hypothetical protein

Overview
Namehypothetical protein (AFJ24751.1)
Smed IDSMED30016879
Length (bp)3794
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of hypothetical protein (SMED30016879) t-SNE clustered cells

Violin plots show distribution of expression levels for hypothetical protein (SMED30016879) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of hypothetical protein (SMED30016879) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for hypothetical protein (SMED30016879) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016879

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30016879SMESG000058269.1 dd_Smed_v4_7993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016879SMESG000058269.1 dd_Smed_v4_7993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of hypothetical protein vs. TrEMBL
Match: I1ZI97 (Uncharacterized protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 309.686 bits (792), Expect = 1.200e-94
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 1
Query: 3118 MSYQKTVPRSLNYITVMENNCSSPLSIYPPSECSYLEPDTNESFRKIKSHNFKHNLTTPQSSPVVDYCQIDLNCTYALKAIDHLLYHDKIKYRDKDSILKSGSPEDVESCMNFDQSENFSISSFNRERKNKMSTNKKVFRRLFSRKAESTN 3570
            MSYQKTVPRSLNYITVMENNCSSPLSIYPPSECSYLEPDTNESFRKIKSHNFKHNLTTPQSSPVVDYCQIDLNCTYALKAIDHLLYHDKIKYRDKDSILKSGSPEDVESCMNFDQSENFSISSFNRERKNKMSTNKKVFRRLFSRKAESTN
Sbjct:    1 MSYQKTVPRSLNYITVMENNCSSPLSIYPPSECSYLEPDTNESFRKIKSHNFKHNLTTPQSSPVVDYCQIDLNCTYALKAIDHLLYHDKIKYRDKDSILKSGSPEDVESCMNFDQSENFSISSFNRERKNKMSTNKKVFRRLFSRKAESTN 151          
BLAST of hypothetical protein vs. TrEMBL
Match: A0A4Z2DDY2 (Uncharacterized protein OS=Schistosoma japonicum OX=6182 GN=EWB00_002065 PE=4 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 2.738e-20
Identity = 49/103 (47.57%), Postives = 68/103 (66.02%), Query Frame = 1
Query:  259 IDEITGFEYGRHVDKEGSVMALIGRNVVYCIAFSQNETMFRWAETLHKHFKCSNFHATLKKVSETSGLFNKISTGIQGNLHIQSLRICLIGEPADGNKFICEW 567
            +DEITGFE G H+DKE +++  IG + VY +A +  + MFRWA+TL +    + F  TL+   + S LF     G+QG+LH+Q  R+CLIGEP+ G KFIC W
Sbjct:  154 VDEITGFESGYHMDKESNIIVFIGVSSVYALALAGMDEMFRWADTLARIVVDNRFRVTLRHAGDGSKLFQ----GLQGSLHVQHWRLCLIGEPSTGCKFICNW 252          
BLAST of hypothetical protein vs. TrEMBL
Match: A0A4S2LXG0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005573 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 9.213e-20
Identity = 56/115 (48.70%), Postives = 72/115 (62.61%), Query Frame = 1
Query:  238 KLNRQYLIDEITGFEYGRHVDKEGSVMALIGRNVVYCIAFSQNETMFRWAETLHKHFKCSNFHATLKKVSETSGLFNKISTGIQGNLHIQSLRICLIGEPADGNKFICEWPISTI 582
            +LN    IDEITGFE G H+DKE +V+ LIG + V+ IA    + MFRWA  + +    S F  TL+K SE S    K+  G QG+LH+Q  R+CLIGEP  G KFIC W + +I
Sbjct:  137 RLNAPVPIDEITGFESGCHLDKESNVIVLIGISSVHIIALEAFDEMFRWAGAMTQIMTDSQFRVTLRKSSEGS----KLPQGTQGSLHVQHWRLCLIGEPLAGCKFICSWKLDSI 247          
BLAST of hypothetical protein vs. TrEMBL
Match: A0A074YY96 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_11640 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 9.613e-20
Identity = 56/115 (48.70%), Postives = 72/115 (62.61%), Query Frame = 1
Query:  238 KLNRQYLIDEITGFEYGRHVDKEGSVMALIGRNVVYCIAFSQNETMFRWAETLHKHFKCSNFHATLKKVSETSGLFNKISTGIQGNLHIQSLRICLIGEPADGNKFICEWPISTI 582
            +LN    IDEITGFE G H+DKE +V+ LIG + V+ IA    + MFRWA  + +    S F  TL+K SE S    K+  G QG+LH+Q  R+CLIGEP  G KFIC W + +I
Sbjct:  147 RLNAPVPIDEITGFESGCHLDKESNVIVLIGISSVHIIALEAFDEMFRWAGAMTQIMTDSQFRVTLRKSSEGS----KLPQGTQGSLHVQHWRLCLIGEPLAGCKFICSWKLDSI 257          
BLAST of hypothetical protein vs. TrEMBL
Match: A0A1S8X5J8 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=X801_02095 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 9.631e-20
Identity = 56/115 (48.70%), Postives = 72/115 (62.61%), Query Frame = 1
Query:  238 KLNRQYLIDEITGFEYGRHVDKEGSVMALIGRNVVYCIAFSQNETMFRWAETLHKHFKCSNFHATLKKVSETSGLFNKISTGIQGNLHIQSLRICLIGEPADGNKFICEWPISTI 582
            +LN    IDEITGFE G H+DKE +V+ LIG + V+ IA    + MFRWA  + +    S F  TL+K SE S    K+  G QG+LH+Q  R+CLIGEP  G KFIC W + +I
Sbjct:  147 RLNAPVPIDEITGFESGCHLDKESNVIVLIGISSVHIIALEAFDEMFRWAGAMTQIMTDSQFRVTLRKSSEGS----KLPQGTQGSLHVQHWRLCLIGEPLAGCKFICSWKLDSI 257          
BLAST of hypothetical protein vs. Ensembl Cavefish
Match: ENSAMXT00000022246.2 (protein Dok-7-like [Source:NCBI gene;Acc:103025917])

HSP 1 Score: 52.373 bits (124), Expect = 2.513e-6
Identity = 24/105 (22.86%), Postives = 48/105 (45.71%), Query Frame = 1
Query:   94 EDNVRYRDGRKWKQRYCMLNKSESKSGAITMYITKQFGAAALNQIIDDKLNRQYLIDEITGFEYGRHVDKEGSVMALIGRNVVYCIAFSQNETMFRWAETLHKHF 408
            E +V+ RDG+KWK R+ +L K    +  + ++++K+ GA   + ++         ++ I G E G   +     + ++  N    + F   + +  W   LH H 
Sbjct:    8 EGHVKLRDGKKWKSRWVVLRKPSPVADCLVLHVSKERGAKEKSSVV---------LEHICGLEAGSSGEGVAFTLTILCLNQTVQLGFDSKDALLPWDLRLHYHL 103          
BLAST of hypothetical protein vs. Ensembl Cavefish
Match: ENSAMXT00000041763.1 (protein Dok-7-like [Source:NCBI gene;Acc:103025917])

HSP 1 Score: 51.6026 bits (122), Expect = 5.293e-6
Identity = 24/105 (22.86%), Postives = 48/105 (45.71%), Query Frame = 1
Query:   94 EDNVRYRDGRKWKQRYCMLNKSESKSGAITMYITKQFGAAALNQIIDDKLNRQYLIDEITGFEYGRHVDKEGSVMALIGRNVVYCIAFSQNETMFRWAETLHKHF 408
            E +V+ RDG+KWK R+ +L K    +  + ++++K+ GA   + ++         ++ I G E G   +     + ++  N    + F   + +  W   LH H 
Sbjct:    8 EGHVKLRDGKKWKSRWVVLRKPSPVADCLVLHVSKERGAKEKSSVV---------LEHICGLEAGSSGEGVAFTLTILCLNQTVQLGFDSKDALLPWDLRLHYHL 103          
BLAST of hypothetical protein vs. Ensembl Cavefish
Match: ENSAMXT00000042615.1 (protein Dok-7-like [Source:NCBI gene;Acc:103025917])

HSP 1 Score: 51.6026 bits (122), Expect = 5.913e-6
Identity = 24/105 (22.86%), Postives = 48/105 (45.71%), Query Frame = 1
Query:   94 EDNVRYRDGRKWKQRYCMLNKSESKSGAITMYITKQFGAAALNQIIDDKLNRQYLIDEITGFEYGRHVDKEGSVMALIGRNVVYCIAFSQNETMFRWAETLHKHF 408
            E +V+ RDG+KWK R+ +L K    +  + ++++K+ GA   + ++         ++ I G E G   +     + ++  N    + F   + +  W   LH H 
Sbjct:    8 EGHVKLRDGKKWKSRWVVLRKPSPVADCLVLHVSKERGAKEKSSVV---------LEHICGLEAGSSGEGVAFTLTILCLNQTVQLGFDSKDALLPWDLRLHYHL 103          
BLAST of hypothetical protein vs. Ensembl Cavefish
Match: ENSAMXT00000039695.1 (protein Dok-7-like [Source:NCBI gene;Acc:103025917])

HSP 1 Score: 51.2174 bits (121), Expect = 6.402e-6
Identity = 24/105 (22.86%), Postives = 48/105 (45.71%), Query Frame = 1
Query:   94 EDNVRYRDGRKWKQRYCMLNKSESKSGAITMYITKQFGAAALNQIIDDKLNRQYLIDEITGFEYGRHVDKEGSVMALIGRNVVYCIAFSQNETMFRWAETLHKHF 408
            E +V+ RDG+KWK R+ +L K    +  + ++++K+ GA   + ++         ++ I G E G   +     + ++  N    + F   + +  W   LH H 
Sbjct:    8 EGHVKLRDGKKWKSRWVVLRKPSPVADCLVLHVSKERGAKEKSSVV---------LEHICGLEAGSSGEGVAFTLTILCLNQTVQLGFDSKDALLPWDLRLHYHL 103          
BLAST of hypothetical protein vs. Planmine SMEST
Match: SMESG000058269.1 (SMESG000058269.1)

HSP 1 Score: 2225.67 bits (5766), Expect = 0.000e+0
Identity = 1155/1167 (98.97%), Postives = 1157/1167 (99.14%), Query Frame = 1
Query:   70 MPRLVTFLEDNVRYRDGRKWKQRYCMLNKSESKSGAITMYITKQFGAAALNQIIDDKLNRQYLIDEITGFEYGRHVDKEGSVMALIGRNVVYCIAFSQNETMFRWAETLHKHFKCSNFHATLKKVSETSGLFNKISTGIQGNLHIQSLRICLIGEPADGNKFICEWPISTINSIDIFNTDCDKVKELVIKSNSKLNKNKGHFEFEISITQNSVFRESIEPFLKSCQNSNEDFRTNFKIKRYSLDTNNDSTSFSYSILNQDIXXXXXXXXXXXXXXXXEIPIPRSREHSGPDQRPIDNVQIKIRKSNKNFAKVLKESKKHFSLIETNGIFDHNSCLFDDDEEIADQFDNKCRNPLYNGLSQESSGVYVNGASNSSREPNLSARILIHDDSGCGNLSSTSSTQNDAINLPNVLPLCQKPSSSKDNPILNFYRSIVRNPLLLTNYRKYCRLLKAVSDCRSQIIKRSNSFNCVHLCDKSQIGYHRKHSTSNFPLNLNYQVSDQYFSYWRKKINTKFFETFLFTDNKNEANILKQSSNHLLSQKLPFKSPKDFHNSIIKSMQNGTACLYLFCYHHFLMLLNDLKVIINNLESKQKLDNNVMDDXXXXXXXXXXXXIYNRWLEKIQSEYCKSFDADIHSQRASILDINLILIYEIANNIFYSRKCYSAKHGSCDSIPRHPPYFMTNPKIELNNDKCLLKRVDENIFKPSFKQXXXXXXXXXXXXXXXXXXDFRYYNQSHPIPKQRKKIKEIKYQNMSGLDSFDTMNHTFPKQNMSLNKPDSVESGSFKKFRRKYSPSFLMPFFNFGSSKFSNTMFTRRKTPSTHSTLSEPICHLENKYHNNYYNIGHKKQSFTKRSLSVVLDSSYPYEESKECHNYINIQNNKGLMYKPDVDPNNYICSGPSSIFDDNSYPEEILDPSINYGDLHFIKSNCSKTKYRQDPYNHNNSLNYRRAXXXXXXXXXXQNFSTSRPTSLKKHGYSNINQLYSEMPNNSVNASMSDYVNGNIVKXXXXXXXXXXXXXXIMSYQKTVPRSLNYITVMENNCSSPLSIYPPSECSYLEPDTNESFRKIKSHNFKHNLTTPQSSPVVDYCQIDLNCTYALKAIDHLLYHDKIKYRDKDSILKSGSPEDVESCMNFDQSENFSISSFNRERKNKMSTNKKVFRRLFSRKAESTN 3570
            MPRLVTFLEDNVRYRDGRKWKQRYCMLNKSESKSGAITMYITKQFGAAALNQIIDDKLNRQYLIDEITGFEYGRHVDKEGSVMALIGRNVVYCIAFSQNETMFRWAETLHKHFKCSNFHATLKKVSETSGLFNKISTGIQGNLHIQSLRICLIGEPADGNKFICEWPISTINSIDIFNTDCDKVKELVIKSNSKLNKNKGHFEFEISITQNSVFRESIEPFLKSCQNSNEDFRTNFKIKRYSLDTNNDSTSFSYSILNQDINCSNSDNSSSLEKRSSEIPIPRSREHSGPDQRPIDNVQIKIRKSNKNFAKVLKESKKHFSLIETNGIFDHNSCLFDDDEEIADQFDNKCRNPLYNGLSQESSGVYVNGASNSSREPNLSARILIHDDSGCGNLSSTSSTQNDAINLPNVLPLCQKPSSSKDNPILNFYRSIVRNPLLLTNYRKYCRLLKAVSDCRSQIIKRSNSFNCVHLCDKSQIGYHRKHSTSNFPLNLNYQVSDQYFSYWRKKIN+KFFETFLFTDNKNEANILKQSSNH LSQKLPFKSPKDFHNSIIKSMQNGTACLYLFCYHHFLMLLNDLKVIINNLESKQKLDNNVMDD     NN   N IYNRWLEKIQSEYCKSFDADIHSQRASILDINLILIYEIANNIFYSRKCYSAKHGSCDSIPRHPPYFMTNPKIELNNDKCLLKRVDENIFKPSFKQSPLLLSPRLIMSSSSSTPDFRYYNQSHPIPKQRKKIKEIKYQNMSGLDSFDTMNHTFPKQNMSLNKPDSVESGSFKKFRRKYSPSFLMPFFNFGSSKFSNTMFTRRKTPSTHSTLSEPICHLENKYHNNYYNIGHKKQSFTKRSLSVVLDSSYPYEESKECHNYINIQNNKGLMYKPDVDPNNYICSGPSSIFDDNSYPEEILDPSINYGDLHFIKSNCSKTKYRQDPYNHNNSLNYRRASLS+LSNKSLQNFSTSRPTSLKKHGYSNINQLYSEMPNNSVNASMSDYVNGNIVKSSSPQSTQSCSPGSIMSYQKTVPRSLNYITVMENNCSSPLSIYPPSECSYLEPDTNESFRKIKSHNFKHNLTTPQSSPVVDYCQIDLNCTYALKAIDHLLYHDKIKYRDKDSILKSGSPEDVESCMNFDQSENFSISSFNRERKNKMSTNKKVFRRLFSRKAESTN
Sbjct:    1 MPRLVTFLEDNVRYRDGRKWKQRYCMLNKSESKSGAITMYITKQFGAAALNQIIDDKLNRQYLIDEITGFEYGRHVDKEGSVMALIGRNVVYCIAFSQNETMFRWAETLHKHFKCSNFHATLKKVSETSGLFNKISTGIQGNLHIQSLRICLIGEPADGNKFICEWPISTINSIDIFNTDCDKVKELVIKSNSKLNKNKGHFEFEISITQNSVFRESIEPFLKSCQNSNEDFRTNFKIKRYSLDTNNDSTSFSYSILNQDINCSNSDNSSSLEKRSSEIPIPRSREHSGPDQRPIDNVQIKIRKSNKNFAKVLKESKKHFSLIETNGIFDHNSCLFDDDEEIADQFDNKCRNPLYNGLSQESSGVYVNGASNSSREPNLSARILIHDDSGCGNLSSTSSTQNDAINLPNVLPLCQKPSSSKDNPILNFYRSIVRNPLLLTNYRKYCRLLKAVSDCRSQIIKRSNSFNCVHLCDKSQIGYHRKHSTSNFPLNLNYQVSDQYFSYWRKKINSKFFETFLFTDNKNEANILKQSSNHSLSQKLPFKSPKDFHNSIIKSMQNGTACLYLFCYHHFLMLLNDLKVIINNLESKQKLDNNVMDDKFKFNNNNKNN-IYNRWLEKIQSEYCKSFDADIHSQRASILDINLILIYEIANNIFYSRKCYSAKHGSCDSIPRHPPYFMTNPKIELNNDKCLLKRVDENIFKPSFKQSPLLLSPRLIMSSSSSTPDFRYYNQSHPIPKQRKKIKEIKYQNMSGLDSFDTMNHTFPKQNMSLNKPDSVESGSFKKFRRKYSPSFLMPFFNFGSSKFSNTMFTRRKTPSTHSTLSEPICHLENKYHNNYYNIGHKKQSFTKRSLSVVLDSSYPYEESKECHNYINIQNNKGLMYKPDVDPNNYICSGPSSIFDDNSYPEEILDPSINYGDLHFIKSNCSKTKYRQDPYNHNNSLNYRRASLSILSNKSLQNFSTSRPTSLKKHGYSNINQLYSEMPNNSVNASMSDYVNGNIVKSSSPQSTQSCSPGSIMSYQKTVPRSLNYITVMENNCSSPLSIYPPSECSYLEPDTNESFRKIKSHNFKHNLTTPQSSPVVDYCQIDLNCTYALKAIDHLLYHDKIKYRDKDSILKSGSPEDVESCMNFDQSENFSISSFNRERKNKMSTNKKVFRRLFSRKAESTN 1166          
BLAST of hypothetical protein vs. Planmine SMEST
Match: SMESG000058269.1 (SMESG000058269.1)

HSP 1 Score: 2220.28 bits (5752), Expect = 0.000e+0
Identity = 1155/1169 (98.80%), Postives = 1157/1169 (98.97%), Query Frame = 1
Query:   70 MPRLVTFLEDNVRYRDGRKWKQRYCMLNKSESKSGAITMYITKQFGAAALNQIIDDKLNRQYLIDEITGFEYGRHVDKEGSVMALIGRNVVYCIAFSQNETMFRWAETLHKHFKCSNFHATLKKVSETSGLFNKISTGIQGNLHIQSLRICLIGEPADGNKFICEWPISTINSIDIFNTDCDKVKELVIKSNSKLNKNKGHFEFEISITQNSVFRESIEPFLKSCQNSNEDFRTNFKIKRYSLDTNNDSTSFSYSILNQDIXXXXXXXXXXXXXXXXEIPIPRSREHSGPDQRPIDNVQIKIRKSNKNFAKVLKESKKHFSLIETNGIFDHNSCLFDDDEEIADQFDNKCRNPLYNGLSQESSGVYVNGASNSSREPNLSARILIHDDSGCGNLSSTSSTQNDAINLPNVLPLCQKPSSSKDNPILNFYRSIVRNPLLLTNYRKYCRLLKAVSDCRSQIIKRSNSFNCVHLCDKSQIGYHRKHSTSNFPLNLNYQVSDQYFSYWRKKINTKFFETFLFTDNKNEANILKQSSNHLLSQKLPFKSPKDFHNSIIKSMQNGTACLYLFCYHHFLMLLNDLKVIINNLESKQKLDNNVMDDXXXXXXXXXXXXIYNRWLEKIQSEYCKSFDADIHSQRASILDINLILIYEIANNIFYSRKCYSAKHGSCDSIPRHPPYFMTNPKIELNNDKCLLKRVDENIFKPSFKQXXXXXXXXXXXXXXXXXXDFRYYNQSHPIPKQRKKIKEIKYQNMSGLDSFDTMNHTFPKQNMSLNKPDSVES--GSFKKFRRKYSPSFLMPFFNFGSSKFSNTMFTRRKTPSTHSTLSEPICHLENKYHNNYYNIGHKKQSFTKRSLSVVLDSSYPYEESKECHNYINIQNNKGLMYKPDVDPNNYICSGPSSIFDDNSYPEEILDPSINYGDLHFIKSNCSKTKYRQDPYNHNNSLNYRRAXXXXXXXXXXQNFSTSRPTSLKKHGYSNINQLYSEMPNNSVNASMSDYVNGNIVKXXXXXXXXXXXXXXIMSYQKTVPRSLNYITVMENNCSSPLSIYPPSECSYLEPDTNESFRKIKSHNFKHNLTTPQSSPVVDYCQIDLNCTYALKAIDHLLYHDKIKYRDKDSILKSGSPEDVESCMNFDQSENFSISSFNRERKNKMSTNKKVFRRLFSRKAESTN 3570
            MPRLVTFLEDNVRYRDGRKWKQRYCMLNKSESKSGAITMYITKQFGAAALNQIIDDKLNRQYLIDEITGFEYGRHVDKEGSVMALIGRNVVYCIAFSQNETMFRWAETLHKHFKCSNFHATLKKVSETSGLFNKISTGIQGNLHIQSLRICLIGEPADGNKFICEWPISTINSIDIFNTDCDKVKELVIKSNSKLNKNKGHFEFEISITQNSVFRESIEPFLKSCQNSNEDFRTNFKIKRYSLDTNNDSTSFSYSILNQDINCSNSDNSSSLEKRSSEIPIPRSREHSGPDQRPIDNVQIKIRKSNKNFAKVLKESKKHFSLIETNGIFDHNSCLFDDDEEIADQFDNKCRNPLYNGLSQESSGVYVNGASNSSREPNLSARILIHDDSGCGNLSSTSSTQNDAINLPNVLPLCQKPSSSKDNPILNFYRSIVRNPLLLTNYRKYCRLLKAVSDCRSQIIKRSNSFNCVHLCDKSQIGYHRKHSTSNFPLNLNYQVSDQYFSYWRKKIN+KFFETFLFTDNKNEANILKQSSNH LSQKLPFKSPKDFHNSIIKSMQNGTACLYLFCYHHFLMLLNDLKVIINNLESKQKLDNNVMDD     NN   N IYNRWLEKIQSEYCKSFDADIHSQRASILDINLILIYEIANNIFYSRKCYSAKHGSCDSIPRHPPYFMTNPKIELNNDKCLLKRVDENIFKPSFKQSPLLLSPRLIMSSSSSTPDFRYYNQSHPIPKQRKKIKEIKYQNMSGLDSFDTMNHTFPKQNMSLNKPDSVES  GSFKKFRRKYSPSFLMPFFNFGSSKFSNTMFTRRKTPSTHSTLSEPICHLENKYHNNYYNIGHKKQSFTKRSLSVVLDSSYPYEESKECHNYINIQNNKGLMYKPDVDPNNYICSGPSSIFDDNSYPEEILDPSINYGDLHFIKSNCSKTKYRQDPYNHNNSLNYRRASLS+LSNKSLQNFSTSRPTSLKKHGYSNINQLYSEMPNNSVNASMSDYVNGNIVKSSSPQSTQSCSPGSIMSYQKTVPRSLNYITVMENNCSSPLSIYPPSECSYLEPDTNESFRKIKSHNFKHNLTTPQSSPVVDYCQIDLNCTYALKAIDHLLYHDKIKYRDKDSILKSGSPEDVESCMNFDQSENFSISSFNRERKNKMSTNKKVFRRLFSRKAESTN
Sbjct:    1 MPRLVTFLEDNVRYRDGRKWKQRYCMLNKSESKSGAITMYITKQFGAAALNQIIDDKLNRQYLIDEITGFEYGRHVDKEGSVMALIGRNVVYCIAFSQNETMFRWAETLHKHFKCSNFHATLKKVSETSGLFNKISTGIQGNLHIQSLRICLIGEPADGNKFICEWPISTINSIDIFNTDCDKVKELVIKSNSKLNKNKGHFEFEISITQNSVFRESIEPFLKSCQNSNEDFRTNFKIKRYSLDTNNDSTSFSYSILNQDINCSNSDNSSSLEKRSSEIPIPRSREHSGPDQRPIDNVQIKIRKSNKNFAKVLKESKKHFSLIETNGIFDHNSCLFDDDEEIADQFDNKCRNPLYNGLSQESSGVYVNGASNSSREPNLSARILIHDDSGCGNLSSTSSTQNDAINLPNVLPLCQKPSSSKDNPILNFYRSIVRNPLLLTNYRKYCRLLKAVSDCRSQIIKRSNSFNCVHLCDKSQIGYHRKHSTSNFPLNLNYQVSDQYFSYWRKKINSKFFETFLFTDNKNEANILKQSSNHSLSQKLPFKSPKDFHNSIIKSMQNGTACLYLFCYHHFLMLLNDLKVIINNLESKQKLDNNVMDDKFKFNNNNKNN-IYNRWLEKIQSEYCKSFDADIHSQRASILDINLILIYEIANNIFYSRKCYSAKHGSCDSIPRHPPYFMTNPKIELNNDKCLLKRVDENIFKPSFKQSPLLLSPRLIMSSSSSTPDFRYYNQSHPIPKQRKKIKEIKYQNMSGLDSFDTMNHTFPKQNMSLNKPDSVESKGGSFKKFRRKYSPSFLMPFFNFGSSKFSNTMFTRRKTPSTHSTLSEPICHLENKYHNNYYNIGHKKQSFTKRSLSVVLDSSYPYEESKECHNYINIQNNKGLMYKPDVDPNNYICSGPSSIFDDNSYPEEILDPSINYGDLHFIKSNCSKTKYRQDPYNHNNSLNYRRASLSILSNKSLQNFSTSRPTSLKKHGYSNINQLYSEMPNNSVNASMSDYVNGNIVKSSSPQSTQSCSPGSIMSYQKTVPRSLNYITVMENNCSSPLSIYPPSECSYLEPDTNESFRKIKSHNFKHNLTTPQSSPVVDYCQIDLNCTYALKAIDHLLYHDKIKYRDKDSILKSGSPEDVESCMNFDQSENFSISSFNRERKNKMSTNKKVFRRLFSRKAESTN 1168          
BLAST of hypothetical protein vs. Planmine SMEST
Match: SMESG000047305.1 (SMESG000047305.1)

HSP 1 Score: 56.6102 bits (135), Expect = 9.315e-8
Identity = 48/200 (24.00%), Postives = 86/200 (43.00%), Query Frame = 1
Query:   85 TFLEDNVRYRDGRKWKQRYCMLNKSESKSGAITMYITKQFGAAALNQIIDDKLNRQYLIDEIT-GFEYGRHVDKEGSVMALIGRNVVYCIAFSQNETMFRWAETLHKHFKCSNFHATLKKVSETSGLFNKISTGIQGNLHIQSLRICLIGEPADGN-KFICEWPISTINSIDIFNTDCDKVKELVIKSNSKLNKNKGHFE 678
              +E ++ YR  +KW  RYC L ++ S S ++ + I       +    +  + + Q +   +  G  +G H++ E  +M ++ +N V C+AF +   M  W++ + K+    +   TL    + S L  K    + G L I    I  I +P+    K +  W I+     DI    C +          K N +KG F+
Sbjct:    3 VIIESDLLYRYKKKWVTRYCKLVQTNSFSDSVKLLIYTSDENRSKRLSLGIRKSCQLMSKHVVYGHLHGIHMNNEAHIMFVVCKNSVECLAFKEFSIMKLWSDMITKYLNDISQPVTLVHADKNSQLKAK----LDGRLLINCSHISFIRDPSCSEPKLLMSWKIA-----DIMEYGCSR--------EIKKNASKGKFK 185          
The following BLAST results are available for this feature:
BLAST of hypothetical protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI971.200e-94100.00Uncharacterized protein OS=Schmidtea mediterranea ... [more]
A0A4Z2DDY22.738e-2047.57Uncharacterized protein OS=Schistosoma japonicum O... [more]
A0A4S2LXG09.213e-2048.70Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074YY969.613e-2048.70Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A1S8X5J89.631e-2048.70Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of hypothetical protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSAMXT00000022246.22.513e-622.86protein Dok-7-like [Source:NCBI gene;Acc:103025917... [more]
ENSAMXT00000041763.15.293e-622.86protein Dok-7-like [Source:NCBI gene;Acc:103025917... [more]
ENSAMXT00000042615.15.913e-622.86protein Dok-7-like [Source:NCBI gene;Acc:103025917... [more]
ENSAMXT00000039695.16.402e-622.86protein Dok-7-like [Source:NCBI gene;Acc:103025917... [more]
back to top
BLAST of hypothetical protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of hypothetical protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000058269.10.000e+098.97SMESG000058269.1[more]
SMESG000058269.10.000e+098.80SMESG000058269.1[more]
SMESG000047305.19.315e-824.00SMESG000047305.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30016879
GenBankAFJ24751.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016879 ID=SMED30016879|Name=hypothetical protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3794bp
TTTCAAGGTTGACATGTGATTAATCGCCATATTAAATCAAATGCTGTGGA
AAGTATTGTAATTTTTATAATGCCTAGACTAGTTACTTTTCTTGAAGATA
ATGTAAGATATAGAGATGGAAGAAAGTGGAAACAACGATATTGTATGCTA
AATAAATCAGAATCAAAATCAGGTGCCATCACAATGTATATCACAAAACA
ATTCGGAGCTGCTGCACTGAATCAAATCATTGATGATAAGTTAAATAGAC
AATATTTAATCGATGAAATTACTGGTTTTGAATATGGAAGGCATGTTGAC
AAAGAAGGTTCTGTGATGGCCTTAATCGGTCGAAATGTGGTATATTGTAT
TGCATTTTCACAAAATGAGACAATGTTCAGATGGGCAGAAACTTTACACA
AACATTTCAAATGCTCTAATTTTCACGCGACTCTTAAAAAAGTCTCAGAA
ACGAGTGGCCTTTTCAATAAGATATCTACTGGTATTCAAGGTAATTTGCA
CATTCAATCATTACGCATATGTTTGATTGGTGAACCTGCGGATGGCAATA
AATTTATTTGTGAATGGCCAATCTCAACTATCAATTCAATAGATATCTTT
AATACAGATTGTGATAAAGTAAAAGAGTTAGTTATCAAATCAAATTCAAA
ATTAAATAAAAATAAAGGGCATTTTGAATTTGAGATAAGCATAACGCAAA
ATAGCGTTTTTAGAGAGTCAATTGAACCATTTTTAAAGTCTTGTCAGAAT
TCAAATGAAGATTTCAGAACTAACTTTAAAATAAAACGTTATTCTCTTGA
TACTAACAATGATTCTACATCATTCAGTTATTCAATTTTAAATCAAGATA
TAAATTGTAGTAATTCCGACAATAGCAGTAGCTTAGAGAAACGCTCATCA
GAAATACCTATACCGAGATCAAGAGAACATTCAGGACCAGATCAACGACC
AATCGACAATGTTCAAATAAAAATTCGCAAGTCAAATAAAAATTTTGCAA
AAGTCCTCAAAGAAAGCAAAAAACACTTTTCATTGATTGAAACCAATGGA
ATTTTTGATCATAACTCTTGTTTATTTGACGATGATGAGGAAATTGCTGA
TCAATTTGATAACAAATGTCGAAATCCTTTATATAATGGCTTGAGTCAAG
AAAGCAGTGGCGTGTATGTAAATGGTGCCTCAAATAGTTCGAGAGAACCA
AATCTTTCCGCTCGTATTTTAATTCATGATGATAGCGGCTGTGGCAATTT
GTCATCTACCTCAAGTACCCAAAACGATGCTATCAATCTTCCTAATGTTC
TACCTCTATGCCAGAAACCATCTAGTTCCAAAGACAATCCAATTCTAAAT
TTCTATCGGAGTATAGTTCGTAATCCCTTATTGTTAACAAATTACAGAAA
ATACTGTCGATTATTGAAAGCAGTTTCTGATTGTCGAAGTCAGATAATAA
AAAGAAGCAATTCTTTCAATTGTGTTCATTTATGTGATAAATCTCAAATT
GGCTATCACCGTAAACATTCAACTTCAAATTTCCCTCTCAACTTGAACTA
TCAAGTATCAGATCAATATTTCAGCTATTGGAGAAAGAAAATTAATACCA
AATTTTTTGAAACATTTCTTTTTACCGATAACAAAAACGAAGCAAATATT
TTAAAACAGTCTTCTAATCATTTATTATCTCAGAAATTACCATTTAAATC
ACCTAAAGATTTCCATAATTCTATTATCAAATCCATGCAAAATGGCACAG
CATGTCTGTATTTATTTTGCTATCATCACTTTTTAATGCTCCTCAACGAT
CTCAAAGTTATTATAAATAACCTAGAATCAAAACAAAAGCTTGATAATAA
TGTAATGGATGACAATAAATTCAAATTCAATAATAAAAATAAAAATAATA
TCTACAATCGGTGGTTAGAGAAGATTCAGTCGGAATATTGTAAATCATTT
GACGCCGATATTCACTCGCAAAGAGCGTCTATTCTTGACATTAATTTGAT
ATTGATATATGAGATTGCGAATAATATTTTCTATTCAAGGAAGTGTTACT
CAGCTAAACATGGATCATGTGACTCCATTCCAAGACATCCACCCTACTTC
ATGACAAATCCGAAAATCGAGTTAAACAATGACAAATGCCTTCTCAAGCG
TGTCGATGAAAACATTTTTAAACCGTCTTTTAAACAAAGTCCATTGCTTT
TAAGCCCTAGATTAATTATGAGCAGTTCTTCATCGACTCCAGATTTCAGA
TATTACAATCAATCTCATCCTATTCCAAAACAAAGGAAAAAAATCAAAGA
AATAAAATATCAAAATATGTCTGGATTAGACAGTTTTGATACAATGAATC
ATACATTTCCCAAGCAAAACATGTCGCTAAATAAGCCTGATTCCGTTGAA
AGTGGAAGTTTCAAAAAATTTCGAAGAAAATATTCCCCAAGTTTCCTTAT
GCCATTTTTTAATTTTGGGTCCTCGAAATTTTCAAATACAATGTTTACAA
GGCGGAAAACTCCATCAACACATTCAACATTGTCTGAACCAATTTGTCAT
CTGGAAAATAAATACCACAATAATTACTACAATATTGGTCATAAGAAGCA
ATCTTTTACAAAACGAAGTCTTTCTGTAGTTCTCGATAGCAGTTATCCGT
ATGAAGAATCTAAAGAATGTCATAATTATATAAATATTCAGAACAATAAA
GGTCTCATGTATAAACCAGATGTTGATCCCAACAATTATATTTGTAGCGG
CCCAAGCTCCATATTTGACGACAATTCATATCCTGAAGAAATACTAGATC
CTAGTATAAATTATGGAGATTTGCATTTTATTAAATCCAACTGTTCAAAA
ACGAAATATCGACAAGATCCATATAATCACAATAATTCACTAAATTATAG
ACGGGCCAGCCTTTCACTTTTATCTAATAAAAGCCTGCAAAATTTTTCTA
CGTCACGTCCAACATCACTTAAAAAGCACGGATACTCTAATATAAATCAG
CTATATTCTGAAATGCCCAATAATAGTGTCAACGCAAGCATGTCAGACTA
CGTCAATGGCAATATAGTCAAGAGTTCTTCCCCTCAGTCAACACAATCAT
GTTCACCTGGGTCGATAATGTCCTATCAAAAAACCGTTCCACGGTCACTC
AATTACATCACAGTTATGGAAAATAATTGTTCAAGTCCATTGTCAATTTA
TCCTCCATCTGAGTGTTCTTATCTCGAACCAGACACTAACGAATCATTCA
GAAAAATTAAATCTCATAATTTCAAGCACAATTTAACGACTCCTCAGTCT
TCTCCGGTTGTCGATTATTGTCAAATAGACCTCAATTGTACTTATGCTCT
CAAAGCGATTGATCATTTGTTGTATCATGACAAAATTAAATATCGTGACA
AAGACTCAATTTTAAAGAGCGGATCACCCGAAGATGTTGAATCCTGTATG
AATTTCGATCAATCCGAAAACTTTTCTATTTCCTCATTTAATAGAGAAAG
AAAAAATAAAATGTCTACGAATAAAAAAGTTTTTCGTCGATTATTTTCCC
GTAAAGCAGAATCGACTAATTAAAATTGATTTTTATTTCAGGAAGCATTT
TTATTGAACGTGTTTGGAAACGAAAAGAAATATTCTCAGATTTATAAATT
CAGCTATTTACATTAACTTCTCAAAGAATGTCTAAATGATTTTTCCCCTT
GTAATTCTGTACATATATGTTTATTTATTATCTTCAAACTATTTGATTTT
ATTTAGAGGTACTACTTTCTGTAGAGTTAATTGTTATTTTTTAT
back to top

protein sequence of SMED30016879-orf-1

>SMED30016879-orf-1 ID=SMED30016879-orf-1|Name=SMED30016879-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1168bp
MPRLVTFLEDNVRYRDGRKWKQRYCMLNKSESKSGAITMYITKQFGAAAL
NQIIDDKLNRQYLIDEITGFEYGRHVDKEGSVMALIGRNVVYCIAFSQNE
TMFRWAETLHKHFKCSNFHATLKKVSETSGLFNKISTGIQGNLHIQSLRI
CLIGEPADGNKFICEWPISTINSIDIFNTDCDKVKELVIKSNSKLNKNKG
HFEFEISITQNSVFRESIEPFLKSCQNSNEDFRTNFKIKRYSLDTNNDST
SFSYSILNQDINCSNSDNSSSLEKRSSEIPIPRSREHSGPDQRPIDNVQI
KIRKSNKNFAKVLKESKKHFSLIETNGIFDHNSCLFDDDEEIADQFDNKC
RNPLYNGLSQESSGVYVNGASNSSREPNLSARILIHDDSGCGNLSSTSST
QNDAINLPNVLPLCQKPSSSKDNPILNFYRSIVRNPLLLTNYRKYCRLLK
AVSDCRSQIIKRSNSFNCVHLCDKSQIGYHRKHSTSNFPLNLNYQVSDQY
FSYWRKKINTKFFETFLFTDNKNEANILKQSSNHLLSQKLPFKSPKDFHN
SIIKSMQNGTACLYLFCYHHFLMLLNDLKVIINNLESKQKLDNNVMDDNK
FKFNNKNKNNIYNRWLEKIQSEYCKSFDADIHSQRASILDINLILIYEIA
NNIFYSRKCYSAKHGSCDSIPRHPPYFMTNPKIELNNDKCLLKRVDENIF
KPSFKQSPLLLSPRLIMSSSSSTPDFRYYNQSHPIPKQRKKIKEIKYQNM
SGLDSFDTMNHTFPKQNMSLNKPDSVESGSFKKFRRKYSPSFLMPFFNFG
SSKFSNTMFTRRKTPSTHSTLSEPICHLENKYHNNYYNIGHKKQSFTKRS
LSVVLDSSYPYEESKECHNYINIQNNKGLMYKPDVDPNNYICSGPSSIFD
DNSYPEEILDPSINYGDLHFIKSNCSKTKYRQDPYNHNNSLNYRRASLSL
LSNKSLQNFSTSRPTSLKKHGYSNINQLYSEMPNNSVNASMSDYVNGNIV
KSSSPQSTQSCSPGSIMSYQKTVPRSLNYITVMENNCSSPLSIYPPSECS
YLEPDTNESFRKIKSHNFKHNLTTPQSSPVVDYCQIDLNCTYALKAIDHL
LYHDKIKYRDKDSILKSGSPEDVESCMNFDQSENFSISSFNRERKNKMST
NKKVFRRLFSRKAESTN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0019901protein kinase binding
GO:0005158insulin receptor binding
Vocabulary: biological process
TermDefinition
GO:0061098positive regulation of protein tyrosine kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011993PH-like_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 5..113
e-value: 5.9E-15
score: 57.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 267..295
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 278..295