Major facilitator superfamily domain-containing protein 8

Overview
NameMajor facilitator superfamily domain-containing protein 8
Smed IDSMED30016864
Length (bp)2617
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Major facilitator superfamily domain-containing protein 8 (SMED30016864) t-SNE clustered cells

Violin plots show distribution of expression levels for Major facilitator superfamily domain-containing protein 8 (SMED30016864) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016864

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30016864h1SMcG0010330 dd_Smed_v4_26230_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30016864h1SMcG0010330 dd_Smed_v6_26230_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Human
Match: MFSD8 (major facilitator superfamily domain containing 8 [Source:HGNC Symbol;Acc:HGNC:28486])

HSP 1 Score: 116.701 bits (291), Expect = 1.170e-28
Identity = 72/182 (39.56%), Postives = 108/182 (59.34%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQY-FALNMFTAAGFMGA 745
            S+R+L+LTMFLSSVGFS+ + SIWPYL+ +D       LG V+A +S+GQ+    IFGL  N     ++PLI SI      N  Y+YL     + K +++++R ++G G+GNVA+ R++    +  +E+T+ +A +S  Q LGFI GP  QT F  LG  G   +     +NM+T    + A
Sbjct:   38 SIRILYLTMFLSSVGFSVVMMSIWPYLQKIDPTADTSFLGWVIASYSLGQMVASPIFGLWSN-YRPRKEPLIVSILISVAANCLYAYLHIPASHNKYYMLVARGLLGIGAGNVAVVRSYTAGATSLQERTSSMANISMCQALGFILGPVFQTCFTFLGEKGVTWDVIKLQINMYTTPVLLSA 218          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Human
Match: MFSD8 (major facilitator superfamily domain containing 8 [Source:HGNC Symbol;Acc:HGNC:28486])

HSP 1 Score: 116.701 bits (291), Expect = 1.170e-28
Identity = 72/182 (39.56%), Postives = 108/182 (59.34%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQY-FALNMFTAAGFMGA 745
            S+R+L+LTMFLSSVGFS+ + SIWPYL+ +D       LG V+A +S+GQ+    IFGL  N     ++PLI SI      N  Y+YL     + K +++++R ++G G+GNVA+ R++    +  +E+T+ +A +S  Q LGFI GP  QT F  LG  G   +     +NM+T    + A
Sbjct:   38 SIRILYLTMFLSSVGFSVVMMSIWPYLQKIDPTADTSFLGWVIASYSLGQMVASPIFGLWSN-YRPRKEPLIVSILISVAANCLYAYLHIPASHNKYYMLVARGLLGIGAGNVAVVRSYTAGATSLQERTSSMANISMCQALGFILGPVFQTCFTFLGEKGVTWDVIKLQINMYTTPVLLSA 218          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Human
Match: MFSD8 (major facilitator superfamily domain containing 8 [Source:HGNC Symbol;Acc:HGNC:28486])

HSP 1 Score: 116.701 bits (291), Expect = 1.170e-28
Identity = 72/182 (39.56%), Postives = 108/182 (59.34%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQY-FALNMFTAAGFMGA 745
            S+R+L+LTMFLSSVGFS+ + SIWPYL+ +D       LG V+A +S+GQ+    IFGL  N     ++PLI SI      N  Y+YL     + K +++++R ++G G+GNVA+ R++    +  +E+T+ +A +S  Q LGFI GP  QT F  LG  G   +     +NM+T    + A
Sbjct:   38 SIRILYLTMFLSSVGFSVVMMSIWPYLQKIDPTADTSFLGWVIASYSLGQMVASPIFGLWSN-YRPRKEPLIVSILISVAANCLYAYLHIPASHNKYYMLVARGLLGIGAGNVAVVRSYTAGATSLQERTSSMANISMCQALGFILGPVFQTCFTFLGEKGVTWDVIKLQINMYTTPVLLSA 218          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Human
Match: MFSD8 (major facilitator superfamily domain containing 8 [Source:HGNC Symbol;Acc:HGNC:28486])

HSP 1 Score: 116.316 bits (290), Expect = 1.510e-28
Identity = 72/182 (39.56%), Postives = 108/182 (59.34%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQY-FALNMFTAAGFMGA 745
            S+R+L+LTMFLSSVGFS+ + SIWPYL+ +D       LG V+A +S+GQ+    IFGL  N     ++PLI SI      N  Y+YL     + K +++++R ++G G+GNVA+ R++    +  +E+T+ +A +S  Q LGFI GP  QT F  LG  G   +     +NM+T    + A
Sbjct:   38 SIRILYLTMFLSSVGFSVVMMSIWPYLQKIDPTADTSFLGWVIASYSLGQMVASPIFGLWSNY-RPRKEPLIVSILISVAANCLYAYLHIPASHNKYYMLVARGLLGIGAGNVAVVRSYTAGATSLQERTSSMANISMCQALGFILGPVFQTCFTFLGEKGVTWDVIKLQINMYTTPVLLSA 218          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Human
Match: MFSD8 (major facilitator superfamily domain containing 8 [Source:HGNC Symbol;Acc:HGNC:28486])

HSP 1 Score: 117.472 bits (293), Expect = 1.571e-28
Identity = 72/182 (39.56%), Postives = 108/182 (59.34%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQY-FALNMFTAAGFMGA 745
            S+R+L+LTMFLSSVGFS+ + SIWPYL+ +D       LG V+A +S+GQ+    IFGL  N     ++PLI SI      N  Y+YL     + K +++++R ++G G+GNVA+ R++    +  +E+T+ +A +S  Q LGFI GP  QT F  LG  G   +     +NM+T    + A
Sbjct:   38 SIRILYLTMFLSSVGFSVVMMSIWPYLQKIDPTADTSFLGWVIASYSLGQMVASPIFGLWSNY-RPRKEPLIVSILISVAANCLYAYLHIPASHNKYYMLVARGLLGIGAGNVAVVRSYTAGATSLQERTSSMANISMCQALGFILGPVFQTCFTFLGEKGVTWDVIKLQINMYTTPVLLSA 218          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Celegans
Match: Y53G8AR.7 (pep chromosome:WBcel235:III:3282308:3290215:1 gene:WBGene00021814.1 transcript:Y53G8AR.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y53G8AR.7)

HSP 1 Score: 96.6709 bits (239), Expect = 1.331e-20
Identity = 55/210 (26.19%), Postives = 114/210 (54.29%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLIL-SRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRSPYAKYANTDE 829
            S+ +L        + FSI  P++WP+L  +D   +    G + A FS+GQ     +FG  +N+ +S R+PL+  I+ M   N+ + ++  F +  + ++++ +RF +G G+G + + R +    S  +++   +  + A   +G   GP IQ +F P+GYPG +++  F ++M+T+  +  +I S+++++ + I+  +      YA  D+
Sbjct:   47 SIYLLTAIGMFCGIQFSIFFPTLWPFLNTVDPTASASFFGFITAAFSVGQGLASPVFGYWMNKAKSVRQPLVFGISVMILSNIIFCFVEAFAEKERRWVMMVARFFIGVGAGTIGVMRAYAATASSLKDRARAITFIQASYVIGMTLGPGIQVAFTPIGYPG-LSKGVFHVDMYTSPAWFASIISLLSVIFIFIFLEE-----NYAGLDQ 250          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Celegans
Match: ZK550.2 (pep chromosome:WBcel235:IV:17245584:17249750:1 gene:WBGene00013996.1 transcript:ZK550.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK550.2)

HSP 1 Score: 87.8113 bits (216), Expect = 8.512e-18
Identity = 56/186 (30.11%), Postives = 94/186 (50.54%), Query Frame = 2
Query:  230 FLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYF 787
            F+  V  S+   S+WPYL  LD       LG VVA  ++G      ++GL   +  S + P +        G + Y  ++  +QYGK +++++R + G G GN+A  R +    S P+++   ++  +A    G  FGP I   F PLG  G  N     +NM+T+A ++ A   ++  VL+L++F
Sbjct:   46 FVVGVQISVYYMSMWPYLSGLDKTADMDFLGWVVAACNMGCTITNPLYGLWNQKTLSCKWPTVTGFLIAAVGQVMYGAISEVEQYGKWYMLVARVVTGLGVGNLAALRAYGATASTPKDRLKAISYGTAGFVFGISFGPAISAFFTPLGETG-FNIWIVKINMYTSAAYLMAFICVLAAVLMLVFF 230          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Celegans
Match: W05E10.1 (pep chromosome:WBcel235:V:11689413:11691691:-1 gene:WBGene00012280.1 transcript:W05E10.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W05E10.1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.949e-17
Identity = 64/200 (32.00%), Postives = 103/200 (51.50%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYF 787
            + N  S+    L  +   +  S+   S+WPYL  LD        GI++A FSIGQ  G  IFG    + ESF+ P+   + F   GN+ Y  L       +  +++SR ++GFG+GN++  R +V A S  E++   V+L +  Q  G + GP +QT+F  +G  G      F L+ +T+  F+ +I  I+  V++  YF
Sbjct:   28 KSNWTSLWFANLIQYFCGLQMSLYFTSMWPYLLKLDPTAQLPFFGIILASFSIGQAVGSPIFGTWTQKTESFKVPVATGLVFCCVGNILYGILPTIMWEVQWLMLVSRVLIGFGAGNLSALRAYVAASSTLEDRNTAVSLATGSQVTGMLTGPILQTAFAFIG-DGVRVFNTFDLDAYTSPAFVLSIVLIIMAVMIFFYF 226          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Celegans
Match: F27D9.2 (pep chromosome:WBcel235:X:7672993:7676312:1 gene:WBGene00017861.1 transcript:F27D9.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F27D9.2)

HSP 1 Score: 82.4185 bits (202), Expect = 3.967e-16
Identity = 66/229 (28.82%), Postives = 117/229 (51.09%), Query Frame = 2
Query:  230 FLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRS--PYAKYANTDEINVEAAILKKLLEKSRFGELSRTVMTR 910
            F+ +  F+I   S++PY+  L+  VT+ S GIVVA++S+ Q     +FG   N++   R PLI     M FGN+ Y  L          ++L+R I G G+GN+++ R + +  S  ++++  +A +S    LG + GP +Q  F PLG  G +N     ++++T+      I ++  ++++ + F ++    + K    DE N E  I  K L    F  +   ++TR
Sbjct:   50 FIQATQFAIFFTSMYPYILTLEHNVTQTSFGIVVAMYSVSQAIFSPVFGFWSNRIGQVRFPLIVGFIVMAFGNITYLSLQYLSSNHLYVMMLARLIAGGGTGNMSLLRAYASTASTSKDRSRAIACVSGGIALGTMMGPGLQLLFSPLGENG-INILGLNISIYTSPALFCLILNVTGLLIVKLAFVEKYIINHGKNIVQDEENGEKKI--KKLASPDFIAILLCIITR 275          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Celegans
Match: T28C12.1 (pep chromosome:WBcel235:V:6331907:6334008:1 gene:WBGene00020888.1 transcript:T28C12.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T28C12.1)

HSP 1 Score: 79.7221 bits (195), Expect = 3.093e-15
Identity = 63/207 (30.43%), Postives = 99/207 (47.83%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRSPYA 808
            R +  S+ +  +  F+  V  S+   S+WPYL  LD       LG VVA  SIG      I+G    +  S + P+I        G L+Y+ L  F    K F++ +RF+ G G GN+A  R +    S P+++   ++  +    LGF FGP I + F PLG  G +    F LNM+T   ++  +  +     L++Y + +  YA
Sbjct:   15 RTDWRSMWIAIVMQFVVGVQISVYYMSMWPYLSGLDKTADFDFLGWVVASCSIGCTIANPIYGYWNQKTMSVKWPVITGFLIAAVGQLWYALLGFFGNV-KWFMLCARFLTGLGVGNIAALRVYAAMASTPKDRMRAISFGTGGFVLGFSFGPVISSIFTPLGEEG-IQFGGFILNMYTIVSYLMVLICLS--ACLVVYLFFKESYA 217          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Fly
Match: Cln7 (gene:FBgn0035767 transcript:FBtr0332732)

HSP 1 Score: 110.153 bits (274), Expect = 1.140e-24
Identity = 75/200 (37.50%), Postives = 120/200 (60.00%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAV---NEQYFALNMFTAAGFMGAITSIVNIVLLL 778
            ++   SVR+++ TMFL ++GFSI L  IWPYL  LD    K+ +G++VA   +GQ+    IFG   N+L   R PL+ S++     +  YS L       K +++ SRF++G  S N+A+ R++++A ++  E+T  VA++S  Q LGFI GP +Q +  PLG  G V    + +F  NM+TA+G++  + SI N ++ L
Sbjct:   31 KQRWRSVRIIYFTMFLMALGFSIILTGIWPYLNKLDPDAGKEFMGLIVAANPLGQMIFSPIFGWWGNKLGKIRLPLLLSLSLFTLASGIYSSLELRPDNVKYWMLSSRFLIGVSSANIALCRSYLSAATRISERTHAVAMVSLAQVLGFIIGPTLQAAVTPLGDQGHVWLWGKMHF--NMYTASGWINVLMSIGNFMMFL 228          

HSP 2 Score: 68.1662 bits (165), Expect = 1.875e-11
Identity = 33/78 (42.31%), Postives = 46/78 (58.97%), Query Frame = 2
Query: 2267 GCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVY 2500
            GCP T++ WC    ALT+   +I     ++GY I   +   +FS  LGP  Q +WMG+ T  G LSR++GP FV S+Y
Sbjct:  380 GCPTTQK-WCGELPALTLTQFIIGFAFTSIGYPIGVTLIQTIFSKVLGPRPQGVWMGWMTGSGCLSRVLGPVFVGSIY 456          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Fly
Match: Cln7 (gene:FBgn0035767 transcript:FBtr0332733)

HSP 1 Score: 110.153 bits (274), Expect = 1.140e-24
Identity = 75/200 (37.50%), Postives = 120/200 (60.00%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAV---NEQYFALNMFTAAGFMGAITSIVNIVLLL 778
            ++   SVR+++ TMFL ++GFSI L  IWPYL  LD    K+ +G++VA   +GQ+    IFG   N+L   R PL+ S++     +  YS L       K +++ SRF++G  S N+A+ R++++A ++  E+T  VA++S  Q LGFI GP +Q +  PLG  G V    + +F  NM+TA+G++  + SI N ++ L
Sbjct:   31 KQRWRSVRIIYFTMFLMALGFSIILTGIWPYLNKLDPDAGKEFMGLIVAANPLGQMIFSPIFGWWGNKLGKIRLPLLLSLSLFTLASGIYSSLELRPDNVKYWMLSSRFLIGVSSANIALCRSYLSAATRISERTHAVAMVSLAQVLGFIIGPTLQAAVTPLGDQGHVWLWGKMHF--NMYTASGWINVLMSIGNFMMFL 228          

HSP 2 Score: 68.1662 bits (165), Expect = 1.875e-11
Identity = 33/78 (42.31%), Postives = 46/78 (58.97%), Query Frame = 2
Query: 2267 GCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVY 2500
            GCP T++ WC    ALT+   +I     ++GY I   +   +FS  LGP  Q +WMG+ T  G LSR++GP FV S+Y
Sbjct:  380 GCPTTQK-WCGELPALTLTQFIIGFAFTSIGYPIGVTLIQTIFSKVLGPRPQGVWMGWMTGSGCLSRVLGPVFVGSIY 456          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Fly
Match: Cln7 (gene:FBgn0035767 transcript:FBtr0076881)

HSP 1 Score: 110.153 bits (274), Expect = 1.140e-24
Identity = 75/200 (37.50%), Postives = 120/200 (60.00%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAV---NEQYFALNMFTAAGFMGAITSIVNIVLLL 778
            ++   SVR+++ TMFL ++GFSI L  IWPYL  LD    K+ +G++VA   +GQ+    IFG   N+L   R PL+ S++     +  YS L       K +++ SRF++G  S N+A+ R++++A ++  E+T  VA++S  Q LGFI GP +Q +  PLG  G V    + +F  NM+TA+G++  + SI N ++ L
Sbjct:   31 KQRWRSVRIIYFTMFLMALGFSIILTGIWPYLNKLDPDAGKEFMGLIVAANPLGQMIFSPIFGWWGNKLGKIRLPLLLSLSLFTLASGIYSSLELRPDNVKYWMLSSRFLIGVSSANIALCRSYLSAATRISERTHAVAMVSLAQVLGFIIGPTLQAAVTPLGDQGHVWLWGKMHF--NMYTASGWINVLMSIGNFMMFL 228          

HSP 2 Score: 68.1662 bits (165), Expect = 1.875e-11
Identity = 33/78 (42.31%), Postives = 46/78 (58.97%), Query Frame = 2
Query: 2267 GCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVY 2500
            GCP T++ WC    ALT+   +I     ++GY I   +   +FS  LGP  Q +WMG+ T  G LSR++GP FV S+Y
Sbjct:  380 GCPTTQK-WCGELPALTLTQFIIGFAFTSIGYPIGVTLIQTIFSKVLGPRPQGVWMGWMTGSGCLSRVLGPVFVGSIY 456          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Zebrafish
Match: mfsd8 (major facilitator superfamily domain containing 8 [Source:NCBI gene;Acc:564342])

HSP 1 Score: 129.028 bits (323), Expect = 6.846e-31
Identity = 80/205 (39.02%), Postives = 122/205 (59.51%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPG-AVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRS 799
            R    S+RV++ TMFLSSVGF+I + SIWPYLK +D       LG VVA +S+GQ+     FGL  N     R+PL+ SI      N++YSY+     + +  ++L+R  VG G+GNVA+ R++V   +  +E+T+ +A MSA Q LGFI GP +Q     +G  G +V+     +NM+TA   + A   ++NI+L+++   + S
Sbjct:   25 RSRWRSIRVMYFTMFLSSVGFTIVITSIWPYLKKIDESADASFLGWVVAAYSLGQMVASPFFGLWSNH-RPRREPLVCSIFINVSANIYYSYVYLPPSHNQIHMLLARTFVGIGAGNVAVVRSYVAGATSLKERTSAMANMSACQALGFILGPALQAVLSFIGETGVSVDVIKLQVNMYTAPALLAACFGVINILLVILVLREHS 228          

HSP 2 Score: 76.2554 bits (186), Expect = 7.305e-14
Identity = 71/253 (28.06%), Postives = 119/253 (47.04%), Query Frame = 2
Query: 1907 ENEVVCCPQQPGKVDFLGITIXXXXXXXXXXXXXXXETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGK--------------PPI-----PKTNGT---TGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKGLPXXXXXXXXXXXXXXXXXXXXYNRIVSF 2599
            E  V   P+  G +D + +     + F  + +F+  ETI TP+ MD FA+    A L   + LA+ G   I +++ +   + R  +R  ++ G I   +  F+L+P   +              PPI     P +N +    GCP +EQ WC  T  + +   + S     +GY  C+V++  L+S  LGP  Q ++MG+ TA GS +R +GP FV+  Y   G    F  +    +  + ++   Y R+V+F
Sbjct:  244 EERVDVPPEVEGDIDHIAVFTSNVLFFIILFIFAVFETISTPLSMDMFAWTRKEAVLYNGIILAAIGFESILVFLVVKVVSARVGDRPLLLGGLILIFVGFFMLLPWGNQYPKIQWTDINNNTIPPIQLAPTPASNSSLEPIGCP-SEQTWCLFTPVIHLAQYITSDILIGVGYPTCNVMSYTLYSKILGPKPQGVYMGWLTASGSGARTLGPVFVSHFYTILGPRWAFSAICGIVLAAIVMLSAMYKRLVAF 495          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Zebrafish
Match: mfsd8 (major facilitator superfamily domain containing 8 [Source:NCBI gene;Acc:564342])

HSP 1 Score: 129.028 bits (323), Expect = 6.846e-31
Identity = 80/205 (39.02%), Postives = 122/205 (59.51%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPG-AVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRS 799
            R    S+RV++ TMFLSSVGF+I + SIWPYLK +D       LG VVA +S+GQ+     FGL  N     R+PL+ SI      N++YSY+     + +  ++L+R  VG G+GNVA+ R++V   +  +E+T+ +A MSA Q LGFI GP +Q     +G  G +V+     +NM+TA   + A   ++NI+L+++   + S
Sbjct:   25 RSRWRSIRVMYFTMFLSSVGFTIVITSIWPYLKKIDESADASFLGWVVAAYSLGQMVASPFFGLWSNH-RPRREPLVCSIFINVSANIYYSYVYLPPSHNQIHMLLARTFVGIGAGNVAVVRSYVAGATSLKERTSAMANMSACQALGFILGPALQAVLSFIGETGVSVDVIKLQVNMYTAPALLAACFGVINILLVILVLREHS 228          

HSP 2 Score: 76.2554 bits (186), Expect = 7.305e-14
Identity = 71/253 (28.06%), Postives = 119/253 (47.04%), Query Frame = 2
Query: 1907 ENEVVCCPQQPGKVDFLGITIXXXXXXXXXXXXXXXETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGK--------------PPI-----PKTNGT---TGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKGLPXXXXXXXXXXXXXXXXXXXXYNRIVSF 2599
            E  V   P+  G +D + +     + F  + +F+  ETI TP+ MD FA+    A L   + LA+ G   I +++ +   + R  +R  ++ G I   +  F+L+P   +              PPI     P +N +    GCP +EQ WC  T  + +   + S     +GY  C+V++  L+S  LGP  Q ++MG+ TA GS +R +GP FV+  Y   G    F  +    +  + ++   Y R+V+F
Sbjct:  244 EERVDVPPEVEGDIDHIAVFTSNVLFFIILFIFAVFETISTPLSMDMFAWTRKEAVLYNGIILAAIGFESILVFLVVKVVSARVGDRPLLLGGLILIFVGFFMLLPWGNQYPKIQWTDINNNTIPPIQLAPTPASNSSLEPIGCP-SEQTWCLFTPVIHLAQYITSDILIGVGYPTCNVMSYTLYSKILGPKPQGVYMGWLTASGSGARTLGPVFVSHFYTILGPRWAFSAICGIVLAAIVMLSAMYKRLVAF 495          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Xenopus
Match: MFSD8 (major facilitator superfamily domain containing 8 [Source:NCBI gene;Acc:100495784])

HSP 1 Score: 144.05 bits (362), Expect = 4.630e-36
Identity = 84/199 (42.21%), Postives = 122/199 (61.31%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGA-VNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDR 796
            S+RV++LTMFLSSVGFSI + SIWPYL+ +D       LG V+A FS+GQ+    +FGL  N     R+PL+ SIT +   +  Y+Y+     + K +++L+R +VGFGSGNVA+ R++V   +   E+T  +A +SAFQ +GFI GP  Q     +G  G  +   Y  +NM+TA   MGA+  I NI+L+   F + 
Sbjct:   36 SIRVMYLTMFLSSVGFSIVMTSIWPYLQKVDQSADASFLGWVIASFSLGQMVASPLFGLWSNH-RPRREPLVVSITILVAASCLYAYVQVPASHNKYYMLLARTLVGFGSGNVAVVRSYVAGATSLSERTGAMANISAFQAIGFILGPAFQAGLSMIGENGVTIGAIYLQVNMYTAPALMGALLGIGNIILIFAVFREH 233          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Xenopus
Match: MFSD8 (major facilitator superfamily domain containing 8 [Source:NCBI gene;Acc:100495784])

HSP 1 Score: 144.821 bits (364), Expect = 5.387e-36
Identity = 90/232 (38.79%), Postives = 135/232 (58.19%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGA-VNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRSPYAKYANTDEINVEAAILKKLLEKSRFGELSR 895
            S+RV++LTMFLSSVGFSI + SIWPYL+ +D       LG V+A FS+GQ+    +FGL  N     R+PL+ SIT +   +  Y+Y+     + K +++L+R +VGFGSGNVA+ R++V   +   E+T  +A +SAFQ +GFI GP  Q     +G  G  +   Y  +NM+TA   MGA+  I NI+L+   F +        +   IN E+ +    +EK+  G + +
Sbjct:   36 SIRVMYLTMFLSSVGFSIVMTSIWPYLQKVDQSADASFLGWVIASFSLGQMVASPLFGLWSNH-RPRREPLVVSITILVAASCLYAYVQVPASHNKYYMLLARTLVGFGSGNVAVVRSYVAGATSLSERTGAMANISAFQAIGFILGPAFQAGLSMIGENGVTIGAIYLQVNMYTAPALMGALLGIGNIILIFAVFREHRVDDLGIHVSSINSESEVTD--VEKANEGSIDQ 264          

HSP 2 Score: 82.4185 bits (202), Expect = 1.212e-15
Identity = 61/191 (31.94%), Postives = 93/191 (48.69%), Query Frame = 2
Query: 2015 ETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGK-PPIPKT---NGT---------------------TGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKG 2512
            ETI TP+ MD +A+  T A     + LA+ G+  + +++ +   +K+   RV ++ G +      FVL+P   + P I  T   N T                     TGCPV  Q WC  T  + +   L S     +GY IC+V++  L+S  +GP  Q L+MG+ TA GS +R +GP FV+ +Y   G
Sbjct:  285 ETISTPLTMDMYAWTRTQAVFYNGIILAAVGVESVIVFLAVKILSKKTGERVLLLGGLVIIWFGFFVLLPWGNQLPEIQFTELQNATIHNTTHWTSSITFSGNHTVEPTGCPVV-QTWCLYTPIIHLGQYLTSDILIGVGYPICNVMSYTLYSKIIGPKPQGLYMGWLTAAGSAARTLGPVFVSQIYTHLG 474          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Xenopus
Match: MFSD8 (major facilitator superfamily domain containing 8 [Source:NCBI gene;Acc:100495784])

HSP 1 Score: 121.324 bits (303), Expect = 1.903e-28
Identity = 81/226 (35.84%), Postives = 124/226 (54.87%), Query Frame = 2
Query:  221 LTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGA-VNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRSPYAKYANTDEINVEAAILKKLLEKSRFGELSR 895
            L  F +  GFSI + SIWPYL+ +D       LG V+A FS+GQ+    +FGL  N     R+PL+ SIT +   +  Y+Y+     + K +++L+R +VGFGSGNVA+ R++V   +   E+T  +A +SAFQ +GFI GP  Q     +G  G  +   Y  +NM+TA   MGA+  I NI+L+   F +        +   IN E+ +    +EK+  G + +
Sbjct:    5 LICFCTFSGFSIVMTSIWPYLQKVDQSADASFLGWVIASFSLGQMVASPLFGLWSNH-RPRREPLVVSITILVAASCLYAYVQVPASHNKYYMLLARTLVGFGSGNVAVVRSYVAGATSLSERTGAMANISAFQAIGFILGPAFQAGLSMIGENGVTIGAIYLQVNMYTAPALMGALLGIGNIILIFAVFREHRVDDLGIHVSSINSESEVTD--VEKANEGSIDQ 227          

HSP 2 Score: 87.8113 bits (216), Expect = 1.933e-17
Identity = 61/182 (33.52%), Postives = 93/182 (51.10%), Query Frame = 2
Query: 2015 ETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPM---------VGK----PP---IPKTNGTTGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKG 2512
            ETI TP+ MD +A+  T A     + LA+ G+  + +++ +   +K+   RV ++ G +      FVL+P           GK    PP   +P     TGCPV  Q WC  T  + +   L S     +GY IC+V++  L+S  +GP  Q L+MG+ TA GS +R +GP FV+ +Y   G
Sbjct:  248 ETISTPLTMDMYAWTRTQAVFYNGIILAAVGVESVIVFLAVKILSKKTGERVLLLGGLVIIWFGFFVLLPWGNQLPEIQFTGKYYKTPPFTTLPTGPQPTGCPVV-QTWCLYTPIIHLGQYLTSDILIGVGYPICNVMSYTLYSKIIGPKPQGLYMGWLTAAGSAARTLGPVFVSQIYTHLG 428          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Xenopus
Match: MFSD8 (major facilitator superfamily domain containing 8 [Source:NCBI gene;Acc:100495784])

HSP 1 Score: 119.013 bits (297), Expect = 8.014e-28
Identity = 68/148 (45.95%), Postives = 98/148 (66.22%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGP 646
            S+RV++LTMFLSSVGFSI + SIWPYL+ +D       LG V+A FS+GQ+    +FGL  N     R+PL+ SIT +   +  Y+Y+     + K +++L+R +VGFGSGNVA+ R++V   +   E+T  +A +SAFQ +GFI GP
Sbjct:   36 SIRVMYLTMFLSSVGFSIVMTSIWPYLQKVDQSADASFLGWVIASFSLGQMVASPLFGLWSNH-RPRREPLVVSITILVAASCLYAYVQVPASHNKYYMLLARTLVGFGSGNVAVVRSYVAGATSLSERTGAMANISAFQAIGFILGP 182          

HSP 2 Score: 81.2629 bits (199), Expect = 2.069e-15
Identity = 61/191 (31.94%), Postives = 93/191 (48.69%), Query Frame = 2
Query: 2015 ETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGK-PPIPKT---NGT---------------------TGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKG 2512
            ETI TP+ MD +A+  T A     + LA+ G+  + +++ +   +K+   RV ++ G +      FVL+P   + P I  T   N T                     TGCPV  Q WC  T  + +   L S     +GY IC+V++  L+S  +GP  Q L+MG+ TA GS +R +GP FV+ +Y   G
Sbjct:  217 ETISTPLTMDMYAWTRTQAVFYNGIILAAVGVESVIVFLAVKILSKKTGERVLLLGGLVIIWFGFFVLLPWGNQLPEIQFTELQNATIHNTTHWTSSITFSGNHTVEPTGCPVV-QTWCLYTPIIHLGQYLTSDILIGVGYPICNVMSYTLYSKIIGPKPQGLYMGWLTAAGSAARTLGPVFVSQIYTHLG 406          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Xenopus
Match: MFSD8 (major facilitator superfamily domain containing 8 [Source:NCBI gene;Acc:100495784])

HSP 1 Score: 117.087 bits (292), Expect = 9.140e-27
Identity = 85/236 (36.02%), Postives = 129/236 (54.66%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVG----FSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGA-VNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRSPYAKYANTDEINVEAAILKKLLEKSRFGELSR 895
            S+RV++LTMFLSSVG     S TL  I     ++D       LG V+A FS+GQ+    +FGL  N     R+PL+ SIT +   +  Y+Y+     + K +++L+R +VGFGSGNVA+ R++V   +   E+T  +A +SAFQ +GFI GP  Q     +G  G  +   Y  +NM+TA   MGA+  I NI+L+   F +        +   IN E+ +    +EK+  G + +
Sbjct:   36 SIRVMYLTMFLSSVGELSRTSSTLEMI-----MVDQSADASFLGWVIASFSLGQMVASPLFGLWSNH-RPRREPLVVSITILVAASCLYAYVQVPASHNKYYMLLARTLVGFGSGNVAVVRSYVAGATSLSERTGAMANISAFQAIGFILGPAFQAGLSMIGENGVTIGAIYLQVNMYTAPALMGALLGIGNIILIFAVFREHRVDDLGIHVSSINSESEVTD--VEKANEGSIDQ 263          

HSP 2 Score: 82.4185 bits (202), Expect = 1.077e-15
Identity = 61/191 (31.94%), Postives = 93/191 (48.69%), Query Frame = 2
Query: 2015 ETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGK-PPIPKT---NGT---------------------TGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKG 2512
            ETI TP+ MD +A+  T A     + LA+ G+  + +++ +   +K+   RV ++ G +      FVL+P   + P I  T   N T                     TGCPV  Q WC  T  + +   L S     +GY IC+V++  L+S  +GP  Q L+MG+ TA GS +R +GP FV+ +Y   G
Sbjct:  284 ETISTPLTMDMYAWTRTQAVFYNGIILAAVGVESVIVFLAVKILSKKTGERVLLLGGLVIIWFGFFVLLPWGNQLPEIQFTELQNATIHNTTHWTSSITFSGNHTVEPTGCPVV-QTWCLYTPIIHLGQYLTSDILIGVGYPICNVMSYTLYSKIIGPKPQGLYMGWLTAAGSAARTLGPVFVSQIYTHLG 473          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Mouse
Match: Mfsd8 (major facilitator superfamily domain containing 8 [Source:MGI Symbol;Acc:MGI:1919425])

HSP 1 Score: 120.168 bits (300), Expect = 7.162e-28
Identity = 74/182 (40.66%), Postives = 110/182 (60.44%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQY-FALNMFTAAGFMGA 745
            SVR+L+LTMFLSSVGFSI + SIWPYL+ +D       LG V+A +S+GQ+    +FGL  N     ++PLI SI+     N  Y+Y+     + K +++++R +VGFG+GNVA+ R+++   +  +E+T  +A  S  Q LGFI GP  QT F  +G  G   +     +NM+TA   + A
Sbjct:   39 SVRILYLTMFLSSVGFSIVIMSIWPYLQKIDQTADASFLGWVIASYSLGQMVASPLFGLWSN-YRPRKEPLIVSISISVAANCLYAYVHVPAAHNKYYMLIARGLVGFGAGNVAVVRSYIAGATSLQERTNAMANTSTCQALGFILGPVFQTCFALIGEKGVTWDIIKLQVNMYTAPVLLAA 219          

HSP 2 Score: 79.337 bits (194), Expect = 8.164e-15
Identity = 64/225 (28.44%), Postives = 106/225 (47.11%), Query Frame = 2
Query: 1928 PQQP-GKVDFLGITIXXXXXXXXXXXXXXXETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPP-----------IPKT------------------NGTTGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKG 2512
            PQ P G +D + +     V F  + +F+  ETILTP+ +D +A+    A L   + L + G+  + +++G+   +K+   R  ++ G +   +  F+L+P   + P            P T                     TGCP+ EQ WC  T  + +   L +      GY  CSV++  L+S  LGP  Q ++MG+ T  GS +RI+GP F++ VY + G
Sbjct:  258 PQIPEGSIDQVAVVATNIVFFVVLFIFAVYETILTPLTLDMYAWTQEQAVLYDGILLVAFGVEAVLVFMGVKLLSKKIGERAILLGGFVVVWVGFFILLPWGNQFPKIQWEDLHNSSTPNTTFGEIIIGLWNSSREDHSEQPTGCPI-EQTWCLYTPVIHLAQFLTAAVLIGTGYPACSVMSYTLYSKVLGPKPQGIYMGWLTTSGSAARILGPVFISHVYTYLG 481          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Mouse
Match: Mfsd8 (major facilitator superfamily domain containing 8 [Source:MGI Symbol;Acc:MGI:1919425])

HSP 1 Score: 120.168 bits (300), Expect = 7.162e-28
Identity = 74/182 (40.66%), Postives = 110/182 (60.44%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQY-FALNMFTAAGFMGA 745
            SVR+L+LTMFLSSVGFSI + SIWPYL+ +D       LG V+A +S+GQ+    +FGL  N     ++PLI SI+     N  Y+Y+     + K +++++R +VGFG+GNVA+ R+++   +  +E+T  +A  S  Q LGFI GP  QT F  +G  G   +     +NM+TA   + A
Sbjct:   39 SVRILYLTMFLSSVGFSIVIMSIWPYLQKIDQTADASFLGWVIASYSLGQMVASPLFGLWSN-YRPRKEPLIVSISISVAANCLYAYVHVPAAHNKYYMLIARGLVGFGAGNVAVVRSYIAGATSLQERTNAMANTSTCQALGFILGPVFQTCFALIGEKGVTWDIIKLQVNMYTAPVLLAA 219          

HSP 2 Score: 79.337 bits (194), Expect = 8.164e-15
Identity = 64/225 (28.44%), Postives = 106/225 (47.11%), Query Frame = 2
Query: 1928 PQQP-GKVDFLGITIXXXXXXXXXXXXXXXETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPP-----------IPKT------------------NGTTGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKG 2512
            PQ P G +D + +     V F  + +F+  ETILTP+ +D +A+    A L   + L + G+  + +++G+   +K+   R  ++ G +   +  F+L+P   + P            P T                     TGCP+ EQ WC  T  + +   L +      GY  CSV++  L+S  LGP  Q ++MG+ T  GS +RI+GP F++ VY + G
Sbjct:  258 PQIPEGSIDQVAVVATNIVFFVVLFIFAVYETILTPLTLDMYAWTQEQAVLYDGILLVAFGVEAVLVFMGVKLLSKKIGERAILLGGFVVVWVGFFILLPWGNQFPKIQWEDLHNSSTPNTTFGEIIIGLWNSSREDHSEQPTGCPI-EQTWCLYTPVIHLAQFLTAAVLIGTGYPACSVMSYTLYSKVLGPKPQGIYMGWLTTSGSAARILGPVFISHVYTYLG 481          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Mouse
Match: Mfsd8 (major facilitator superfamily domain containing 8 [Source:MGI Symbol;Acc:MGI:1919425])

HSP 1 Score: 106.301 bits (264), Expect = 9.873e-26
Identity = 68/174 (39.08%), Postives = 102/174 (58.62%), Query Frame = 2
Query:  227 MFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQY-FALNMFTAAGFMGA 745
            MFLSSVGFSI + SIWPYL+ +D       LG V+A +S+GQ+    +FGL  N     ++PLI SI+     N  Y+Y+     + K +++++R +VGFG+GNVA+ R+++   +  +E+T  +A  S  Q LGFI GP  QT F  +G  G   +     +NM+TA   + A
Sbjct:    1 MFLSSVGFSIVIMSIWPYLQKIDQTADASFLGWVIASYSLGQMVASPLFGLWSNY-RPRKEPLIVSISISVAANCLYAYVHVPAAHNKYYMLIARGLVGFGAGNVAVVRSYIAGATSLQERTNAMANTSTCQALGFILGPVFQTCFALIGEKGVTWDIIKLQVNMYTAPVLLAA 173          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Mouse
Match: Mfsd8 (major facilitator superfamily domain containing 8 [Source:MGI Symbol;Acc:MGI:1919425])

HSP 1 Score: 106.301 bits (264), Expect = 9.873e-26
Identity = 68/174 (39.08%), Postives = 102/174 (58.62%), Query Frame = 2
Query:  227 MFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQY-FALNMFTAAGFMGA 745
            MFLSSVGFSI + SIWPYL+ +D       LG V+A +S+GQ+    +FGL  N     ++PLI SI+     N  Y+Y+     + K +++++R +VGFG+GNVA+ R+++   +  +E+T  +A  S  Q LGFI GP  QT F  +G  G   +     +NM+TA   + A
Sbjct:    1 MFLSSVGFSIVIMSIWPYLQKIDQTADASFLGWVIASYSLGQMVASPLFGLWSNY-RPRKEPLIVSISISVAANCLYAYVHVPAAHNKYYMLIARGLVGFGAGNVAVVRSYIAGATSLQERTNAMANTSTCQALGFILGPVFQTCFALIGEKGVTWDIIKLQVNMYTAPVLLAA 173          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Mouse
Match: Mfsd8 (major facilitator superfamily domain containing 8 [Source:MGI Symbol;Acc:MGI:1919425])

HSP 1 Score: 52.373 bits (124), Expect = 4.936e-8
Identity = 22/37 (59.46%), Postives = 30/37 (81.08%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKK 313
            SVR+L+LTMFLSSVGFSI + SIWPYL+  + + + +
Sbjct:   36 SVRILYLTMFLSSVGFSIVIMSIWPYLQKAEKRTSYR 72          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. UniProt/SwissProt
Match: sp|Q6GPQ3|MFSD8_XENLA (Major facilitator superfamily domain-containing protein 8 OS=Xenopus laevis OX=8355 GN=mfsd8 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.373e-35
Identity = 91/232 (39.22%), Postives = 135/232 (58.19%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPG-AVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRSPYAKYANTDEINVEAAILKKLLEKSRFGELSR 895
            S+RV++LTMFLSSVGFSI + SIWPYL+ +D       LG V+A FS+GQ+    +FGL  N     R+PL+ SIT +   +  Y+Y+     + K +++L+R  VGFGSGNVA+ R++V   +   E+T  +A +SAFQ +GFI GP  Q +   +G  G  +N     +NM+TA   MGA+  I NI+L+   F +        N   IN E+ +    +EK+  G + +
Sbjct:   36 SIRVMYLTMFLSSVGFSIVMTSIWPYLQKVDQSADASFLGWVIASFSLGQMVASPLFGLWSNH-RPRREPLVVSITILVAASCLYAYVHVPASHNKYYMLLARTFVGFGSGNVAVVRSYVAGATSLSERTGAMANISAFQAMGFILGPAFQAALSVIGETGITINGISLQVNMYTAPALMGALLGIGNIILIFAIFREHRVDDLEKNVSSINSESEVTD--VEKANEGPIDQ 264          

HSP 2 Score: 82.8037 bits (203), Expect = 4.032e-15
Identity = 58/191 (30.37%), Postives = 91/191 (47.64%), Query Frame = 2
Query: 2015 ETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPP---------------------IPKTNGT----TGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKG 2512
            ETI TP+ MD +A+  T A     + LA+ G+  + +++ +    K+   RV ++ G     +  F+L+P   + P                     IP +       TGCPV  Q WC  T  + +   L S     +GY IC+V++  L+S  +GP  Q L+MG+ TA GS +R +GP FV+ +Y   G
Sbjct:  285 ETISTPLTMDMYAWTRTQAVFYNGIILAAVGVESVIVFLTVKILCKKTGERVLLLGGLAVIWIGFFILLPWGNQMPKIQWTDLQNATIHNTTQWTSSIPSSGNHSVEPTGCPVI-QTWCLYTPVIHLAQYLTSDILIGVGYPICNVMSYTLYSKIIGPKPQGLYMGWLTAAGSAARTLGPVFVSQIYTHLG 474          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. UniProt/SwissProt
Match: sp|Q0VA82|MFSD8_DANRE (Major facilitator superfamily domain-containing protein 8 OS=Danio rerio OX=7955 GN=mfsd8 PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 5.168e-30
Identity = 80/205 (39.02%), Postives = 122/205 (59.51%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPG-AVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRS 799
            R    S+RV++ TMFLSSVGF+I + SIWPYLK +D       LG VVA +S+GQ+     FGL  N     R+PL+ SI      N++YSY+     + +  ++L+R  VG G+GNVA+ R++V   +  +E+T+ +A MSA Q LGFI GP +Q     +G  G +V+     +NM+TA   + A   ++NI+L+++   + S
Sbjct:   25 RSRWRSIRVMYFTMFLSSVGFTIVITSIWPYLKKIDESADASFLGWVVAAYSLGQMVASPFFGLWSNH-RPRREPLVCSIFINVSANIYYSYVYLPPSHNQIHMLLARTFVGIGAGNVAVVRSYVAGATSLKERTSAMANMSACQALGFILGPALQAVLSFIGETGVSVDVIKLQVNMYTAPALLAACFGVINILLVILVLREHS 228          

HSP 2 Score: 76.2554 bits (186), Expect = 5.514e-13
Identity = 71/253 (28.06%), Postives = 119/253 (47.04%), Query Frame = 2
Query: 1907 ENEVVCCPQQPGKVDFLGITIXXXXXXXXXXXXXXXETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGK--------------PPI-----PKTNGT---TGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKGLPXXXXXXXXXXXXXXXXXXXXYNRIVSF 2599
            E  V   P+  G +D + +     + F  + +F+  ETI TP+ MD FA+    A L   + LA+ G   I +++ +   + R  +R  ++ G I   +  F+L+P   +              PPI     P +N +    GCP +EQ WC  T  + +   + S     +GY  C+V++  L+S  LGP  Q ++MG+ TA GS +R +GP FV+  Y   G    F  +    +  + ++   Y R+V+F
Sbjct:  244 EERVDVPPEVEGDIDHIAVFTSNVLFFIILFIFAVFETISTPLSMDMFAWTRKEAVLYNGIILAAIGFESILVFLVVKVVSARVGDRPLLLGGLILIFVGFFMLLPWGNQYPKIQWTDINNNTIPPIQLAPTPASNSSLEPIGCP-SEQTWCLFTPVIHLAQYITSDILIGVGYPTCNVMSYTLYSKILGPKPQGVYMGWLTASGSGARTLGPVFVSHFYTILGPRWAFSAICGIVLAAIVMLSAMYKRLVAF 495          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. UniProt/SwissProt
Match: sp|Q8BH31|MFSD8_MOUSE (Major facilitator superfamily domain-containing protein 8 OS=Mus musculus OX=10090 GN=Mfsd8 PE=2 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 5.010e-27
Identity = 74/182 (40.66%), Postives = 110/182 (60.44%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQY-FALNMFTAAGFMGA 745
            SVR+L+LTMFLSSVGFSI + SIWPYL+ +D       LG V+A +S+GQ+    +FGL  N     ++PLI SI+     N  Y+Y+     + K +++++R +VGFG+GNVA+ R+++   +  +E+T  +A  S  Q LGFI GP  QT F  +G  G   +     +NM+TA   + A
Sbjct:   39 SVRILYLTMFLSSVGFSIVIMSIWPYLQKIDQTADASFLGWVIASYSLGQMVASPLFGLWSN-YRPRKEPLIVSISISVAANCLYAYVHVPAAHNKYYMLIARGLVGFGAGNVAVVRSYIAGATSLQERTNAMANTSTCQALGFILGPVFQTCFALIGEKGVTWDIIKLQVNMYTAPVLLAA 219          

HSP 2 Score: 79.337 bits (194), Expect = 5.710e-14
Identity = 64/225 (28.44%), Postives = 106/225 (47.11%), Query Frame = 2
Query: 1928 PQQP-GKVDFLGITIXXXXXXXXXXXXXXXETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPP-----------IPKT------------------NGTTGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKG 2512
            PQ P G +D + +     V F  + +F+  ETILTP+ +D +A+    A L   + L + G+  + +++G+   +K+   R  ++ G +   +  F+L+P   + P            P T                     TGCP+ EQ WC  T  + +   L +      GY  CSV++  L+S  LGP  Q ++MG+ T  GS +RI+GP F++ VY + G
Sbjct:  258 PQIPEGSIDQVAVVATNIVFFVVLFIFAVYETILTPLTLDMYAWTQEQAVLYDGILLVAFGVEAVLVFMGVKLLSKKIGERAILLGGFVVVWVGFFILLPWGNQFPKIQWEDLHNSSTPNTTFGEIIIGLWNSSREDHSEQPTGCPI-EQTWCLYTPVIHLAQFLTAAVLIGTGYPACSVMSYTLYSKVLGPKPQGIYMGWLTTSGSAARILGPVFISHVYTYLG 481          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. UniProt/SwissProt
Match: sp|Q8NHS3|MFSD8_HUMAN (Major facilitator superfamily domain-containing protein 8 OS=Homo sapiens OX=9606 GN=MFSD8 PE=1 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 2.844e-25
Identity = 72/182 (39.56%), Postives = 108/182 (59.34%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQY-FALNMFTAAGFMGA 745
            S+R+L+LTMFLSSVGFS+ + SIWPYL+ +D       LG V+A +S+GQ+    IFGL  N     ++PLI SI      N  Y+YL     + K +++++R ++G G+GNVA+ R++    +  +E+T+ +A +S  Q LGFI GP  QT F  LG  G   +     +NM+T    + A
Sbjct:   38 SIRILYLTMFLSSVGFSVVMMSIWPYLQKIDPTADTSFLGWVIASYSLGQMVASPIFGLWSNY-RPRKEPLIVSILISVAANCLYAYLHIPASHNKYYMLVARGLLGIGAGNVAVVRSYTAGATSLQERTSSMANISMCQALGFILGPVFQTCFTFLGEKGVTWDVIKLQINMYTTPVLLSA 218          

HSP 2 Score: 85.5001 bits (210), Expect = 6.878e-16
Identity = 61/195 (31.28%), Postives = 96/195 (49.23%), Query Frame = 2
Query: 2015 ETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPP-----------IPKT------------------NGTTGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKG 2512
            ETI+TP+ MD +A+    A L   + LA+ G+  + I++G+   +K+   R  ++ G I   +  F+L+P   + P           IP T                     TGC + EQ WC  T  + +   L S     LGY +C++++  L+S  LGP  Q ++MG+ TA GS +RI+GP F++ VYA  G
Sbjct:  287 ETIITPLTMDMYAWTQEQAVLYNGIILAALGVEAVVIFLGVKLLSKKIGERAILLGGLIVVWVGFFILLPWGNQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTGCSI-EQAWCLYTPVIHLAQFLTSAVLIGLGYPVCNLMSYTLYSKILGPKPQGVYMGWLTASGSGARILGPMFISQVYAHWG 480          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. TrEMBL
Match: A0A210PPS0 (Major facilitator superfamily domain-containing protein 8 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT12176 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 5.362e-42
Identity = 93/220 (42.27%), Postives = 143/220 (65.00%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRSPYAKYANTDEINVEAAILKKL 862
            S+RV++LTMFLSSV FSI + SIWPYL++LD   T   LG VVA +S+GQL    IFG   N+ +  R+PL+ SI       + Y+YL + K +    L+L+R  +GFG+GNVA+ R++V+  +   E+T  +A MSA Q +GFIFGP IQT+ +P+G+PG V+E  F L+++T   ++  I  I+N+VLL++ F +     +  N ++IN +  + ++L
Sbjct:   49 SIRVMYLTMFLSSVSFSICMSSIWPYLQLLDPSATTDFLGWVVASYSLGQLIASPIFGFWANKRKRSREPLVVSIVINILATVLYAYLESLKSHKSIALLLARGFIGFGAGNVAVVRSYVSGATTTRERTGAMASMSACQAIGFIFGPGIQTAMVPVGWPGPVHEPGFHLDLYTMPAWLSVIVGIMNVVLLVVVFQEH----RVDNDEDINFQVQVGERL 264          

HSP 2 Score: 69.3218 bits (168), Expect = 2.750e-8
Identity = 57/206 (27.67%), Postives = 92/206 (44.66%), Query Frame = 2
Query: 2015 ETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPP-------IPKT--NGTT-------------------------------GCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKG 2512
            ETI TP+ MD F++  + A+L   + LA  G++ IF++I +    KR++ R  ++ G +FC       +P     P       +P +  N TT                               GCP++ + WC  T  + +   L       +GY +C+++   +FS  LGP  Q + MG  T  GSL+R +GP F++ VY   G
Sbjct:  292 ETIATPLTMDMFSWTKSEATLYTGIILAVGGVIAIFVFIVVKVLVKRFNERYILIGGFLFCLAGFITFLPWGNDFPDYHDQDLLPPSSVNSTTDPLRGITDWSTSLMTTPGHNSSAPGDDPEHRGCPISYK-WCAYTPRILLPQFLGGTLLIVIGYPVCNLMIYTIFSKVLGPKPQGVMMGLLTGSGSLARTLGPIFISQVYNAYG 496          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. TrEMBL
Match: A0A0B6Y827 (MFS domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF16201 PE=4 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 7.963e-38
Identity = 82/195 (42.05%), Postives = 128/195 (65.64%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYF 787
            S+RV++L MFL SV F+IT+ S+WP+L+VL+   +   LG VVA +S+GQL    IFG   N+  S R+PL+ S+      N+FY YL +   +   ++IL+R ++GF +GNVA+ R++V+  +  +E+T+ +A +S FQ +GFI GP IQ + +P+ YPG V+  YF  NM+TA  F+    +I+ +VLL+  F
Sbjct:   56 SIRVVYLVMFLGSVTFTITMSSLWPFLQVLNPTASTSFLGWVVAAYSLGQLSASPIFGGWANRRNSSREPLVVSLILTVLSNIFYMYLESMPDHRHYYMILARGLIGFSAGNVAVVRSYVSGATTVQERTSSMANLSIFQAMGFILGPVIQAALVPISYPGPVDSVYFHFNMYTAPAFLAGCVAIIAVVLLVFVF 250          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. TrEMBL
Match: K1RB27 (Major facilitator superfamily domain-containing protein 8 OS=Crassostrea gigas OX=29159 GN=CGI_10009378 PE=4 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.094e-37
Identity = 84/190 (44.21%), Postives = 129/190 (67.89%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSI 757
            R    S+RV++LTMFLSSV FSI + SIWP+LK+L++  +   LG VVA +SIGQL    +FG+  N +   R+PL+ S+      N+ Y+YL + K +   FLI +R ++GFG+GNVA+ R++++  +K +E+T+ +A +SAFQ +GFI GP IQT+ +P+GYPG V+     +N++TA  F+ A+  I
Sbjct:   45 RSRWRSIRVMYLTMFLSSVSFSICMSSIWPFLKLLESSASTDLLGWVVASYSIGQLIASPVFGMMANCMRKSREPLVISLIINILANILYAYLEDIKTHRVVFLIAARALIGFGAGNVAVVRSYLSGATKLKERTSAMANLSAFQAIGFIVGPGIQTAMVPIGYPGPVHMSGLRINLYTAPAFLSALVGI 234          

HSP 2 Score: 69.707 bits (169), Expect = 2.138e-8
Identity = 72/241 (29.88%), Postives = 106/241 (43.98%), Query Frame = 2
Query: 2015 ETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPP------------IPKTNGT---------------------------------TGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKGLPXXXXXXXXXXXXXXXXXXXXYNRIVSFK 2602
            ETI TP+ MD +A+   +A+L   + LA  G++ I ++I I   +K  + R+ ++ G I C L  FV +P     P            +PK NG+                                 TGCP   Q WC  T  +T+   L       +GY   +V++  LFS  LGP  Q   MG  TA GSL+R VGP FV+ +Y   G  + F  +    +I +  + + Y R+V FK
Sbjct:  294 ETIGTPLTMDMYAWTRAHATLYNGIILAVGGVVAILVFIVIKILSKWVNERLLLIGGLICCFLGFFVYLPWGNDYPSSQMANIGPEHQLPK-NGSWFTVIPSDKTIPPHYNQSTTAAPGNSSGSGSEATGCPDAYQ-WCSYTPIVTLSQFLCGTALICIGYPTGNVMSYALFSKILGPKPQGTMMGILTASGSLARTVGPIFVSLIYHAFGPRVTFVSMCGMTLITVIFVGFVYKRLVPFK 532          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. TrEMBL
Match: A0A1I8HTA2 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.825e-34
Identity = 92/224 (41.07%), Postives = 135/224 (60.27%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYF---------YDRSPYAKYANTDEINVEAA 847
            S+R+ +LT F+SS+GFSI L SIWPYL+ +D +  +  LG VVA FS+GQL    I GL  N ++  R P++ S+    FG+  Y+Y+  F    +  L++SRF++G G+GN A+ R+FV+  +   E+T  +A +S  Q LGFI GP +Q  F  LGYPG V+     +NM+T+AG +  + +I NIVL+ ++F          DRS     AN   IN +AA
Sbjct:   17 SIRLCYLTFFISSLGFSICLSSIWPYLQQVDTESNEAFLGWVVAAFSLGQLIASPILGLLFNVMKQARIPILISLVISLFGSALYAYVHIFPTNRRFVLLVSRFVIGLGAGNGAVIRSFVSGATTVAERTEVMAKVSICQSLGFIVGPAVQAVFTLLGYPGPVHGAALQINMYTSAGLLSFLMAIGNIVLIAVFFKEFFFETDTMDRS----LANPASINSDAA 236          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. TrEMBL
Match: A0A1I8GXH1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.977e-34
Identity = 91/224 (40.62%), Postives = 135/224 (60.27%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYF---------YDRSPYAKYANTDEINVEAA 847
            S+R+ +LT F+SS+GFSI L SIWPYL+ +D +  +  LG VVA FS+GQL    I GL  N ++  R P++ S+    FG+  Y+Y+  F    +  L+++RF++G G+GN A+ R+FV+  +   E+T  +A +S  Q LGFI GP +Q  F  LGYPG V+     +NM+T+AG +  + +I NIVL+ ++F          DRS     AN   IN +AA
Sbjct:   17 SIRLCYLTFFISSLGFSICLSSIWPYLQQVDTESNEAFLGWVVAAFSLGQLIASPILGLLFNVMKQARIPILISLVISLFGSALYAYVHIFPTNRRFVLLVARFVIGLGAGNGAVIRSFVSGATTVAERTEVMAKVSICQSLGFIVGPAVQAVFTLLGYPGPVHGAALQINMYTSAGLLSFLMAIGNIVLIAVFFKEFFFETDTMDRS----LANPASINSDAA 236          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Cavefish
Match: mfsd8 (major facilitator superfamily domain containing 8 [Source:NCBI gene;Acc:103022629])

HSP 1 Score: 127.487 bits (319), Expect = 1.691e-30
Identity = 78/188 (41.49%), Postives = 115/188 (61.17%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPG-AVNEQYFALNMFTAAGFMGAI 748
            R    S+RV++ TMFLSSVGF+I + SIWPYL+ +D       LG VVA +S+GQ+    +FGL  N     R+PL+ SI F    N++Y+Y+     Y K  ++L+R  VGFG+GNVA+ R++V   +  +E+T+ +A MSA Q LGFI GP +Q +   +G  G  ++     LNM+TA   + A+
Sbjct:   26 RSRWKSIRVMYFTMFLSSVGFTIVITSIWPYLQKIDDTADASFLGWVVAAYSLGQMVASPLFGLWSNH-RPRREPLVCSIFFNVSANIYYAYVYLIPSYNKYHMLLARAFVGFGAGNVAVVRSYVAGATSLKERTSAMANMSACQALGFILGPALQAALSFIGEKGYTLHFLELKLNMYTAPALLAAV 212          

HSP 2 Score: 85.1149 bits (209), Expect = 8.997e-17
Identity = 62/187 (33.16%), Postives = 94/187 (50.27%), Query Frame = 2
Query: 2015 ETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPP-----------IPK-------TNGT---TGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKG 2512
            ETI TP+ MD FA+    A L   + LA+ G   I +++ +   + R  +R  ++ G     +  F+L+P   + P           IP         NGT   TGCP  EQ+WC+ T A+ +   + S     +GY  C+V++  L+S  LGP  Q ++MG+ TA GS +R +GP FV+ VY   G
Sbjct:  281 ETISTPLSMDMFAWTRKEAVLYNGIILAAIGFESIIVFLVVKVISVRIGDRPVLLSGLAIVFIGFFILLPWGNQYPKIQWADLQNNSIPAITFAANAANGTVEPTGCP-PEQIWCQYTPAIQLAQYITSDILIGVGYPACNVMSYTLYSKILGPKPQGVYMGWLTASGSGARTLGPVFVSQVYTLLG 466          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Cavefish
Match: mfsd8 (major facilitator superfamily domain containing 8 [Source:NCBI gene;Acc:103022629])

HSP 1 Score: 102.064 bits (253), Expect = 3.485e-22
Identity = 72/188 (38.30%), Postives = 107/188 (56.91%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPG-AVNEQYFALNMFTAAGFMGAI 748
            R    S+RV++ TMFLSSVG     P+I      +D       LG VVA +S+GQ+    +FGL  N     R+PL+ SI F    N++Y+Y+     Y K  ++L+R  VGFG+GNVA+ R++V   +  +E+T+ +A MSA Q LGFI GP +Q +   +G  G  ++     LNM+TA   + A+
Sbjct:   14 RSRWKSIRVMYFTMFLSSVGKIFIHPTI--NHNTIDDTADASFLGWVVAAYSLGQMVASPLFGLWSNH-RPRREPLVCSIFFNVSANIYYAYVYLIPSYNKYHMLLARAFVGFGAGNVAVVRSYVAGATSLKERTSAMANMSACQALGFILGPALQAALSFIGEKGYTLHFLELKLNMYTAPALLAAV 198          

HSP 2 Score: 84.3445 bits (207), Expect = 1.336e-16
Identity = 67/219 (30.59%), Postives = 108/219 (49.32%), Query Frame = 2
Query: 2015 ETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPP-----------IPK-------TNGT---TGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKGLPXXXXXXXXXXXXXXXXXXXXYNRIVSFKPK 2608
            ETI TP+ MD FA+    A L   + LA+ G   I +++ +   + R  +R  ++ G     +  F+L+P   + P           IP         NGT   TGCP  EQ+WC+ T A+ +   + S     +GY  C+V++  L+S  LGP  Q ++MG+ TA GS +R +GP FV+ VY   G    F ++    +  + L+   Y R+++F  +
Sbjct:  267 ETISTPLSMDMFAWTRKEAVLYNGIILAAIGFESIIVFLVVKVISVRIGDRPVLLSGLAIVFIGFFILLPWGNQYPKIQWADLQNNSIPAITFAANAANGTVEPTGCP-PEQIWCQYTPAIQLAQYITSDILIGVGYPACNVMSYTLYSKILGPKPQGVYMGWLTASGSGARTLGPVFVSQVYTLLGPRWAFSLICGIVLAAIILLTAMYKRLIAFSVR 484          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Cavefish
Match: si:ch211-38m6.6 (si:ch211-38m6.6 [Source:ZFIN;Acc:ZDB-GENE-070705-179])

HSP 1 Score: 50.8322 bits (120), Expect = 4.764e-6
Identity = 43/153 (28.10%), Postives = 70/153 (45.75%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGP 646
            R+  +S   + L  FLS V +++ LP+IW YL++LDA      LG+    FS             + +  + +  ++ S  F   GN  Y     F  Y K  L+ SR + G G+G  +    F+T  + P+E+    A + A +  G + GP
Sbjct:    5 RKRELSFLTIGLLFFLSGVEYAVILPTIWKYLQILDAPAYFLGLGLSAFSFSGLLSGPLFGRWSDVTR--TTKSIILFSNVFEIVGNFMY-----FLGYSKWLLLASRLVAGIGAGAGSSIFGFLTRTTLPDERARVFAAVMACRQAGLLIGP 150          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Sea Lamprey
Match: mfsd8 (major facilitator superfamily domain containing 8 [Source:NCBI gene;Acc:564342])

HSP 1 Score: 99.3673 bits (246), Expect = 5.328e-23
Identity = 68/181 (37.57%), Postives = 100/181 (55.25%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNV-AITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPG-AVNEQYFALNMFT 724
            R    S+RV++LTMFLSSVGFSI + SIWP+L+ +D   +   LG V+A +S+ QLF     G   N   S   PL+ S+     G++ Y Y       G+  ++ +R  +G G+G   A+ R F +A +  +E+T  +A +SA Q LGFI GP +QT    +G  G +       LNM+T
Sbjct:    5 RRRWRSIRVMYLTMFLSSVGFSIVMSSIWPFLQKVDPSSSPTFLGWVLASYSLAQLFACPALGAWANARGS-SMPLLTSMLLGTAGHVMYMYAHAVHSRGRFLVLAARIFLGLGAGTTQAVVRAFASAATNMDERTPVMANLSACQALGFILGPVLQTVLTWVGEEGVSWPPLALQLNMYT 184          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Medaka
Match: mfsd8 (major facilitator superfamily domain containing 8 [Source:NCBI gene;Acc:101161364])

HSP 1 Score: 115.161 bits (287), Expect = 1.933e-26
Identity = 81/227 (35.68%), Postives = 126/227 (55.51%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPG-AVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRS--------PYAKYANTDEINVE 841
            R    S+RV++ TMFLSSVGF+I + S+WPYL+ +D+      LG +VA +S+GQ+    +FG   N     R+PL+ SI      N++Y+Y    K   K  L++SR  VGFG+GNVA+ R++V   +   E+T  +A MSA Q LGFI GP +Q     +G  G  V+     L+M+T    + A+  ++NI+L+++   +              Y + D +N+E
Sbjct:   28 RSRWRSIRVMYFTMFLSSVGFTIVITSLWPYLEKVDSGADASFLGWMVAAYSLGQMVASPLFGWWSNH-RPRREPLVCSIFINLAANIYYAYAYLPKTNNKYHLLMSRAFVGFGAGNVAVVRSYVAGATSLRERTGAMANMSACQALGFILGPALQAGLTFIGEEGITVDVIKLQLSMYTTPALLAALFGLINILLVVLVLKEHRVDEDGKQIQAINYTSEDRVNIE 253          

HSP 2 Score: 77.411 bits (189), Expect = 2.367e-14
Identity = 56/188 (29.79%), Postives = 91/188 (48.40%), Query Frame = 2
Query: 2015 ETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVG--QIFCTLTCFV------------------LIPMVGKPPIPKTNG--TTGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKG 2512
            ETI TP+ MD F++    A L   + + + G   I +++ +  +++R+ +R  ++ G   IFC     +                  L+  V K  +   N    TGCP  EQ WC+   A+ +   + S     +GY  C+V++  L+S  LGP  Q ++MG+ TA GS +R +GP FV+ VY   G
Sbjct:  282 ETIATPLSMDMFSWTRKEAVLYNGIIMCAIGFESILVFLAVKAASQRFGDRPVLLAGFAVIFCGFIVLLPWGNHYPKIQWADLKNNTLVGEVSKAALASNNTFEPTGCPY-EQTWCQYIPAIHLAQYISSDILIGVGYPACNVMSYTLYSKILGPKPQGVYMGWLTASGSGARTLGPVFVSHVYTLLG 468          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Medaka
Match: mfsd8 (major facilitator superfamily domain containing 8 [Source:NCBI gene;Acc:101161364])

HSP 1 Score: 76.2554 bits (186), Expect = 4.197e-14
Identity = 62/217 (28.57%), Postives = 105/217 (48.39%), Query Frame = 2
Query: 1928 PQQPGKVDFLGITIXXXXXXXXXXXXXXXETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVG--QIFCTLTCFV------------------LIPMVGKPPIPKTNG--TTGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKG 2512
            P+    +D + + I   + F+ M +F+  ETI TP+ MD F++    A L   + + + G   I +++ +  +++R+ +R  ++ G   IFC     +                  L+  V K  +   N    TGCP  EQ WC+   A+ +   + S     +GY  C+V++  L+S  LGP  Q ++MG+ TA GS +R +GP FV+ VY   G
Sbjct:  158 PEDELSIDQVAVLISNILFFTVMFIFAVFETIATPLSMDMFSWTRKEAVLYNGIIMCAIGFESILVFLAVKAASQRFGDRPVLLAGFAVIFCGFIVLLPWGNHYPKIQWADLKNNTLVGEVSKAALASNNTFEPTGCPY-EQTWCQYIPAIHLAQYISSDILIGVGYPACNVMSYTLYSKILGPKPQGVYMGWLTASGSGARTLGPVFVSHVYTLLG 373          

HSP 2 Score: 73.1738 bits (178), Expect = 3.522e-13
Identity = 63/153 (41.18%), Postives = 90/153 (58.82%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGP 646
            R    S+RV++ TMFLSSVG  ++ P++   LKV D+      LG +VA +S+GQ+    +FG   N     R+PL+ SI      N++Y+Y    K   K  L++SR  VGFG+GNVA+ R++V   +   E+T  +A MSA Q LGFI GP
Sbjct:   10 RSRWRSIRVMYFTMFLSSVGEFVS-PAL-CSLKV-DSGADASFLGWMVAAYSLGQMVASPLFGWWSNH-RPRREPLVCSIFINLAANIYYAYAYLPKTNNKYHLLMSRAFVGFGAGNVAVVRSYVAGATSLRERTGAMANMSACQALGFILGP 158          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Medaka
Match: ENSORLT00000008970.2 (major facilitator superfamily domain-containing protein 8 [Source:NCBI gene;Acc:101156398])

HSP 1 Score: 55.0694 bits (131), Expect = 2.293e-7
Identity = 58/216 (26.85%), Postives = 107/216 (49.54%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLG--YPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRSPYAKYANTDE 829
            R+  ++   + L   LS V +++ LP+IW YL+ L+A+     LG+ ++ FS+  L  G +FG   ++ ++ +K ++ +  F   GNL Y     F  Y K  L+ SR + G G+G  +    F+T  +  E++    A + A +  G + GP     F+ L   + G+     F +N +TA G    +  I+ + L++++ Y   PY +   T +
Sbjct:    5 RKRKLTFATIGLIFLLSGVEYAVILPTIWRYLQTLNAE--PYFLGLTLSAFSLSGLLSGPLFGHLSDRTQTTKKIILFANFFEIIGNLMY-----FMGYSKWLLLSSRLVAGIGTGAGSSIFGFLTRSTASEDRATVFAAVMACRQAGLLIGPAFNI-FLRLCNFHLGS-----FVVNKYTAPGLFMCLLWIL-LQLVVVFMYWDLPYLERRKTKD 206          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Medaka
Match: si:ch211-38m6.6 (major facilitator superfamily domain-containing protein 8-like [Source:NCBI gene;Acc:105356178])

HSP 1 Score: 52.373 bits (124), Expect = 1.546e-6
Identity = 58/199 (29.15%), Postives = 99/199 (49.75%), Query Frame = 2
Query:  221 LTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPC----IQTSFIPLGYPGAVNEQYFALNMFTAAG-FMGAITSIVNIVLLLIYFYDRSP 802
            L   LS + +++ LP+IW YL++L+A      LG+ ++ FS+  L  G +FG   ++ ++ +  ++ S  F   GN  Y     F  Y K  L+ SR + G G+G  +    F+T  + PEE+    A + A +  G + GP     ++     LG P       FA+N +T+ G FM  +  ++  V+L +Y +D  P
Sbjct:   25 LIFMLSGIEYAVILPTIWRYLQILEAP--PYFLGLGLSAFSLSGLLTGPLFGFWSDRSKTTKSIILFSNLFEIAGNFMY-----FLGYSKWLLLCSRLVAGIGAGAGSSIFGFLTRSTLPEERAGIFAAVMACRQAGLLIGPAFNLFLRLCDFKLG-P-------FAVNKYTSPGIFMCLLWLLLQFVVLALY-WDVPP 207          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Planmine SMEST
Match: SMESG000078496.1 (SMESG000078496.1)

HSP 1 Score: 1399.8 bits (3622), Expect = 0.000e+0
Identity = 784/807 (97.15%), Postives = 785/807 (97.27%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRSPYAKYANTDEINVEAAILKKLLEKSRFGELSRTVMTRKFCFLDKHLTSVIILFWNSIVVGKSVNAMESFLNRPPIPTKRNSPLLKGEKVKDESVFIIGMPATKFEMAINESIVSSDKVASSENDLSAADIKLVDSKKNYINPTNEIEKEYENTFFQKAKDANSRFAFLKDSFEEESQPAIRIEGNDFQDNGLSIVAIPQVIKESNKDTESTFYNKDESIFKSFFDTNISEVMTQMLIHPSERRSRRIASFPQTSTVYSSYLFSIMGSFVALILNNSAENSIRSGTYGRWRNSLITKSEFLSSMNSTEKHSNRTQSPSFMHSSKLGKINDLNKSEYRSSLGPXXXXXXXXXXXXXXCRSFVERIRGKSAEENEVVCCPQQPGKVDFLGITIXXXXXXXXXXXXXXXETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPPIPKTNGTTGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKGLPXXXXXXXXXXXXXXXXXXXXYNRIVSFKPK 2608
            RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAIFSIGQLFGGIIFGLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRSPYAKYANTDEINVEAAILKKLLEKSRFGELSRTVMT                      +GKSVNAMESFLNRPPIPTKRNSPLLKGEKVKDESVFIIGMPATKFEMAINESIVSSDKVASSENDLSAADIKLVDSKKNYINPTNEIEKEYENTFFQKAKDANSRFAFLKDSFEEESQPAIRIEGNDFQDNGLSIVAIPQVIKESNKDTESTFYNKDESIFKSFFDTNISEVMTQMLIHPSERRSRRIASFPQTSTVYSSYLFSIMGSFVALILNNSAENSIRSGTYGRWRNSLITKSEFLSSMNSTEKHSNRTQSPSFMHSSKLGKINDLNKSEYRSSLGPSENHSNHSLHSVSVCRSFVERIRGKSAEENEVVCCPQQPGKVDFLGITIVLSVLFSSMVLFSSLETILTPMLMDNFAFELTYASLIASLDLASCGIMGIFIYIGIGFSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPPIPKTNGTTGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKGLPLVFGILLLFNVILLWLIFWFYNRIVSFKPK
Sbjct:   22 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAIFSIGQLFGGIIFGLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRSPYAKYANTDEINVEAAILKKLLEKSRFGELSRTVMT----------------------LGKSVNAMESFLNRPPIPTKRNSPLLKGEKVKDESVFIIGMPATKFEMAINESIVSSDKVASSENDLSAADIKLVDSKKNYINPTNEIEKEYENTFFQKAKDANSRFAFLKDSFEEESQPAIRIEGNDFQDNGLSIVAIPQVIKESNKDTESTFYNKDESIFKSFFDTNISEVMTQMLIHPSERRSRRIASFPQTSTVYSSYLFSIMGSFVALILNNSAENSIRSGTYGRWRNSLITKSEFLSSMNSTEKHSNRTQSPSFMHSSKLGKINDLNKSEYRSSLGPSENHSNHSLHSVSVCRSFVERIRGKSAEENEVVCCPQQPGKVDFLGITIVLSVLFSSMVLFSSLETILTPMLMDNFAFELTYASLIASLDLASCGIMGIFIYIGIGFSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPPIPKTNGTTGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKGLPLVFGILLLFNVILLWLIFWFYNRIVSFKPK 806          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Planmine SMEST
Match: SMESG000078496.1 (SMESG000078496.1)

HSP 1 Score: 1389.02 bits (3594), Expect = 0.000e+0
Identity = 780/807 (96.65%), Postives = 781/807 (96.78%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRSPYAKYANTDEINVEAAILKKLLEKSRFGELSRTVMTRKFCFLDKHLTSVIILFWNSIVVGKSVNAMESFLNRPPIPTKRNSPLLKGEKVKDESVFIIGMPATKFEMAINESIVSSDKVASSENDLSAADIKLVDSKKNYINPTNEIEKEYENTFFQKAKDANSRFAFLKDSFEEESQPAIRIEGNDFQDNGLSIVAIPQVIKESNKDTESTFYNKDESIFKSFFDTNISEVMTQMLIHPSERRSRRIASFPQTSTVYSSYLFSIMGSFVALILNNSAENSIRSGTYGRWRNSLITKSEFLSSMNSTEKHSNRTQSPSFMHSSKLGKINDLNKSEYRSSLGPXXXXXXXXXXXXXXCRSFVERIRGKSAEENEVVCCPQQPGKVDFLGITIXXXXXXXXXXXXXXXETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPPIPKTNGTTGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKGLPXXXXXXXXXXXXXXXXXXXXYNRIVSFKPK 2608
            RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAIFSIGQLFGGIIFGLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRSPYAKYANTDEINVEAAILKKLLEKSRFGELSRTVMT                      +GKSVNAMESFLNRPPIPTKRNSPLLKGEKVKDESVFIIGMPATKFEMAINESIVSSDK    ENDLSAADIKLVDSKKNYINPTNEIEKEYENTFFQKAKDANSRFAFLKDSFEEESQPAIRIEGNDFQDNGLSIVAIPQVIKESNKDTESTFYNKDESIFKSFFDTNISEVMTQMLIHPSERRSRRIASFPQTSTVYSSYLFSIMGSFVALILNNSAENSIRSGTYGRWRNSLITKSEFLSSMNSTEKHSNRTQSPSFMHSSKLGKINDLNKSEYRSSLGPSENHSNHSLHSVSVCRSFVERIRGKSAEENEVVCCPQQPGKVDFLGITIVLSVLFSSMVLFSSLETILTPMLMDNFAFELTYASLIASLDLASCGIMGIFIYIGIGFSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPPIPKTNGTTGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKGLPLVFGILLLFNVILLWLIFWFYNRIVSFKPK
Sbjct:   22 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAIFSIGQLFGGIIFGLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRSPYAKYANTDEINVEAAILKKLLEKSRFGELSRTVMT----------------------LGKSVNAMESFLNRPPIPTKRNSPLLKGEKVKDESVFIIGMPATKFEMAINESIVSSDK----ENDLSAADIKLVDSKKNYINPTNEIEKEYENTFFQKAKDANSRFAFLKDSFEEESQPAIRIEGNDFQDNGLSIVAIPQVIKESNKDTESTFYNKDESIFKSFFDTNISEVMTQMLIHPSERRSRRIASFPQTSTVYSSYLFSIMGSFVALILNNSAENSIRSGTYGRWRNSLITKSEFLSSMNSTEKHSNRTQSPSFMHSSKLGKINDLNKSEYRSSLGPSENHSNHSLHSVSVCRSFVERIRGKSAEENEVVCCPQQPGKVDFLGITIVLSVLFSSMVLFSSLETILTPMLMDNFAFELTYASLIASLDLASCGIMGIFIYIGIGFSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPPIPKTNGTTGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKGLPLVFGILLLFNVILLWLIFWFYNRIVSFKPK 802          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Planmine SMEST
Match: SMESG000078496.1 (SMESG000078496.1)

HSP 1 Score: 1347.8 bits (3487), Expect = 0.000e+0
Identity = 763/807 (94.55%), Postives = 764/807 (94.67%), Query Frame = 2
Query:  188 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRSPYAKYANTDEINVEAAILKKLLEKSRFGELSRTVMTRKFCFLDKHLTSVIILFWNSIVVGKSVNAMESFLNRPPIPTKRNSPLLKGEKVKDESVFIIGMPATKFEMAINESIVSSDKVASSENDLSAADIKLVDSKKNYINPTNEIEKEYENTFFQKAKDANSRFAFLKDSFEEESQPAIRIEGNDFQDNGLSIVAIPQVIKESNKDTESTFYNKDESIFKSFFDTNISEVMTQMLIHPSERRSRRIASFPQTSTVYSSYLFSIMGSFVALILNNSAENSIRSGTYGRWRNSLITKSEFLSSMNSTEKHSNRTQSPSFMHSSKLGKINDLNKSEYRSSLGPXXXXXXXXXXXXXXCRSFVERIRGKSAEENEVVCCPQQPGKVDFLGITIXXXXXXXXXXXXXXXETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPPIPKTNGTTGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKGLPXXXXXXXXXXXXXXXXXXXXYNRIVSFKPK 2608
            RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAIFSIGQLFGGIIFGLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRSPYAKYANTDEINVEAAILKKLLEKSRFGELSRTVMT                      +GKSVNAMESFLNRPPIPTKRNSPLLKGEKVKDESVFIIGMPATKFEMAINESIVSSDKVASSENDLSAADIKLVDSKKNYINPTNEIEKEYENTFFQKAKDANSRFAFLKDSFEEESQPAIRIEGNDFQDNGLSIVAIPQVIKESNKDTESTFYNKDESIFKSFFDTNISEVMTQMLIHPSERRSRRIASFPQTST                     AENSIRSGTYGRWRNSLITKSEFLSSMNSTEKHSNRTQSPSFMHSSKLGKINDLNKSEYRSSLGPSENHSNHSLHSVSVCRSFVERIRGKSAEENEVVCCPQQPGKVDFLGITIVLSVLFSSMVLFSSLETILTPMLMDNFAFELTYASLIASLDLASCGIMGIFIYIGIGFSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPPIPKTNGTTGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKGLPLVFGILLLFNVILLWLIFWFYNRIVSFKPK
Sbjct:   22 RENIISVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAIFSIGQLFGGIIFGLAINQLESFRKPLIASITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYFYDRSPYAKYANTDEINVEAAILKKLLEKSRFGELSRTVMT----------------------LGKSVNAMESFLNRPPIPTKRNSPLLKGEKVKDESVFIIGMPATKFEMAINESIVSSDKVASSENDLSAADIKLVDSKKNYINPTNEIEKEYENTFFQKAKDANSRFAFLKDSFEEESQPAIRIEGNDFQDNGLSIVAIPQVIKESNKDTESTFYNKDESIFKSFFDTNISEVMTQMLIHPSERRSRRIASFPQTST---------------------AENSIRSGTYGRWRNSLITKSEFLSSMNSTEKHSNRTQSPSFMHSSKLGKINDLNKSEYRSSLGPSENHSNHSLHSVSVCRSFVERIRGKSAEENEVVCCPQQPGKVDFLGITIVLSVLFSSMVLFSSLETILTPMLMDNFAFELTYASLIASLDLASCGIMGIFIYIGIGFSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPPIPKTNGTTGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKGLPLVFGILLLFNVILLWLIFWFYNRIVSFKPK 785          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Planmine SMEST
Match: SMESG000039774.1 (SMESG000039774.1)

HSP 1 Score: 129.413 bits (324), Expect = 2.716e-31
Identity = 74/197 (37.56%), Postives = 121/197 (61.42%), Query Frame = 2
Query:  203 SVRVLFLTMFLSSVGFSITLPSIWPYLKVLDAKVTKKSLGIVVAXXXXXXXXXXXXXXLAINQLESFRKPLIASITFMFFGNLFYSYLANF--KQYGKSFLILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYF 787
            ++++ +  MF +SV +SI +PS+WPY+ ++D   +K+ LG VVA++SIGQLF   +F     +   F+  LI S      GN  YS + +   K   K  L+ SR ++G    N+A  R F+T  +  EE+   ++++SA QGLGFI GP +Q +F+P+GYPG +   +F +NM+TA+G  G +++ V ++LL+  F
Sbjct:   40 AIKITYAVMFFTSVSYSIQMPSLWPYMNIIDDTYSKEFLGWVVAVYSIGQLFTCPLFSYISGKTGCFKTILILSAIIAGTGNYLYSVIVDIDGKLAKKISLLTSRIVIGIAGANIAPIRLFLTLATTEEERIGPMSILSACQGLGFIIGPGLQAAFVPIGYPGIIEIPFFRINMYTASGIFGVLSNFVILILLIFCF 236          

HSP 2 Score: 102.834 bits (255), Expect = 1.493e-22
Identity = 65/172 (37.79%), Postives = 95/172 (55.23%), Query Frame = 2
Query: 2015 ETILTPMLMDNFAFELTYASLIASLDLASCXXXXXXXXXXXXXSTKRYSNRVHMVVGQIFCTLTCFVLIPMVGKPPIPKTNGTT----------GCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICSVVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVY 2500
            ET  TPM MDNF +  ++A+LI S+ LAS GI  I I+I + +  K    ++  + G +    +   +IPM G   IP  N  T          GC + +Q WCK   AL  +   +SL  FTLGY   +V++ V+FS  + P +Q+LWMG  TA GS++R+V P F++  Y
Sbjct:  296 ETSTTPMTMDNFGWSRSHATLINSIILASSGICSIGIFISLKYVVKIIKEKIVFITGFVLILCSAIYMIPM-GSDKIPILNNMTEFNTTEYSSGGCNIIQQPWCKDVPALEYWQYGLSLAFFTLGYPTANVLSYVIFSRLVDPSAQSLWMGLLTASGSIARVVAPLFISKFY 466          
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Planmine SMEST
Match: SMESG000066500.1 (SMESG000066500.1)

HSP 1 Score: 51.6026 bits (122), Expect = 1.913e-6
Identity = 36/129 (27.91%), Postives = 66/129 (51.16%), Query Frame = 2
Query:  497 LILSRFIVGFGSGNVAITRTFVTAFSKPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYP-GAVNEQYFALNMFTAAGFMGAITSIVNIVLLLIYF--YDRSPYAKYANTDEINVEAAILKKLLEKS 874
            +++ RFI G GSG+       V   + PEE+TA + ++   + +G I GP       P+ +  G+V     +LN++ + GF+ AI   V  + +LI +   D+S     +++   N+   I+ K+ EK+
Sbjct:  135 VMMGRFIAGIGSGSEVPLYADVVRVTNPEERTAYIVILLLARQVGLIIGPAATLILHPIKFQIGSV-----SLNIYNSPGFLMAILWCVQTIQVLISYPDVDKSGALLKSSSQGKNINEMIIHKIYEKN 258          
The following BLAST results are available for this feature:
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFSD81.170e-2839.56major facilitator superfamily domain containing 8 ... [more]
MFSD81.170e-2839.56major facilitator superfamily domain containing 8 ... [more]
MFSD81.170e-2839.56major facilitator superfamily domain containing 8 ... [more]
MFSD81.510e-2839.56major facilitator superfamily domain containing 8 ... [more]
MFSD81.571e-2839.56major facilitator superfamily domain containing 8 ... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Y53G8AR.71.331e-2026.19pep chromosome:WBcel235:III:3282308:3290215:1 gene... [more]
ZK550.28.512e-1830.11pep chromosome:WBcel235:IV:17245584:17249750:1 gen... [more]
W05E10.15.949e-1732.00pep chromosome:WBcel235:V:11689413:11691691:-1 gen... [more]
F27D9.23.967e-1628.82pep chromosome:WBcel235:X:7672993:7676312:1 gene:W... [more]
T28C12.13.093e-1530.43pep chromosome:WBcel235:V:6331907:6334008:1 gene:W... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cln71.140e-2437.50gene:FBgn0035767 transcript:FBtr0332732[more]
Cln71.140e-2437.50gene:FBgn0035767 transcript:FBtr0332733[more]
Cln71.140e-2437.50gene:FBgn0035767 transcript:FBtr0076881[more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mfsd86.846e-3139.02major facilitator superfamily domain containing 8 ... [more]
mfsd86.846e-3139.02major facilitator superfamily domain containing 8 ... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MFSD84.630e-3642.21major facilitator superfamily domain containing 8 ... [more]
MFSD85.387e-3638.79major facilitator superfamily domain containing 8 ... [more]
MFSD81.903e-2835.84major facilitator superfamily domain containing 8 ... [more]
MFSD88.014e-2845.95major facilitator superfamily domain containing 8 ... [more]
MFSD89.140e-2736.02major facilitator superfamily domain containing 8 ... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mfsd87.162e-2840.66major facilitator superfamily domain containing 8 ... [more]
Mfsd87.162e-2840.66major facilitator superfamily domain containing 8 ... [more]
Mfsd89.873e-2639.08major facilitator superfamily domain containing 8 ... [more]
Mfsd89.873e-2639.08major facilitator superfamily domain containing 8 ... [more]
Mfsd84.936e-859.46major facilitator superfamily domain containing 8 ... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q6GPQ3|MFSD8_XENLA1.373e-3539.22Major facilitator superfamily domain-containing pr... [more]
sp|Q0VA82|MFSD8_DANRE5.168e-3039.02Major facilitator superfamily domain-containing pr... [more]
sp|Q8BH31|MFSD8_MOUSE5.010e-2740.66Major facilitator superfamily domain-containing pr... [more]
sp|Q8NHS3|MFSD8_HUMAN2.844e-2539.56Major facilitator superfamily domain-containing pr... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PPS05.362e-4242.27Major facilitator superfamily domain-containing pr... [more]
A0A0B6Y8277.963e-3842.05MFS domain-containing protein (Fragment) OS=Arion ... [more]
K1RB271.094e-3744.21Major facilitator superfamily domain-containing pr... [more]
A0A1I8HTA21.825e-3441.07MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8GXH11.977e-3440.63Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mfsd81.691e-3041.49major facilitator superfamily domain containing 8 ... [more]
mfsd83.485e-2238.30major facilitator superfamily domain containing 8 ... [more]
si:ch211-38m6.64.764e-628.10si:ch211-38m6.6 [Source:ZFIN;Acc:ZDB-GENE-070705-1... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mfsd85.328e-2337.57major facilitator superfamily domain containing 8 ... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mfsd81.933e-2635.68major facilitator superfamily domain containing 8 ... [more]
mfsd84.197e-1428.57major facilitator superfamily domain containing 8 ... [more]
ENSORLT00000008970.22.293e-726.85major facilitator superfamily domain-containing pr... [more]
si:ch211-38m6.61.546e-629.15major facilitator superfamily domain-containing pr... [more]
back to top
BLAST of Major facilitator superfamily domain-containing protein 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078496.10.000e+097.15SMESG000078496.1[more]
SMESG000078496.10.000e+096.65SMESG000078496.1[more]
SMESG000078496.10.000e+094.55SMESG000078496.1[more]
SMESG000039774.12.716e-3137.56SMESG000039774.1[more]
SMESG000066500.11.913e-627.91SMESG000066500.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016864 ID=SMED30016864|Name=Major facilitator superfamily domain-containing protein 8|organism=Schmidtea mediterranea sexual|type=transcript|length=2617bp
TTTCTGAAATTGTAAATTGTAAATTTATTTTACTTATTTCAATTTGCTCG
ATTTAATGTTTTTAAAATTAATTTTTTAATCAATTAAGTTTTATTAATTT
CCGAATTGTTAGGATTATGTTTTCATGAAAATCGAAGAAGAGGAGTCAGT
TGAAAAGTCAAAAAGTCTGAAAGAGATTTCACTTGAAAGAGAAAATATAA
TATCAGTGCGAGTTTTATTTTTAACAATGTTTCTCAGTAGTGTTGGATTT
TCAATTACTTTGCCATCAATTTGGCCATATCTAAAAGTTTTAGACGCAAA
AGTCACCAAAAAATCATTGGGCATAGTTGTAGCAATATTTTCTATTGGTC
AATTATTTGGCGGAATCATATTCGGATTGGCTATTAATCAATTGGAGTCT
TTTAGGAAGCCTTTAATTGCCTCGATTACTTTCATGTTTTTTGGAAACCT
ATTTTACTCATATTTAGCCAATTTCAAACAATATGGGAAATCTTTTTTAA
TTTTATCAAGATTTATTGTTGGATTCGGCTCAGGAAATGTGGCAATAACT
AGAACATTTGTGACGGCTTTTTCTAAGCCTGAAGAAAAGACTGCCCAAGT
TGCACTTATGAGTGCATTTCAAGGATTGGGATTTATTTTCGGGCCATGTA
TTCAAACTTCCTTTATTCCCTTGGGTTACCCTGGAGCCGTAAATGAACAG
TATTTTGCCTTGAATATGTTTACAGCTGCTGGTTTTATGGGAGCAATTAC
AAGTATCGTAAATATTGTATTGCTCCTCATTTATTTCTACGACAGAAGTC
CATATGCCAAGTACGCAAATACCGACGAAATAAATGTTGAGGCTGCAATT
CTGAAAAAATTATTGGAAAAAAGCCGATTCGGTGAATTGAGCAGGACAGT
TATGACCCGTAAGTTTTGTTTTCTGGATAAACATTTGACGTCTGTAATCA
TTCTTTTCTGGAATTCAATTGTAGTTGGAAAATCTGTAAATGCAATGGAA
TCGTTCTTAAATCGGCCCCCAATTCCAACGAAACGTAACAGCCCACTATT
GAAAGGAGAAAAGGTTAAAGATGAATCAGTTTTTATCATTGGAATGCCAG
CAACTAAGTTTGAAATGGCCATTAATGAATCCATCGTTTCAAGTGATAAA
GTTGCATCATCAGAAAATGATTTATCAGCGGCGGATATAAAGTTAGTTGA
TTCAAAGAAAAACTATATCAATCCGACAAATGAAATTGAAAAAGAGTACG
AAAATACATTTTTTCAAAAAGCAAAAGATGCTAACTCAAGATTCGCTTTT
CTGAAAGATTCTTTTGAAGAGGAGAGTCAACCGGCCATACGAATTGAGGG
AAACGACTTTCAAGATAATGGCCTGAGTATCGTTGCGATACCTCAAGTTA
TAAAAGAATCAAATAAAGACACAGAGTCAACCTTTTATAACAAAGACGAA
TCTATTTTCAAATCATTTTTCGACACTAACATTTCCGAAGTGATGACACA
AATGTTAATACATCCTTCCGAGAGACGTTCCCGAAGGATTGCATCCTTTC
CTCAAACTTCGACAGTTTATTCCAGTTATTTATTTTCAATTATGGGATCG
TTTGTTGCGCTAATTTTAAATAATTCAGCGGAAAACTCCATCCGAAGTGG
AACTTATGGCAGATGGAGAAACTCACTAATAACAAAATCTGAATTTCTCT
CTTCAATGAATTCAACGGAAAAGCATTCAAATCGTACTCAGTCTCCTTCG
TTCATGCATAGTTCTAAATTGGGAAAGATAAATGATCTGAATAAATCTGA
ATACCGATCGTCATTAGGTCCCAGTGAAAATCATTCAAACCATTCTCTGC
ACAGTGTATCCGTTTGTCGTAGTTTCGTTGAAAGAATTAGAGGGAAGAGT
GCCGAAGAAAATGAAGTAGTTTGTTGTCCGCAACAACCTGGAAAAGTAGA
CTTCCTAGGCATAACAATTGTATTATCAGTTTTATTTTCATCAATGGTTT
TGTTTTCATCTTTAGAAACAATTTTGACTCCCATGCTGATGGATAATTTT
GCTTTTGAACTTACTTACGCTTCTTTAATTGCCAGCTTAGATTTGGCTTC
GTGTGGCATTATGGGAATTTTCATTTATATCGGAATCGGATTTTCAACTA
AAAGGTATTCCAACAGAGTACATATGGTAGTAGGACAAATATTTTGTACA
CTTACTTGCTTTGTACTTATTCCAATGGTCGGAAAACCGCCAATTCCAAA
AACTAATGGAACTACTGGATGTCCAGTGACTGAGCAACTCTGGTGTAAGA
CTACCTCAGCTCTTACTATATATGCCCTTCTCATTTCCCTGTTTACATTC
ACACTAGGCTATGCAATATGCTCTGTTGTAACTACCGTTTTGTTTTCCTT
GGCCCTTGGTCCCGGTTCTCAGGCTTTATGGATGGGATTCTTTACAGCCG
TTGGTAGCCTGTCACGGATAGTCGGTCCATTTTTTGTTACTTCAGTTTAT
GCTTTCAAAGGACTGCCACTCGTATTCGGAATTTTGTTATTATTTAATGT
CATTTTACTTTGGCTGATATTTTGGTTTTATAATCGAATTGTATCTTTCA
AACCTAAATGAATATAT
back to top

protein sequence of SMED30016864-orf-1

>SMED30016864-orf-1 ID=SMED30016864-orf-1|Name=SMED30016864-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=829bp
MKIEEEESVEKSKSLKEISLERENIISVRVLFLTMFLSSVGFSITLPSIW
PYLKVLDAKVTKKSLGIVVAIFSIGQLFGGIIFGLAINQLESFRKPLIAS
ITFMFFGNLFYSYLANFKQYGKSFLILSRFIVGFGSGNVAITRTFVTAFS
KPEEKTAQVALMSAFQGLGFIFGPCIQTSFIPLGYPGAVNEQYFALNMFT
AAGFMGAITSIVNIVLLLIYFYDRSPYAKYANTDEINVEAAILKKLLEKS
RFGELSRTVMTRKFCFLDKHLTSVIILFWNSIVVGKSVNAMESFLNRPPI
PTKRNSPLLKGEKVKDESVFIIGMPATKFEMAINESIVSSDKVASSENDL
SAADIKLVDSKKNYINPTNEIEKEYENTFFQKAKDANSRFAFLKDSFEEE
SQPAIRIEGNDFQDNGLSIVAIPQVIKESNKDTESTFYNKDESIFKSFFD
TNISEVMTQMLIHPSERRSRRIASFPQTSTVYSSYLFSIMGSFVALILNN
SAENSIRSGTYGRWRNSLITKSEFLSSMNSTEKHSNRTQSPSFMHSSKLG
KINDLNKSEYRSSLGPSENHSNHSLHSVSVCRSFVERIRGKSAEENEVVC
CPQQPGKVDFLGITIVLSVLFSSMVLFSSLETILTPMLMDNFAFELTYAS
LIASLDLASCGIMGIFIYIGIGFSTKRYSNRVHMVVGQIFCTLTCFVLIP
MVGKPPIPKTNGTTGCPVTEQLWCKTTSALTIYALLISLFTFTLGYAICS
VVTTVLFSLALGPGSQALWMGFFTAVGSLSRIVGPFFVTSVYAFKGLPLV
FGILLLFNVILLWLIFWFYNRIVSFKPK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0008270zinc ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
IPR007527Znf_SWIM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 22..293
e-value: 3.9E-22
score: 80.5
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 568..820
e-value: 4.0E-8
score: 34.5
NoneNo IPR availablePANTHERPTHR23510:SF3MAJOR FACILITATOR SUPERFAMILY DOMAIN-CONTAINING PROTEIN 8coord: 6..234
NoneNo IPR availablePANTHERPTHR23510:SF3MAJOR FACILITATOR SUPERFAMILY DOMAIN-CONTAINING PROTEIN 8coord: 542..825
NoneNo IPR availablePANTHERPTHR23510FAMILY NOT NAMEDcoord: 542..825
NoneNo IPR availablePANTHERPTHR23510FAMILY NOT NAMEDcoord: 6..234
NoneNo IPR availableCDDcd17326MFS_MFSD8coord: 621..817
e-value: 3.08867E-23
score: 100.361
NoneNo IPR availableCDDcd17326MFS_MFSD8coord: 28..223
e-value: 1.22001E-53
score: 188.572
NoneNo IPR availableTMHMMTMhelixcoord: 797..819
NoneNo IPR availableTMHMMTMhelixcoord: 65..87
NoneNo IPR availableTMHMMTMhelixcoord: 681..703
NoneNo IPR availableTMHMMTMhelixcoord: 28..50
NoneNo IPR availableTMHMMTMhelixcoord: 199..221
NoneNo IPR availableTMHMMTMhelixcoord: 167..189
NoneNo IPR availableTMHMMTMhelixcoord: 652..674
NoneNo IPR availableTMHMMTMhelixcoord: 610..632
NoneNo IPR availableTMHMMTMhelixcoord: 755..777
NoneNo IPR availableTMHMMTMhelixcoord: 729..748
NoneNo IPR availableTMHMMTMhelixcoord: 125..147
NoneNo IPR availableTMHMMTMhelixcoord: 96..115
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 31..245
e-value: 7.0E-19
score: 68.0
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 27..235
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 613..822