT-SLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKV----GIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEF 406
            MS+K   ++ G+W+CPD+ CGN+NF +R  CNRCG++K    K+    G EIGK +AEKS+GLFSA+DW CK+C N+NWARR+ CN+CNT K     +RTGYGGGF ERE  VEYI+R +SD EYDEF
Sbjct:    1 MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNEREN-VEYIEREESDGEYDEF 127          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Mouse
Match: Zranb2 (zinc finger, RAN-binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1858211])

HSP 1 Score: 102.064 bits (253), Expect = 4.785e-24
Identity = 55/124 (44.35%), Postives = 69/124 (55.65%), Query Frame = 2
Query:   38 MSSKT-SLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKVGIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEF 406
            MS+K   ++ G+W+CPD+ CGN+NF +R  CNRCG                                  C N+NWARR+ CN+CNT K     +RTGYGGGF ERE  VEYI+R +SD EYDEF
Sbjct:    1 MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCG---------------------------------VCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNEREN-VEYIEREESDGEYDEF 90          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Mouse
Match: Zranb2 (zinc finger, RAN-binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1858211])

HSP 1 Score: 46.9802 bits (110), Expect = 4.699e-7
Identity = 19/36 (52.78%), Postives = 28/36 (77.78%), Query Frame = 2
Query:   38 MSSKT-SLTKGNWLCPDESCGNMNFPKRDKCNRCGK 142
            MS+K   ++ G+W+CPD+ CGN+NF +R  CNRCG+
Sbjct:    1 MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGR 36          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Mouse
Match: Zranb2 (zinc finger, RAN-binding domain containing 2 [Source:MGI Symbol;Acc:MGI:1858211])

HSP 1 Score: 46.595 bits (109), Expect = 6.612e-7
Identity = 19/36 (52.78%), Postives = 28/36 (77.78%), Query Frame = 2
Query:   38 MSSKT-SLTKGNWLCPDESCGNMNFPKRDKCNRCGK 142
            MS+K   ++ G+W+CPD+ CGN+NF +R  CNRCG+
Sbjct:    1 MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGR 36          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q5ZLX5|ZRAB2_CHICK (Zinc finger Ran-binding domain-containing protein 2 OS=Gallus gallus OX=9031 GN=ZRANB2 PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 8.310e-44
Identity = 76/128 (59.38%), Postives = 97/128 (75.78%), Query Frame = 2
Query:   38 MSSKT-SLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKV----GIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEF 406
            MS+K   ++ G+W+CPD+ CGN+NF +R  CNRCG++K    K+    G EIGK +AEKS+GLFSA+DW CK+CGN+NWARR+ CN+CNT K     +RTGYGGGF ERE  VEYI+R +SD EYDEF
Sbjct:    1 MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCGNVNWARRSECNMCNTPKYAKLEERTGYGGGFNEREN-VEYIEREESDGEYDEF 127          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q5R580|ZRAB2_PONAB (Zinc finger Ran-binding domain-containing protein 2 OS=Pongo abelii OX=9601 GN=ZRANB2 PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 2.611e-43
Identity = 75/128 (58.59%), Postives = 96/128 (75.00%), Query Frame = 2
Query:   38 MSSKT-SLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKV----GIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEF 406
            MS+K   ++ G+W+CPD+ CGN+NF +R  CNRCG++K    K+    G EIGK +AEKS+GLFSA+DW CK+C N+NWARR+ CN+CNT K     +RTGYGGGF ERE  VEYI+R +SD EYDEF
Sbjct:    1 MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNEREN-VEYIEREESDGEYDEF 127          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q19QU3|ZRAB2_PIG (Zinc finger Ran-binding domain-containing protein 2 OS=Sus scrofa OX=9823 GN=ZRANB2 PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 3.173e-43
Identity = 75/128 (58.59%), Postives = 96/128 (75.00%), Query Frame = 2
Query:   38 MSSKT-SLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKV----GIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEF 406
            MS+K   ++ G+W+CPD+ CGN+NF +R  CNRCG++K    K+    G EIGK +AEKS+GLFSA+DW CK+C N+NWARR+ CN+CNT K     +RTGYGGGF ERE  VEYI+R +SD EYDEF
Sbjct:    1 MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNEREN-VEYIEREESDGEYDEF 127          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|O35986|ZRAB2_RAT (Zinc finger Ran-binding domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Zranb2 PE=1 SV=2)

HSP 1 Score: 157.147 bits (396), Expect = 3.896e-43
Identity = 75/128 (58.59%), Postives = 96/128 (75.00%), Query Frame = 2
Query:   38 MSSKT-SLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKV----GIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEF 406
            MS+K   ++ G+W+CPD+ CGN+NF +R  CNRCG++K    K+    G EIGK +AEKS+GLFSA+DW CK+C N+NWARR+ CN+CNT K     +RTGYGGGF ERE  VEYI+R +SD EYDEF
Sbjct:    1 MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNEREN-VEYIEREESDGEYDEF 127          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q9R020|ZRAB2_MOUSE (Zinc finger Ran-binding domain-containing protein 2 OS=Mus musculus OX=10090 GN=Zranb2 PE=1 SV=2)

HSP 1 Score: 157.147 bits (396), Expect = 3.896e-43
Identity = 75/128 (58.59%), Postives = 96/128 (75.00%), Query Frame = 2
Query:   38 MSSKT-SLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKV----GIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEF 406
            MS+K   ++ G+W+CPD+ CGN+NF +R  CNRCG++K    K+    G EIGK +AEKS+GLFSA+DW CK+C N+NWARR+ CN+CNT K     +RTGYGGGF ERE  VEYI+R +SD EYDEF
Sbjct:    1 MSTKNFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNEREN-VEYIEREESDGEYDEF 127          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. TrEMBL
Match: A0A5K3EVU9 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 7.919e-58
Identity = 92/134 (68.66%), Postives = 112/134 (83.58%), Query Frame = 2
Query:   38 MSSKTSLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKV---GIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEFGMKKKKYR 430
            MSSK + +KG+W+C D  CGN+NF +R+KCN+CG+ KK  + V   G EIGK +AEKS+GLFS DDW CKSCGN+NWARRT CN+CNTSKVNTQGQRTGYGGG+ ER+E V+Y  R++SDDEYDEFG+KKKKYR
Sbjct:    1 MSSKFAPSKGDWICSDSRCGNVNFARREKCNKCGRPKKHQSSVHVSGREIGKELAEKSRGLFSPDDWQCKSCGNVNWARRTVCNVCNTSKVNTQGQRTGYGGGYMERDEVVDYKQRDESDDEYDEFGIKKKKYR 134          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. TrEMBL
Match: A0A158QSC5 (Zinc finger Ran-binding domain-containing protein 2 OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS657 PE=3 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.205e-55
Identity = 92/137 (67.15%), Postives = 112/137 (81.75%), Query Frame = 2
Query:   38 MSSKTSLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKV---GIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDE---FGMKKKKYR 430
            MSSK + +KG+W+C D  CGN+NF +R+KCN+CG+ KK  + V   G EIGK +AEKS+GLFS DDW CKSCGN+NWARRT CN+CNTSKVNTQGQRTGYGGG+ ER+E V+Y  R++SDDEYDE   FG+KKKKYR
Sbjct:    1 MSSKFAPSKGDWICSDSRCGNVNFARREKCNKCGRPKKHQSSVHVSGREIGKELAEKSRGLFSPDDWQCKSCGNVNWARRTVCNVCNTSKVNTQGQRTGYGGGYMERDEVVDYKQRDESDDEYDEVFLFGIKKKKYR 137          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. TrEMBL
Match: A0A0R3W352 (Zinc finger Ran-binding domain-containing protein 2 OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4319 PE=3 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 4.532e-53
Identity = 86/134 (64.18%), Postives = 105/134 (78.36%), Query Frame = 2
Query:   38 MSSKTSLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTK---VGIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEFGMKKKKYR 430
            MS + + +KG+W+C D  CGN+NF +RDKCN+CG+ KK        G EIGK  AEKS+GLF  DDW CKSCGN+NWARRT CN+CN +KVNTQGQRTGYGGG+ ER+E V+Y   ++SDDEYDEFG+KKKKYR
Sbjct:    1 MSGRFAPSKGDWVCSDSRCGNLNFARRDKCNKCGRPKKHNQSGHNSGKEIGKEFAEKSRGLFGPDDWQCKSCGNVNWARRTVCNVCNAAKVNTQGQRTGYGGGYMERDEVVDYKRHDESDDEYDEFGLKKKKYR 134          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. TrEMBL
Match: A0A068YFS0 (Zinc finger Ran-binding domain-containing protein 2 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001117200 PE=3 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 5.008e-53
Identity = 86/134 (64.18%), Postives = 106/134 (79.10%), Query Frame = 2
Query:   38 MSSKTSLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTK---VGIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEFGMKKKKYR 430
            MS + + +KG+W+C D  CGN+NF +RDKCN+CG+ KK+       G EIGK  AEKS+GLF  DDW CKSCGN+NWARRT CN+CN +KVNTQGQRTGYGGG+ ER+E V+Y   ++SDDEYDEFG+KKKKYR
Sbjct:    1 MSGRFAPSKGDWVCSDSRCGNLNFARRDKCNKCGRPKKNNQSGHSSGKEIGKEFAEKSRGLFGPDDWQCKSCGNVNWARRTVCNVCNAAKVNTQGQRTGYGGGYMERDEVVDYKRHDESDDEYDEFGLKKKKYR 134          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. TrEMBL
Match: A0A068WK62 (Zinc finger Ran-binding domain-containing protein 2 OS=Echinococcus granulosus OX=6210 GN=EgrG_001117200 PE=3 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 5.814e-53
Identity = 86/134 (64.18%), Postives = 106/134 (79.10%), Query Frame = 2
Query:   38 MSSKTSLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTK---VGIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEFGMKKKKYR 430
            MS + + +KG+W+C D  CGN+NF +RDKCN+CG+ KK+       G EIGK  AEKS+GLF  DDW CKSCGN+NWARRT CN+CN +KVNTQGQRTGYGGG+ ER+E V+Y   ++SDDEYDEFG+KKKKYR
Sbjct:    1 MSGRFAPSKGDWVCSDSRCGNLNFARRDKCNKCGRPKKNNQSGHSSGKEIGKEFAEKSRGLFGPDDWQCKSCGNVNWARRTVCNVCNAAKVNTQGQRTGYGGGYMERDEVVDYKRHDESDDEYDEFGLKKKKYR 134          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000042597.1 (zinc finger RANBP2-type containing 2 [Source:NCBI gene;Acc:103033185])

HSP 1 Score: 156.377 bits (394), Expect = 9.969e-44
Identity = 75/129 (58.14%), Postives = 96/129 (74.42%), Query Frame = 2
Query:   38 MSSKT-SLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKV----GIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEFG 409
            MS K+  ++ G+W+CPD+ CGN+NF +R  CNRCG++K    K+    G EIGK +AEKS+GLFSA+DW CK+CGN+NWARR+ CN+CNT K     +RTGYGGGF ERE  V Y +R +SD EYDEFG
Sbjct:    1 MSGKSFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKLMKAGGTEIGKTLAEKSRGLFSANDWQCKTCGNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENLV-YNEREESDGEYDEFG 128          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO36097 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJP8])

HSP 1 Score: 154.066 bits (388), Expect = 7.606e-46
Identity = 74/130 (56.92%), Postives = 94/130 (72.31%), Query Frame = 2
Query:   56 LTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKV---GIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEFGMKKKKYRGH 436
            L+ G+W+CPD  CGNMNF +R  CNRCG++KK V  +   G+E+GK  A KS GLFSA+DW+C  CGN+NWARR +CN+CN +K +    RTGYGGG+ ER   VEY  + +SDDEYDEFG +KKK   H
Sbjct:    3 LSDGDWVCPDPKCGNMNFARRSSCNRCGREKKCVDTIKLSGVELGKQAASKSGGLFSAEDWICSKCGNVNWARRNSCNMCNNAKFSKVEARTGYGGGYNER-GTVEYKPKEESDDEYDEFGRRKKKKGSH 131          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Medaka
Match: zranb2 (zinc finger RANBP2-type containing 2 [Source:NCBI gene;Acc:101175066])

HSP 1 Score: 159.844 bits (403), Expect = 7.642e-45
Identity = 76/128 (59.38%), Postives = 97/128 (75.78%), Query Frame = 2
Query:   38 MSSKT-SLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKV----GIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEF 406
            MS K+  ++ G+W+CPD+ CGN+NF +R  CNRCG++K    K+    G EIGK +AEKS+GLFSA+DW CK+CGN+NWARR+ CN+CNT K     +RTGYGGGF ERE  VEYI+R +SD EYDEF
Sbjct:   38 MSGKSFRVSDGDWICPDKKCGNVNFARRTSCNRCGREKTTEAKMMKAGGTEIGKTLAEKSRGLFSANDWQCKTCGNVNWARRSECNMCNTPKYAKLEERTGYGGGFNEREN-VEYIEREESDGEYDEF 164          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000017096.1 (SMESG000017096.1)

HSP 1 Score: 400.208 bits (1027), Expect = 1.765e-139
Identity = 284/286 (99.30%), Postives = 285/286 (99.65%), Query Frame = 2
Query:   38 MSSKTSLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKVGIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEFGMKKKKYRGHIXXXXXXXXXXXXXXXLSNHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDLSKYDLWGDDNADGNQTTKPNEAIPPKRAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKKPVDNGLDNVDSRKQRKQKMERSRSRSPVDKRDKKYY 895
            MSSKTSLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKVGIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEFGMKKKKYRGHINQEN+NNKVEEVNEKLSNHEEVDENIDEDNEEEDDNGDDEIDEAEEDSDNGDLSKYDLWGDDNAD NQTTKPNEAIPPKRAKSQSSISSVSSSSSGSSTDSSDSSDSSSSSSSPKKPVDNGLDNVDSRKQRKQKMERSRSRSPVDKRDKKYY
Sbjct:    1 MSSKTSLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKVGIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEFGMKKKKYRGHINQENDNNKVEEVNEKLSNHEEVDENIDEDNEEEDDNGDDEIDEAEEDSDNGDLSKYDLWGDDNADCNQTTKPNEAIPPKRAKSQSSISSVSSSSSGSSTDSSDSSDSSSSSSSPKKPVDNGLDNVDSRKQRKQKMERSRSRSPVDKRDKKYY 286          
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000017096.1 (SMESG000017096.1)

HSP 1 Score: 349.747 bits (896), Expect = 7.702e-120
Identity = 266/286 (93.01%), Postives = 267/286 (93.36%), Query Frame = 2
Query:   38 MSSKTSLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKVGIEIGKVIAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEFGMKKKKYRGHIXXXXXXXXXXXXXXXLSNHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDLSKYDLWGDDNADGNQTTKPNEAIPPKRAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKKPVDNGLDNVDSRKQRKQKMERSRSRSPVDKRDKKYY 895
            MSSKTSLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKVGIEIGKVIAEKSKGLFSADDWMCK                  SKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEFGMKKKKYRGHINQEN+NNKVEEVNEKLSNHEEVDENIDEDNEEEDDNGDDEIDEAEEDSDNGDLSKYDLWGDDNAD NQTTKPNEAIPPKRAKSQSSISSVSSSSSGSSTDSSDSSDSSSSSSSPKKPVDNGLDNVDSRKQRKQKMERSRSRSPVDKRDKKYY
Sbjct:    1 MSSKTSLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKVGIEIGKVIAEKSKGLFSADDWMCK------------------SKVNTQGQRTGYGGGFYEREEAVEYIDRNDSDDEYDEFGMKKKKYRGHINQENDNNKVEEVNEKLSNHEEVDENIDEDNEEEDDNGDDEIDEAEEDSDNGDLSKYDLWGDDNADCNQTTKPNEAIPPKRAKSQSSISSVSSSSSGSSTDSSDSSDSSSSSSSPKKPVDNGLDNVDSRKQRKQKMERSRSRSPVDKRDKKYY 268          
The following BLAST results are available for this feature:
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ZRANB25.437e-4458.59zinc finger RANBP2-type containing 2 [Source:HGNC ... [more]
ZRANB25.437e-4458.59zinc finger RANBP2-type containing 2 [Source:HGNC ... [more]
ZRANB21.021e-4358.59zinc finger RANBP2-type containing 2 [Source:HGNC ... [more]
back to top
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y25C1A.84.926e-3250.39Zinc finger Ran-binding domain-containing protein ... [more]
back to top
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG37321.879e-3441.94gene:FBgn0034750 transcript:FBtr0071936[more]
back to top
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zranb21.448e-4358.14zinc finger, RAN-binding domain containing 2 [Sour... [more]
back to top
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
thoc54.547e-4459.38THO complex 5 [Source:Xenbase;Acc:XB-GENE-1015168][more]
back to top
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zranb24.459e-4458.59zinc finger, RAN-binding domain containing 2 [Sour... [more]
Zranb25.569e-4458.59zinc finger, RAN-binding domain containing 2 [Sour... [more]
Zranb24.785e-2444.35zinc finger, RAN-binding domain containing 2 [Sour... [more]
Zranb24.699e-752.78zinc finger, RAN-binding domain containing 2 [Sour... [more]
Zranb26.612e-752.78zinc finger, RAN-binding domain containing 2 [Sour... [more]
back to top
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZLX5|ZRAB2_CHICK8.310e-4459.38Zinc finger Ran-binding domain-containing protein ... [more]
sp|Q5R580|ZRAB2_PONAB2.611e-4358.59Zinc finger Ran-binding domain-containing protein ... [more]
sp|Q19QU3|ZRAB2_PIG3.173e-4358.59Zinc finger Ran-binding domain-containing protein ... [more]
sp|O35986|ZRAB2_RAT3.896e-4358.59Zinc finger Ran-binding domain-containing protein ... [more]
sp|Q9R020|ZRAB2_MOUSE3.896e-4358.59Zinc finger Ran-binding domain-containing protein ... [more]
back to top
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EVU97.919e-5868.66Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A158QSC51.205e-5567.15Zinc finger Ran-binding domain-containing protein ... [more]
A0A0R3W3524.532e-5364.18Zinc finger Ran-binding domain-containing protein ... [more]
A0A068YFS05.008e-5364.18Zinc finger Ran-binding domain-containing protein ... [more]
A0A068WK625.814e-5364.18Zinc finger Ran-binding domain-containing protein ... [more]
back to top
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000042597.19.969e-4458.14zinc finger RANBP2-type containing 2 [Source:NCBI ... [more]
back to top
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO360977.606e-4656.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
zranb27.642e-4559.38zinc finger RANBP2-type containing 2 [Source:NCBI ... [more]
back to top
BLAST of Zinc finger Ran-binding domain-containing protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000017096.11.765e-13999.30SMESG000017096.1[more]
SMESG000017096.17.702e-12093.01SMESG000017096.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016880 ID=SMED30016880|Name=Zinc finger Ran-binding domain-containing protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1254bp
TTTATGTTTATTTTTAAAATAAATTTGAATTTGTAAAATGTCTTCTAAAA
CGTCATTAACTAAAGGCAATTGGTTATGTCCTGATGAAAGCTGTGGAAAT
ATGAATTTTCCCAAAAGGGACAAGTGTAATAGATGTGGTAAAAAGAAAAA
AGATGTAACCAAAGTTGGTATAGAAATCGGTAAAGTAATCGCGGAAAAGA
GTAAAGGACTGTTTAGTGCAGATGATTGGATGTGCAAAAGTTGTGGGAAT
ATAAATTGGGCTAGAAGAACAGCTTGTAATATTTGTAATACTAGTAAAGT
GAATACACAAGGCCAGCGAACTGGTTACGGTGGAGGATTTTACGAACGAG
AAGAAGCTGTCGAATATATCGATCGAAATGATTCCGACGATGAATACGAT
GAGTTTGGAATGAAGAAAAAAAAATATCGTGGACACATTAATCAAGAAAA
TGAAAATAATAAAGTCGAGGAAGTCAATGAAAAGCTATCAAATCACGAGG
AAGTTGATGAAAACATTGATGAAGATAATGAAGAGGAAGATGACAATGGT
GATGATGAAATCGATGAAGCTGAAGAGGATAGCGATAATGGGGACTTATC
CAAATATGATTTATGGGGAGATGATAATGCCGATGGTAATCAAACAACTA
AGCCCAATGAAGCAATTCCTCCAAAGCGAGCCAAGTCTCAATCGTCTATT
TCCTCTGTATCATCCAGTTCTTCGGGATCTTCGACTGATTCTTCAGATTC
AAGCGATTCATCATCGTCGTCATCCTCGCCAAAAAAACCAGTCGACAACG
GATTGGACAATGTAGATTCTAGGAAACAACGAAAACAGAAGATGGAACGG
TCAAGATCGAGATCTCCTGTGGACAAGAGGGACAAGAAATACTACTAACA
GAATTGTTATTTATTAATATAATTATTCTCTTATTTTTATGAATGTTGGT
TGTGAACGTGAATTACGGTATTTATATGGTGTTTGCGCATTTGCAGCATT
GATAAATTGTTTATTATTATTTTGATTGGTTTATTGGAATCGGCCAATGA
AATTTCGGCCAATCGTTTTGGGGCTTGCTTATTGATATGGTTGATTTTCT
AATTACACGATGAAAACTTAAAGTTGTGGAAATGTTTTCCAACGAGTCAG
TCTATAAATGATGCGTAATTTTTTATTCTTTACCTTCCAAACTACAAGAA
TTTTTTATACGTGTTATTTGTTGAACGGATATTTTGTGAGATTTTTAAAA
GTTC
back to top

protein sequence of SMED30016880-orf-1

>SMED30016880-orf-1 ID=SMED30016880-orf-1|Name=SMED30016880-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=287bp
MSSKTSLTKGNWLCPDESCGNMNFPKRDKCNRCGKKKKDVTKVGIEIGKV
IAEKSKGLFSADDWMCKSCGNINWARRTACNICNTSKVNTQGQRTGYGGG
FYEREEAVEYIDRNDSDDEYDEFGMKKKKYRGHINQENENNKVEEVNEKL
SNHEEVDENIDEDNEEEDDNGDDEIDEAEEDSDNGDLSKYDLWGDDNADG
NQTTKPNEAIPPKRAKSQSSISSVSSSSSGSSTDSSDSSDSSSSSSSPKK
PVDNGLDNVDSRKQRKQKMERSRSRSPVDKRDKKYY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036443Znf_RanBP2_sf
IPR001876Znf_RanBP2
IPR017337UCP037956_Znf_RanB2
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0003723RNA binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 136..166
NoneNo IPR availableGENE3DG3DSA:4.10.1060.10coord: 52..91
e-value: 7.2E-12
score: 46.3
coord: 1..40
e-value: 4.7E-13
score: 50.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 197..252
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 131..286
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 131..156
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 255..286
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 157..184
NoneNo IPR availablePANTHERPTHR12999FAMILY NOT NAMEDcoord: 9..276
IPR001876Zinc finger, RanBP2-typeSMARTSM00547zf_4coord: 10..36
e-value: 6.5E-4
score: 29.0
coord: 62..86
e-value: 2.7E-6
score: 36.9
IPR001876Zinc finger, RanBP2-typePFAMPF00641zf-RanBPcoord: 10..38
e-value: 6.5E-6
score: 25.4
coord: 60..87
e-value: 5.3E-5
score: 22.4
IPR001876Zinc finger, RanBP2-typePROSITEPS01358ZF_RANBP2_1coord: 64..83
IPR001876Zinc finger, RanBP2-typePROSITEPS01358ZF_RANBP2_1coord: 12..33
IPR001876Zinc finger, RanBP2-typePROSITEPS50199ZF_RANBP2_2coord: 60..89
score: 9.224
IPR001876Zinc finger, RanBP2-typePROSITEPS50199ZF_RANBP2_2coord: 8..39
score: 9.507
IPR017337Uncharacterised conserved protein UCP037956, zinc finger Ran-bindingPIRSFPIRSF037956ZRANB2coord: 1..286
e-value: 1.8E-83
score: 278.2
IPR036443Zinc finger, RanBP2-type superfamilySUPERFAMILYSSF90209Ran binding protein zinc finger-likecoord: 5..38
IPR036443Zinc finger, RanBP2-type superfamilySUPERFAMILYSSF90209Ran binding protein zinc finger-likecoord: 53..89