Ubiquitin specific peptidase 48

Overview
NameUbiquitin specific peptidase 48
Smed IDSMED30016846
Length (bp)3270
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ubiquitin specific peptidase 48 (SMED30016846) t-SNE clustered cells

Violin plots show distribution of expression levels for Ubiquitin specific peptidase 48 (SMED30016846) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ubiquitin specific peptidase 48 (SMED30016846) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ubiquitin specific peptidase 48 (SMED30016846) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016846

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30016846h1SMcG0004291 Contig2854uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30016846h1SMcG0004291 Contig2854newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30016846h1SMcG0004355 Contig2854uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30016846h1SMcG0004355 Contig2854newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30016846h1SMcG0004291 SmedASXL_017356SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Human
Match: USP48 (ubiquitin specific peptidase 48 [Source:HGNC Symbol;Acc:HGNC:18533])

HSP 1 Score: 327.791 bits (839), Expect = 4.734e-95
Identity = 297/1110 (26.76%), Postives = 487/1110 (43.87%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPV---------------EDIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYI--IKAVLIHIGLQPTSGHYQTLIH-TSNQDWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNK-KNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDF-TIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCI-----------LNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNN--NEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFLSKDWYHFIEDES-IFLVWQSEWDKITN-YYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIRL----------------ISTKDDHYDVNEDGPSKKKYKVNNQINTSV--------NFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNLEI-----GFSGTKLM 3141
            M P+    K+ W + + +  EE       + Y +  +PC    C++NC  N  C+  +GE  WL      S ++ +D        N   GL N G TCY N+ LQV+F  +EL++A++  P                +  P  I  +LQ +FA +Q S  + +DP   + AL L   +QQDA EF  LFM+L++   S   +    N+++    G + Y+T C  CG ES++  +F E++L  +        + +FLK E L  DN+Y C  C  K N  R+  L +LP  L  Q +R+ +D  +G KKK    +GF   L ME YV     + K   Y+  + AVLIH G+   SGHY   +    + +W  ++D +++K+E     KK+ LG ++ +   S   T K K GK     H  S NAYM+ Y      +     N +V+VP+ L+  +   N   E +  E+   R++ V   +    + E + E +Q+         L + A   EF+ + WL KWL        I N               +C H+ L PD  I+ +K ++    D     +       R  + + C +C   +  I + +N    D+ T++N ++      V+    +WV KS LR WR+   LA+E       D +      NGS  +                N D+LCPH  L I  ++R L+ +E W+K+  YFPK           EFP   +  E CS C  L  E  +        L K+  ++++    N   +K   CLS   + D ++      LY +   F+  W++F++ P+  + V+ +  S + C HG  +        ED   I L+W SEW  I   +  D   +   I+      S    +S   +C  C +     Q +    +  + IY+                  +S+ +   D  E  P  +K    NQ N           N+       +RRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L  +   L D   T+  +G+ P S++ L  D  +   A   +D +++     GF GT L+
Sbjct:    1 MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGEHIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELELNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIGFSEILDMEPYV-----EHKGGSYVYELSAVLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEG----KKLQLGIEEDLAEPSKSQTRKPKCGK---GTH-CSRNAYMLVYR----LQTQEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGK---AKHEEVKELYQR---------LPAGAEPYEFVSLEWLQKWLDESTPTKPIDNH------------ACLCSHDKLHPD-KISIMKRISEYAADIFYSRYG---GGPRLTVKALCKECVVERCRILRLKNQLNEDYKTVNNLLKAA----VKGSDGFWVGKSSLRSWRQ---LALEQLDEQDGDAEQSNGKMNGSTLNKDESKEERKEEEELNFNEDILCPHGELCISENERRLVSKEAWSKLQQYFPKAP---------EFP---SYKECCSQCKILEREGEENEA-----LHKMIANEQKTSLPNLFQDKNRPCLSNWPE-DTDV------LYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCPHGGLMFTFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVNPSETQYISEPKLCPECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKDPDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIADYA-AMDDVMQVCMPEEGFKGTGLL 1033          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Human
Match: USP48 (ubiquitin specific peptidase 48 [Source:HGNC Symbol;Acc:HGNC:18533])

HSP 1 Score: 317.005 bits (811), Expect = 3.538e-91
Identity = 294/1122 (26.20%), Postives = 484/1122 (43.14%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPV---------------EDIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYI--IKAVLIHIGLQPTSGHYQTLIH-TSNQDWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDF-TIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCI-----------LNSDLLCPHE-------------NLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNN--NEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFLSKDWYHFIEDES-IFLVWQSEWDKITN-YYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIRL----------------ISTKDDHYDVNEDGPSKKKYKVNNQINTSV--------NFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNLEI-----GFSGTKLM 3141
            M P+    K+ W + + +  EE       + Y +  +PC    C++NC  N  C+  +GE  WL      S ++ +D        N   GL N G TCY N+ LQV+F  +EL++A++  P                +  P  I  +LQ +FA +Q S  + +DP   + AL L   +QQDA EF  LFM+L++   S   +    N+++    G + Y+T C  CG ES++  +F E++L  +        + +FLK E L  DN+Y C  C  K N  R+  L +LP  L  Q +R+ +D  +G KKK    +GF   L ME YV     + K   Y+  + AVLIH G+   SGHY   +    + +W  ++D +++K+E     KK+ LG ++ +          K GK     H  S NAYM+ Y      +     N +V+VP+ L+  +   N   E +  E+   R++ V   +    + E + E +Q+         L + A   EF+ + WL KWL        I N               +C H+ L PD  I+ +K ++    D     +       R  + + C +C   +  I + +N    D+ T++N ++      V+    +WV KS LR WR+   LA+E       D +      NGS  +                N D+LCPH               L I  ++R L+ +E W+K+  YFPK           EFP   +  E CS C  L  E  +        L K+  ++++    N   +K   CLS   + D ++      LY +   F+  W++F++ P+  + V+ +  S + C HG  +        ED   I L+W SEW  I   +  D   +   I+      S    +S   +C  C +     Q +    +  + IY+                  +S+ +   D  E  P  +K    NQ N           N+       +RRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L  +   L D   T+  +G+ P S++ L  D  +   A   +D +++     GF GT L+
Sbjct:    1 MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGEHIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELELNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIGFSEILDMEPYV-----EHKGGSYVYELSAVLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEG----KKLQLGIEEDLEPSKSQTRKPKCGK---GTH-CSRNAYMLVYR----LQTQEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGK---AKHEEVKELYQR---------LPAGAEPYEFVSLEWLQKWLDESTPTKPIDNH------------ACLCSHDKLHPD-KISIMKRISEYAADIFYSRYG---GGPRLTVKALCKECVVERCRILRLKNQLNEDYKTVNNLLKAA----VKGSDGFWVGKSSLRSWRQ---LALEQLDEQDGDAEQSNGKMNGSTLNKDESKEERKEEEELNFNEDILCPHAVFFFSKYIFLNSGELCISENERRLVSKEAWSKLQQYFPKAP---------EFP---SYKECCSQCKILEREGEENEA-----LHKMIANEQKTSLPNLFQDKNRPCLSNWPE-DTDV------LYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCPHGGLMFTFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVNPSETQYISEPKLCPECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKDPDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIADYA-AMDDVMQVCMPEEGFKGTGLL 1045          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Human
Match: USP48 (ubiquitin specific peptidase 48 [Source:HGNC Symbol;Acc:HGNC:18533])

HSP 1 Score: 298.13 bits (762), Expect = 7.127e-85
Identity = 288/1087 (26.49%), Postives = 469/1087 (43.15%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPV---------------EDIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYI--IKAVLIHIGLQPTSGHYQTLIH-TSNQDWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNK-KNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDF-TIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCI-----------LNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNN--NEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFLSKDWYHFIEDES-IFLVWQSEWDKITN-YYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIRLISTKDDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKL-QLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNLEI-----GFSGTKLM 3141
            M P+    K+ W + + +  EE       + Y +  +PC    C++NC  N  C+  +GE  WL      S ++ +D        N   GL N G TCY N+ LQV+F  +EL++A++  P                +  P  I  +LQ +FA +Q S  + +DP   + AL L   +QQDA EF  LFM+L++   S   +    N+++    G + Y+T C  CG ES++  +F E++L  +        + +FLK E L  DN+Y C  C  K N  R+  L +LP  L  Q +R+ +D  +G KKK    +GF   L ME YV     + K   Y+  + AVLIH G+   SGHY   +    + +W  ++D +++K+E     KK+ LG ++ +   S   T K K GK     H  S NAYM+ Y      +     N +V+VP+ L+  +   N   E +  E+   R++ V   +    + E + E +Q+         L + A   EF+ + WL KWL        I N               +C H+ L PD  I+ +K ++    D     +       R  + + C +C   +  I + +N    D+ T++N ++      V+    +WV KS LR WR+   LA+E       D +      NGS  +                N D+LCPH  L I  ++R L+ +E W+K+  YFPK           EFP   +  E CS C  L  E  +        L K+  ++++    N   +K   CLS   + D ++      LY +   F+  W++F++ P+  + V+ +  S + C HG  +        ED   I L+W SEW  I   +  D   +   I+      S    +S   +C  C +     Q +    +  + IY+  +   D+   + +  P         ++N S +  E D    +                   D  KD    Q+M+ +SV+P DQ+L  +   L D   T+  +G+ P S++ L  D  +   A   +D +++     GF GT L+
Sbjct:    1 MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGEHIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELELNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIGFSEILDMEPYV-----EHKGGSYVYELSAVLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEG----KKLQLGIEEDLAEPSKSQTRKPKCGK---GTH-CSRNAYMLVYR----LQTQEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGK---AKHEEVKELYQR---------LPAGAEPYEFVSLEWLQKWLDESTPTKPIDNH------------ACLCSHDKLHPD-KISIMKRISEYAADIFYSRYG---GGPRLTVKALCKECVVERCRILRLKNQLNEDYKTVNNLLKAA----VKGSDGFWVGKSSLRSWRQ---LALEQLDEQDGDAEQSNGKMNGSTLNKDESKEERKEEEELNFNEDILCPHGELCISENERRLVSKEAWSKLQQYFPKAP---------EFP---SYKECCSQCKILEREGEENEA-----LHKMIANEQKTSLPNLFQDKNRPCLSNWPE-DTDV------LYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCPHGGLMFTFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVNPSETQYISEPKLCPECREGLLCQQQRDLREYTQATIYVHKVV--DNKKVMKDSAP---------ELNVSSSETEEDKEEAK------------------PDGEKDPDFNQIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIADYA-AMDDVMQVCMPEEGFKGTGLL 981          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Human
Match: USP48 (ubiquitin specific peptidase 48 [Source:HGNC Symbol;Acc:HGNC:18533])

HSP 1 Score: 189.119 bits (479), Expect = 6.799e-51
Identity = 148/489 (30.27%), Postives = 234/489 (47.85%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPV---------------EDIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIH-TSNQDWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNK-KNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESY------LTELENQRQEKVKTQEHFIKE 1422
            M P+    K+ W + + +  EE       + Y +  +PC    C++NC  N  C+  +GE  WL      S ++ +D        N   GL N G TCY N+ LQV+F  +EL++A++  P                +  P  I  +LQ +FA +Q S  + +DP   + AL L   +QQDA EF  LFM+L++   S   +    N+++    G + Y+T C  CG ES++  +F E++L  +        + +FLK E L  DN+Y C  C  K N  R+  L +LP  L  Q +R+ +D  +G KKK    +GF   L ME YV   ++   +  Y + AVLIH G+   SGHY   +    + +W  ++D +++K+E     KK+ LG ++ +   S   T K K GK     H  S NAYM+ Y      +     N +V+VP+ L+  +   N  +      + E+  Q  +K K +   +KE
Sbjct:    1 MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGEHIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELELNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIGFSEILDMEPYV---EHKGGSYVYELSAVLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEG----KKLQLGIEEDLAEPSKSQTRKPKCGK---GTH-CSRNAYMLVYR----LQTQEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKE 474          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Human
Match: USP48 (ubiquitin specific peptidase 48 [Source:HGNC Symbol;Acc:HGNC:18533])

HSP 1 Score: 120.168 bits (300), Expect = 1.243e-27
Identity = 138/586 (23.55%), Postives = 232/586 (39.59%), Query Frame = 1
Query: 1480 LLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDF-TIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCI-----------LNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNN--NEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFLSKDWYHFIEDES-IFLVWQSEWDKITNYY--------PDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIRLISTKDDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNLEI-----GFSGTKLM 3141
            +L+ +   EF+ + WL KWL        I N               +C H+ L PD  I+ +K ++    D     +       R  + + C +C   +  I + +N    D+ T++N     LL+       +WV KS LR WR+   LA+E       D +      NGS  +                N D+LCPH  L I  ++R L+ +E W+K+  YFPK           EFP   +  E CS C  L  E  +        L K+  ++++    N   +K   CLS   + D ++      LY +   F+  W++F++ P+  + V+ +  S + C HG  +        ED   I L+W SEW  I   +          IE  +++  S+ +  S P L      C  C +     Q +    +  + IY+  +   D+   + +  P         ++N S +  E D    +         N                 Q+M+ +SV+P DQ+L  +   L D   T+  +G+ P S++ L  D  +   A   +D +++     GF GT L+
Sbjct:   18 MLAFSEPYEFVSLEWLQKWLDESTPTKPIDN------------HACLCSHDKLHPD-KISIMKRISEYAADIFYSRYG---GGPRLTVKALCKECVVERCRILRLKNQLNEDYKTVNN-----LLKAAVKGDGFWVGKSSLRSWRQ---LALEQLDEQDGDAEQSNGKMNGSTLNKDESKEERKEEEELNFNEDILCPHGELCISENERRLVSKEAWSKLQQYFPKAP---------EFP---SYKECCSQCKILEREGEENEA-----LHKMIANEQKTSLPNLFQDKNRPCLSNWPE-DTDV------LYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCPHGGLMFTFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVN-PSETQYISEPKL------CPECREGLLCQQQRDLREYTQATIYVHKVV--DNKKVMKDSAP---------ELNVSSSETEEDKEEAKPDGEKDPDFN-----------------QIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIADYAA-MDDVMQVCMPEEGFKGTGLL 519          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Celegans
Match: usp-48 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:G5ECC7])

HSP 1 Score: 109.383 bits (272), Expect = 6.904e-24
Identity = 137/525 (26.10%), Postives = 215/525 (40.95%), Query Frame = 1
Query:  100 NINWEEFMSHQFLSIYNLDKKPCQI----NSCKKNCSDNLYCINKLG------------ETKWLNNKSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRF-PVED-IPDE--------IITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD-------NVIKSLISGTFRYLTRCKGCGYESQMNCQFRE-------IDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNE-YIIKAVLIHIGLQPTSGHYQTLIHTS-NQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTEL-ENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTE-NLLSLANELEFLPMSWLTKWLT 1542
            N + ++    + + +  LD + C +    +S   NC DN +CI++LG            ETK    K   R D  D           AGL N GN CY NS LQV+FN+ E ++ I+ F P E+ +P E         +  LQ IF  +Q +     D    +  L     EQQD+ EF   F N +++   L D          +K L +G       CK CG  S+     RE       ++++   +   AL  +   E L D   + CS C    +  +Q+    LPP++  Q  RY Y + G +K     + +P  +  + +     +     E Y + AV IH G     GHY  LI +  NQ W  Y+D      E ++ + K  G +K    K    T K   K+++         Y + Y R D FK         E        + + +++ + EL E   ++K++  E  + + E  I   +  + K  T  +    ANE+ FLP + L   L 
Sbjct:   30 NTDEDQVTFSKAMEVAKLDCQKCLLHDMHSSKSSNCRDNPFCIHRLGLEKFEKLITQEQETKEEAKKDQKRRDLNDQ---------PAGLINGGNFCYVNSFLQVWFNVPEFRQLIYDFRPSENFVPPEAPRMNVQATMLALQDIFYTLQTTPFNETDKTSNLGKLLRLNSEQQDSQEFGLKFFNALER--CLPDHPNGKETLKRLKDLFTGETCTRIVCK-CGQRSE-----REETAISLTLNIEGYCTLLDALDAYFGEEHLDD---FKCSKCNKTGDVSKQSDYVKLPPVIVIQLNRYKYTSKGRQKLK-TPMAYPREIPAKAFQRTNNSIPPPAEMYDLFAVTIHEGNNAECGHYYDLIKSPLNQKWYRYND------ETVEAIPKPPGTEKPTTAK----TEKSRKKDKEKYPTDQKACYGLLYRRRDAFKPLPHPKLPPE-------ELIIDSKTEIEELFEGLTKKKIEKSEKRLYDLERRINKVKISYGKLETHSDKYKEANEVVFLPTTLLQDVLA 516          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Celegans
Match: math-33 (Ubiquitin carboxyl-terminal hydrolase 7 [Source:UniProtKB/Swiss-Prot;Acc:Q7JKC3])

HSP 1 Score: 97.4413 bits (241), Expect = 3.338e-20
Identity = 90/362 (24.86%), Postives = 155/362 (42.82%), Query Frame = 1
Query:  316 GLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDE--IITYLQTIFAQMQLSVHKMVDPVELINAL---ELPQLEQQDAPEFHSLFM-NLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLK--PMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCNVGFPSYLSMENYVNDGKN-DDKTNEYIIKAVLIHIGLQPTSGHYQTLIH----------TSNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQM 1344
            GL+N G TCY NS+LQ ++     + A++   V   P+E  I+  +Q +F ++Q++  + V+   L  A    +L    Q D  EF  + + NL  +     ++  I +L  G  +   +C    YES     F ++ L    M S ++A   +   E+L D+NKYD      +   E+      LPP+L  Q +R+ Y   G ++K      FP  +++ +    G    ++   Y + AVL+H G +   GHY T I+          TS+  W  +DD  V +    D +    G +KT                      ++S+AYM+ Y R++            ++P  +    +M
Sbjct:  197 GLRNQGATCYMNSILQSFYFTTGFRRAVYNMDVGTEPNESNIVLAMQRVFYELQMA-SEAVETNSLTRAFGWDKLDAFNQHDVQEFCRVLLDNLETKMKGTSEEKSIPNLFRGNMKSYIKCLDVDYESSRTESFYDVQLNVLGMDSLERAFEAYTTSEILDDENKYDAGDHGLQ-RAEKGVKFVELPPILHVQLMRFQY--CGVEQKINERFSFPEKMNLASCCELGPMLTEEDCVYSLHAVLVHSG-EFHGGHYVTYINVNLHESAVDPTSSAKWCKFDDDVVSRTTTDDAIVSNFGGEKT----------------------MNSSAYMLVYVRDNAIDQFLAPIPDSQIPQSVSRTFEM 531          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Celegans
Match: math-33 (Ubiquitin carboxyl-terminal hydrolase 7 [Source:UniProtKB/Swiss-Prot;Acc:Q7JKC3])

HSP 1 Score: 97.4413 bits (241), Expect = 3.450e-20
Identity = 90/362 (24.86%), Postives = 155/362 (42.82%), Query Frame = 1
Query:  316 GLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDE--IITYLQTIFAQMQLSVHKMVDPVELINAL---ELPQLEQQDAPEFHSLFM-NLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLK--PMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCNVGFPSYLSMENYVNDGKN-DDKTNEYIIKAVLIHIGLQPTSGHYQTLIH----------TSNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQM 1344
            GL+N G TCY NS+LQ ++     + A++   V   P+E  I+  +Q +F ++Q++  + V+   L  A    +L    Q D  EF  + + NL  +     ++  I +L  G  +   +C    YES     F ++ L    M S ++A   +   E+L D+NKYD      +   E+      LPP+L  Q +R+ Y   G ++K      FP  +++ +    G    ++   Y + AVL+H G +   GHY T I+          TS+  W  +DD  V +    D +    G +KT                      ++S+AYM+ Y R++            ++P  +    +M
Sbjct:  197 GLRNQGATCYMNSILQSFYFTTGFRRAVYNMDVGTEPNESNIVLAMQRVFYELQMA-SEAVETNSLTRAFGWDKLDAFNQHDVQEFCRVLLDNLETKMKGTSEEKSIPNLFRGNMKSYIKCLDVDYESSRTESFYDVQLNVLGMDSLERAFEAYTTSEILDDENKYDAGDHGLQ-RAEKGVKFVELPPILHVQLMRFQY--CGVEQKINERFSFPEKMNLASCCELGPMLTEEDCVYSLHAVLVHSG-EFHGGHYVTYINVNLHESAVDPTSSAKWCKFDDDVVSRTTTDDAIVSNFGGEKT----------------------MNSSAYMLVYVRDNAIDQFLAPIPDSQIPQSVSRTFEM 531          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Celegans
Match: math-33 (Ubiquitin carboxyl-terminal hydrolase 7 [Source:UniProtKB/Swiss-Prot;Acc:Q7JKC3])

HSP 1 Score: 97.4413 bits (241), Expect = 3.481e-20
Identity = 90/362 (24.86%), Postives = 155/362 (42.82%), Query Frame = 1
Query:  316 GLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDE--IITYLQTIFAQMQLSVHKMVDPVELINAL---ELPQLEQQDAPEFHSLFM-NLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLK--PMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCNVGFPSYLSMENYVNDGKN-DDKTNEYIIKAVLIHIGLQPTSGHYQTLIH----------TSNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQM 1344
            GL+N G TCY NS+LQ ++     + A++   V   P+E  I+  +Q +F ++Q++  + V+   L  A    +L    Q D  EF  + + NL  +     ++  I +L  G  +   +C    YES     F ++ L    M S ++A   +   E+L D+NKYD      +   E+      LPP+L  Q +R+ Y   G ++K      FP  +++ +    G    ++   Y + AVL+H G +   GHY T I+          TS+  W  +DD  V +    D +    G +KT                      ++S+AYM+ Y R++            ++P  +    +M
Sbjct:  197 GLRNQGATCYMNSILQSFYFTTGFRRAVYNMDVGTEPNESNIVLAMQRVFYELQMA-SEAVETNSLTRAFGWDKLDAFNQHDVQEFCRVLLDNLETKMKGTSEEKSIPNLFRGNMKSYIKCLDVDYESSRTESFYDVQLNVLGMDSLERAFEAYTTSEILDDENKYDAGDHGLQ-RAEKGVKFVELPPILHVQLMRFQY--CGVEQKINERFSFPEKMNLASCCELGPMLTEEDCVYSLHAVLVHSG-EFHGGHYVTYINVNLHESAVDPTSSAKWCKFDDDVVSRTTTDDAIVSNFGGEKT----------------------MNSSAYMLVYVRDNAIDQFLAPIPDSQIPQSVSRTFEM 531          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Celegans
Match: math-33 (Ubiquitin carboxyl-terminal hydrolase 7 [Source:UniProtKB/Swiss-Prot;Acc:Q7JKC3])

HSP 1 Score: 97.4413 bits (241), Expect = 3.629e-20
Identity = 91/363 (25.07%), Postives = 155/363 (42.70%), Query Frame = 1
Query:  316 GLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDE--IITYLQTIFAQMQLSVHKMVDPVELINAL---ELPQLEQQDAPEFHSLFM-NLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLK--PMLSFDQALLDFLKVELLTDDNKYDCSCCMHKC-NGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCNVGFPSYLSMENYVNDGKN-DDKTNEYIIKAVLIHIGLQPTSGHYQTLIH----------TSNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQM 1344
            GL+N G TCY NS+LQ ++     + A++   V   P+E  I+  +Q +F ++Q++  + V+   L  A    +L    Q D  EF  + + NL  +     ++  I +L  G  +   +C    YES     F ++ L    M S ++A   +   E+L D+NKYD     H     E+      LPP+L  Q +R+ Y   G ++K      FP  +++ +    G    ++   Y + AVL+H G +   GHY T I+          TS+  W  +DD  V +    D +    G +KT                      ++S+AYM+ Y R++            ++P  +    +M
Sbjct:  194 GLRNQGATCYMNSILQSFYFTTGFRRAVYNMDVGTEPNESNIVLAMQRVFYELQMA-SEAVETNSLTRAFGWDKLDAFNQHDVQEFCRVLLDNLETKMKGTSEEKSIPNLFRGNMKSYIKCLDVDYESSRTESFYDVQLNVLGMDSLERAFEAYTTSEILDDENKYDAGD--HGLQRAEKGVKFVELPPILHVQLMRFQY--CGVEQKINERFSFPEKMNLASCCELGPMLTEEDCVYSLHAVLVHSG-EFHGGHYVTYINVNLHESAVDPTSSAKWCKFDDDVVSRTTTDDAIVSNFGGEKT----------------------MNSSAYMLVYVRDNAIDQFLAPIPDSQIPQSVSRTFEM 528          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Fly
Match: Usp7 (gene:FBgn0030366 transcript:FBtr0073641)

HSP 1 Score: 95.5153 bits (236), Expect = 1.593e-19
Identity = 85/331 (25.68%), Postives = 144/331 (43.50%), Query Frame = 1
Query:  313 AGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVE--DIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLE---QQDAPEFHSLFMNLVDQRF-SLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCN-GERQTVLQTLPPLLCFQFLRYSYDN-SGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHT-SNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQ-NIHFVSSNAYMVFYERE 1269
             GLKN G TCY NSLLQ  +    L+ +++R P E  D    +   LQ +F ++Q    + V   +L  +     L+   Q D  EF  + ++ ++ +    I +  I  L  G      +CK   Y S     F +I L  K   +  ++  D++  E L  DNKYD    +H      +  +  + PP+L    +R+ YD  + +  K      F  +++++ Y+ + +N     +Y++ AVL+H G     GHY   I+  ++  W  +DD  V                 +   K + I     G + + + H   SNAYM+ Y R+
Sbjct:  241 VGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLSLQRVFHELQFG-DRPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSSYIKCKNVDYNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAG--VHGLQEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEHINLDRYLAESEN--TLADYVLHAVLVHSG-DNHGGHYVVFINPKADGRWFKFDDDVV-----------------SSCRKQEAIEQNYGGMDDEISFHAKCSNAYMLVYIRQ 548          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Fly
Match: Usp7 (gene:FBgn0030366 transcript:FBtr0342732)

HSP 1 Score: 95.5153 bits (236), Expect = 1.791e-19
Identity = 85/331 (25.68%), Postives = 144/331 (43.50%), Query Frame = 1
Query:  313 AGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVE--DIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLE---QQDAPEFHSLFMNLVDQRF-SLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCN-GERQTVLQTLPPLLCFQFLRYSYDN-SGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHT-SNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQ-NIHFVSSNAYMVFYERE 1269
             GLKN G TCY NSLLQ  +    L+ +++R P E  D    +   LQ +F ++Q    + V   +L  +     L+   Q D  EF  + ++ ++ +    I +  I  L  G      +CK   Y S     F +I L  K   +  ++  D++  E L  DNKYD    +H      +  +  + PP+L    +R+ YD  + +  K      F  +++++ Y+ + +N     +Y++ AVL+H G     GHY   I+  ++  W  +DD  V                 +   K + I     G + + + H   SNAYM+ Y R+
Sbjct:  241 VGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSSKSVGLSLQRVFHELQFG-DRPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTILEGTIPGLFEGKMSSYIKCKNVDYNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAG--VHGLQEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEHINLDRYLAESEN--TLADYVLHAVLVHSG-DNHGGHYVVFINPKADGRWFKFDDDVV-----------------SSCRKQEAIEQNYGGMDDEISFHAKCSNAYMLVYIRQ 548          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Fly
Match: puf (gene:FBgn0039214 transcript:FBtr0084667)

HSP 1 Score: 91.2781 bits (225), Expect = 4.557e-18
Identity = 95/387 (24.55%), Postives = 158/387 (40.83%), Query Frame = 1
Query:  316 GLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDEIITYL--QTIFAQMQLSVHKMVDPVELINALELPQL-----EQQDAPEFHSLFMNLVDQRFSLIDD--NVIKSLISGTFRYLTRCKGCGYESQMNCQFREI--DLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDN-SGTKKKNCCNVGFPSYLSMENYVN----------------------DGKNDDKTN---------------EYIIKAVLIHIGLQPTSGHYQTLI-------HTSNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSN-AYMVFYER---EDVFKNHTTI 1296
            GL N G TCY  S +Q  + + + + A+ R P         T L  Q +FA +  S  K  +P       ++        EQ+D  EF   F++LV +   +  D  +++K L  G+         CG+ S+    F  +   +  M +  ++L +    + L  DN Y CS C  K   E++   + LP +LCF  +RY+++  +  K+K   +  FP  L+M +YV                       DG  D   N               EY +  V +H G     GHY + I       + +++ W L++D  V+  +      +  G + T     D +T K       +  F  +N AYM+FYER   E + + H+ +
Sbjct: 2016 GLTNLGATCYMASCVQHLYMMPQARAAVLRVPPNAARKHGPTLLELQRMFAYLLESERKSYNPRSFCRVYQMDHQPLNTGEQKDMAEF---FIDLVSKLEDMTPDLKHLVKRLFCGSLSNNVVSLDCGHVSRTAEDFYTVRCQVADMRNLQESLDEVTVKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPQILCFNTMRYTFNMVTMLKEKVNTHFSFPLRLNMCHYVEKTLMPQQYKEERERRQKEKEGADGSGDGNDNEKAEATLDDDIEECYEYELVGVTVHTGTA-DGGHYYSFIKERTKTSYHTHERWFLFNDAEVKPFDPSQIAAECFGGEMT-SKTYDSVTEK-----YLDFSFEKTNSAYMLFYERRLPEHLQRRHSEL 2392          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Fly
Match: puf (gene:FBgn0039214 transcript:FBtr0330309)

HSP 1 Score: 90.8929 bits (224), Expect = 6.183e-18
Identity = 95/387 (24.55%), Postives = 158/387 (40.83%), Query Frame = 1
Query:  316 GLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDEIITYL--QTIFAQMQLSVHKMVDPVELINALELPQL-----EQQDAPEFHSLFMNLVDQRFSLIDD--NVIKSLISGTFRYLTRCKGCGYESQMNCQFREI--DLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDN-SGTKKKNCCNVGFPSYLSMENYVN----------------------DGKNDDKTN---------------EYIIKAVLIHIGLQPTSGHYQTLI-------HTSNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSN-AYMVFYER---EDVFKNHTTI 1296
            GL N G TCY  S +Q  + + + + A+ R P         T L  Q +FA +  S  K  +P       ++        EQ+D  EF   F++LV +   +  D  +++K L  G+         CG+ S+    F  +   +  M +  ++L +    + L  DN Y CS C  K   E++   + LP +LCF  +RY+++  +  K+K   +  FP  L+M +YV                       DG  D   N               EY +  V +H G     GHY + I       + +++ W L++D  V+  +      +  G + T     D +T K       +  F  +N AYM+FYER   E + + H+ +
Sbjct: 2016 GLTNLGATCYMASCVQHLYMMPQARAAVLRVPPNAARKHGPTLLELQRMFAYLLESERKSYNPRSFCRVYQMDHQPLNTGEQKDMAEF---FIDLVSKLEDMTPDLKHLVKRLFCGSLSNNVVSLDCGHVSRTAEDFYTVRCQVADMRNLQESLDEVTVKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPQILCFNTMRYTFNMVTMLKEKVNTHFSFPLRLNMCHYVEKTLMPQQYKEERERRQKEKEGADGSGDGNDNEKAEATLDDDIEECYEYELVGVTVHTGTA-DGGHYYSFIKERTKTSYHTHERWFLFNDAEVKPFDPSQIAAECFGGEMT-SKTYDSVTEK-----YLDFSFEKTNSAYMLFYERRLPEHLQRRHSEL 2392          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Fly
Match: puf (gene:FBgn0039214 transcript:FBtr0306172)

HSP 1 Score: 89.7373 bits (221), Expect = 1.344e-17
Identity = 92/374 (24.60%), Postives = 152/374 (40.64%), Query Frame = 1
Query:  316 GLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDE--IITYLQTIFAQMQLSVHKMVDPVELINALELPQL-----EQQDAPEFHSLFMNLVDQRFSLIDD--NVIKSLISGTFRYLTRCKGCGYESQMNCQFREI--DLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDN-SGTKKKNCCNVGFPSYLSMENYVN----------------------DGKNDDKTN---------------EYIIKAVLIHIGLQPTSGHYQTLI-------HTSNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSN-AYMVFYER 1266
            GL N G TCY  S +Q  + + + + A+ R P          +  LQ +FA +  S  K  +P       ++        EQ+D  EF   F++LV +   +  D  +++K L  G+         CG+ S+    F  +   +  M +  ++L +    + L  DN Y CS C  K   E++   + LP +LCF  +RY+++  +  K+K   +  FP  L+M +YV                       DG  D   N               EY +  V +H G     GHY + I       + +++ W L++D  V+  +      +  G + T     D +T K       +  F  +N AYM+FYER
Sbjct: 2016 GLTNLGATCYMASCVQHLYMMPQARAAVLRVPPNAARKHGPTLLELQRMFAYLLESERKSYNPRSFCRVYQMDHQPLNTGEQKDMAEF---FIDLVSKLEDMTPDLKHLVKRLFCGSLSNNVVSLDCGHVSRTAEDFYTVRCQVADMRNLQESLDEVTVKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPQILCFNTMRYTFNMVTMLKEKVNTHFSFPLRLNMCHYVEKTLMPQQYKEERERRQKEKEGADGSGDGNDNEKAEATLDDDIEECYEYELVGVTVHTG-TADGGHYYSFIKERTKTSYHTHERWFLFNDAEVKPFDPSQIAAECFGGEMT-SKTYDSVTEK-----YLDFSFEKTNSAYMLFYER 2379          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Zebrafish
Match: usp48 (ubiquitin specific peptidase 48 [Source:ZFIN;Acc:ZDB-GENE-050522-197])

HSP 1 Score: 345.895 bits (886), Expect = 1.005e-101
Identity = 303/1128 (26.86%), Postives = 506/1128 (44.86%), Query Frame = 1
Query:   64 MKPK---RKSKWNFDNINWEEFMSHQFLSI-YNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDI----------PDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSN-QDWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKV---KTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVI-----RLAIENKFNDSTDIQDET-----------NSSNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNNNEKKLICL-----SPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFL-SKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISI---------KSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIR-------------------------------LISTKDDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNL------EIGFSGTKLM 3141
            M P+    K+ W +      E ++H+ + + Y +    C+  +C++NC  N  C+  +GE  WL      + ++ +D      D N   GL N G TCY N+ LQV+F+ +EL+ A++RF               P  I  +LQ +FA +Q S  + +DP  L+ AL L   +QQDA EF  LF++L++   S   D    NVI+    G F Y+T C  CG ES +  +F E++L  +   +  + + +FLK E L  DN+Y C  C  K N  R+  LQ+LP  L FQ +R+ +D  SG KKK    + FP  L ME ++ +G+ +  T  Y + AVLIH G+   SGHY   +  ++  DW  ++D  ++K+E     KK+ LG ++ +   +   T K   K  +  H  S NAYM+ Y+++    N T   + V+VP+ L+  ++  N   E + +E+ + R++ V   K +   +KE   ++ A                    EF+P+ WL KWL +   +  I NS              +C H  L PD  I + K ++    D L   +       R   SS C  C   +  + + +N    D+     + K  L++ E+   +W+ K+ LR WR++          E K N+S    +++           +S +G  +++    N D+LC H  LSI  + R L+  E+WNK+  YFPK             P      + C  C  L  E             K   +  R   N  +  L+ L      P+ Q   +   +   LY +P  F+  WK+FI+ P+    V+ +  S + C HG F+ + D     + + I L+W +EW+ I+  +  +  + ISI           + +  + P L      C  C + +   Q +    +  + +Y+R                               L   KD  +   E G  ++K      + T+V       + +RRS R ++ R +  L ++++ T+KD+K+Q+M+ +SV+P DQ+L  +   L D + T+ ++G+ P SI+ L  D  +   A  + D++      E GF GT L+
Sbjct:    1 MAPRLQLEKAAWRWAEAVRPEDITHEHIELAYRIAVSACKRGACRRNCKGNPNCLVGIGEQSWLGEIDENTFHNIDDPNSERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRALYRFQNSRAEGHNTDSDYEPRTICEHLQYLFALLQNSNRRYIDPSGLVKALGLDTGQQQDAQEFSKLFLSLLEDTLSKQKDPNLQNVIQQQFCGQFSYVTVCNKCGRESPLPSRFYELELNIQGHKNLTECVTEFLKEEKLDGDNRYYCESCQSKQNATRRIKLQSLPRTLNFQLMRFVFDRQSGHKKKLNTFISFPEVLDMEPFL-EGREEKCT--YELSAVLIHRGVSAYSGHYIAHVRDAHTNDWYKFNDEEIEKMEG----KKLQLGIEEDIAETAKSQTRKP--KCSKGYH-CSRNAYMLVYKQQTEEINQT--ESPVDVPAFLQKLVEQDNRKFEEWCSEMSDMRKQSVDKGKAKHEEVKELYELLPAED--------------GQSYEFVPLEWLKKWLDDSTAIKEIDNSQ------------FLCTHGKLHPD-KIGEAKRISLKAADLLFSRYGGGPRLDR---SSLCRDCVTQRCRVIRLKNQLNEDYREVTNLAKSALKSEESG--FWIGKASLRSWRQLALDQLEEDEEETKHNNSKINGEKSSPGTKADGVKGDSEDGDGEEMK-NFNEDILCYHGGLSILENDRRLVSAEVWNKLRMYFPKA------------PEFTQDHDPCQQCMRLERE------------GKENEALNRMMANEQKSSLLNLFQEKNRPTLQ---KWPQDTDILYIVPLYFVEEWKKFIRRPAKGNPVSNVGNSILLCPHGGFMFTYDSMLQGDAQHIALLWPAEWEVISKMF--LVDQVISICRIHDKTQDNGNVQYQTHPDL------CRECREGFIFQQQRDMREYTQATVYVRKVIDKKRMIKESAPEFSVSGSDVEDEKEEPKLDGEKDPDFSQTEGGAKRQKLNDTVSLPTAV-VTTTSKSGIRRSTRHRKLRGEKALIVSANQTLKDLKIQIMHAFSVAPFDQNLSIDGRCLKDDSATLGSLGVIPESIICLKADEPIADYA--AMDDVYQVCMPEEGFKGTGLL 1045          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Zebrafish
Match: usp48 (ubiquitin specific peptidase 48 [Source:ZFIN;Acc:ZDB-GENE-050522-197])

HSP 1 Score: 344.739 bits (883), Expect = 5.243e-101
Identity = 303/1128 (26.86%), Postives = 506/1128 (44.86%), Query Frame = 1
Query:   64 MKPK---RKSKWNFDNINWEEFMSHQFLSI-YNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDI----------PDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQ-DWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKV---KTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVI-----RLAIENKFNDSTDIQDET-----------NSSNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNNNEKKLICL-----SPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFL-SKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISI---------KSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIR-------------------------------LISTKDDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNL------EIGFSGTKLM 3141
            M P+    K+ W +      E ++H+ + + Y +    C+  +C++NC  N  C+  +GE  WL      + ++ +D      D N   GL N G TCY N+ LQV+F+ +EL+ A++RF               P  I  +LQ +FA +Q S  + +DP  L+ AL L   +QQDA EF  LF++L++   S   D    NVI+    G F Y+T C  CG ES +  +F E++L  +   +  + + +FLK E L  DN+Y C  C  K N  R+  LQ+LP  L FQ +R+ +D  SG KKK    + FP  L ME ++ +G+ +  T  Y + AVLIH G+   SGHY   +  ++  DW  ++D  ++K+E     KK+ LG ++ +   +   T K   K  +  H  S NAYM+ Y+++    N T   + V+VP+ L+  ++  N   E + +E+ + R++ V   K +   +KE   ++ A                    EF+P+ WL KWL +   +  I NS              +C H  L PD  I + K ++    D L   +       R   SS C  C   +  + + +N    D+     + K  L++ E+   +W+ K+ LR WR++          E K N+S    +++           +S +G  +++    N D+LC H  LSI  + R L+  E+WNK+  YFPK             P      + C  C  L  E             K   +  R   N  +  L+ L      P+ Q   +   +   LY +P  F+  WK+FI+ P+    V+ +  S + C HG F+ + D     + + I L+W +EW+ I+  +  +  + ISI           + +  + P L      C  C + +   Q +    +  + +Y+R                               L   KD  +   E G  ++K      + T+V       + +RRS R ++ R +  L ++++ T+KD+K+Q+M+ +SV+P DQ+L  +   L D + T+ ++G+ P SI+ L  D  +   A  + D++      E GF GT L+
Sbjct:   46 MAPRLQLEKAAWRWAEAVRPEDITHEHIELAYRIAVSACKRGACRRNCKGNPNCLVGIGEQSWLGEIDENTFHNIDDPNSERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRALYRFQNSRAEGHNTDSDYEPRTICEHLQYLFALLQNSNRRYIDPSGLVKALGLDTGQQQDAQEFSKLFLSLLEDTLSKQKDPNLQNVIQQQFCGQFSYVTVCNKCGRESPLPSRFYELELNIQGHKNLTECVTEFLKEEKLDGDNRYYCESCQSKQNATRRIKLQSLPRTLNFQLMRFVFDRQSGHKKKLNTFISFPEVLDMEPFL-EGREEKCT--YELSAVLIHRGVSAYSGHYIAHVRDAHTNDWYKFNDEEIEKMEG----KKLQLGIEEDIAETAKSQTRKP--KCSKGYH-CSRNAYMLVYKQQTEEINQT--ESPVDVPAFLQKLVEQDNRKFEEWCSEMSDMRKQSVDKGKAKHEEVKELYELLPAED--------------GQSYEFVPLEWLKKWLDDSTAIKEIDNSQ------------FLCTHGKLHPD-KIGEAKRISLKAADLLFSRYGGGPRLDR---SSLCRDCVTQRCRVIRLKNQLNEDYREVTNLAKSALKSEESG--FWIGKASLRSWRQLALDQLEEDEEETKHNNSKINGEKSSPGTKADGVKGDSEDGDGEEMK-NFNEDILCYHGGLSILENDRRLVSAEVWNKLRMYFPKA------------PEFTQDHDPCQQCMRLERE------------GKENEALNRMMANEQKSSLLNLFQEKNRPTLQ---KWPQDTDILYIVPLYFVEEWKKFIRRPAKGNPVSNVGNSILLCPHGGFMFTYDSMLQGDAQHIALLWPAEWEVISKMF--LVDQVISICRIHDKTQDNGNVQYQTHPDL------CRECREGFIFQQQRDMREYTQATVYVRKVIDKKRMIKESAPEFSVSGSDVEDEKEEPKLDGEKDPDFSQTEGGAKRQKLNDTVSLPTAV-VTTTSKSGIRRSTRHRKLRGEKALIVSANQTLKDLKIQIMHAFSVAPFDQNLSIDGRCLKDDSATLGSLGVIPESIICLKADEPIADYA--AMDDVYQVCMPEEGFKGTGLL 1090          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Zebrafish
Match: usp48 (ubiquitin specific peptidase 48 [Source:ZFIN;Acc:ZDB-GENE-050522-197])

HSP 1 Score: 229.95 bits (585), Expect = 5.746e-65
Identity = 167/534 (31.27%), Postives = 267/534 (50.00%), Query Frame = 1
Query:   64 MKPK---RKSKWNFDNINWEEFMSHQFLSI-YNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDI----------PDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQ-DWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKV---KTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNS 1575
            M P+    K+ W +      E ++H+ + + Y +    C+  +C++NC  N  C+  +GE  WL      + ++ +D      D N   GL N G TCY N+ LQV+F+ +EL+ A++RF               P  I  +LQ +FA +Q S  + +DP  L+ AL L   +QQDA EF  LF++L++   S   D    NVI+    G F Y+T C  CG ES +  +F E++L  +   +  + + +FLK E L  DN+Y C  C  K N  R+  LQ+LP  L FQ +R+ +D  SG KKK    + FP  L ME ++ +G+ +  T  Y + AVLIH G+   SGHY   +  ++  DW  ++D  ++K+E     KK+ LG ++ +   +   T K   K  +  H  S NAYM+ Y+++    N T   + V+VP+ L+  ++  N   E + +E+ + R++ V   K +   +KE   ++ A                    EF+P+ WL KWL +   +  I NS
Sbjct:    2 MAPRLQLEKAAWRWAEAVRPEDITHEHIELAYRIAVSACKRGACRRNCKGNPNCLVGIGEQSWLGEIDENTFHNIDDPNSERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRALYRFQNSRAEGHNTDSDYEPRTICEHLQYLFALLQNSNRRYIDPSGLVKALGLDTGQQQDAQEFSKLFLSLLEDTLSKQKDPNLQNVIQQQFCGQFSYVTVCNKCGRESPLPSRFYELELNIQGHKNLTECVTEFLKEEKLDGDNRYYCESCQSKQNATRRIKLQSLPRTLNFQLMRFVFDRQSGHKKKLNTFISFPEVLDMEPFL-EGREEKCT--YELSAVLIHRGVSAYSGHYIAHVRDAHTNDWYKFNDEEIEKMEG----KKLQLGIEEDIAETAKSQTRKP--KCSKGYH-CSRNAYMLVYKQQTEEINQT--ESPVDVPAFLQKLVEQDNRKFEEWCSEMSDMRKQSVDKGKAKHEEVKELYELLPA--------------EDGQSYEFVPLEWLKKWLDDSTAIKEIDNS 509          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Zebrafish
Match: usp47 (ubiquitin specific peptidase 47 [Source:ZFIN;Acc:ZDB-GENE-070719-7])

HSP 1 Score: 100.138 bits (248), Expect = 1.016e-20
Identity = 106/441 (24.04%), Postives = 174/441 (39.46%), Query Frame = 1
Query:  286 ILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDEIITY----LQTIFAQMQLSVHKMVDPVELINALELPQLE---QQDAPEFHSLFMNLVDQRFSLIDD-NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--------KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKK-KNCCNVGFPSYLSMENYV------------------------------NDGKNDDKTNEYI---------------------IKAVLIHIGLQPTSGHYQTLIHT-SNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSS-NAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTELENQRQEKVK 1398
            ILN       GL N   TCY NSLLQ  F   E + A++ +  ED  ++ +T     LQ +F  +Q S  + ++  ++  +      E   Q D  E   +  + ++Q++   +  ++I  L  G  +   RC  CGYES     + +I L        +   S ++AL  F++ E L   N+Y C  C  KC+  +       P LL  Q  R+ +D +   + K    + FP  L M  ++                              ND   DD  +E I                     + +V++H G     GHY   I + S+  W  ++D +V K+   DD++K  G                      +  F SS NAYM+ Y  +D  +N   +    + P H+K  +Q   ES   E + +RQ +++
Sbjct:  163 ILNKSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYNWEFEDSEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKLKDYVRCLECGYESWRIDTYLDIPLVIRPFGASQAFGSVEEALQAFIQPETLDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSPFIDVEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSTDDGVDEGICLDNASSAERVLKPKSSLTFELFSVMVHSG-SAAGGHYYACIKSFSDSQWYSFNDQHVSKITQ-DDIRKTYGGSSGSRGYY-------------SSAFASSTNAYMLMYRLKDPSRNAKFLEVE-DFPEHIKRLVQREKES---EEQEKRQREIE 584          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Zebrafish
Match: usp46 (ubiquitin specific peptidase 46 [Source:NCBI gene;Acc:100148916])

HSP 1 Score: 94.3597 bits (233), Expect = 4.884e-20
Identity = 83/308 (26.95%), Postives = 131/308 (42.53%), Query Frame = 1
Query:  316 GLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDE-IITYLQTIFAQMQLSVHKM--VDPVELINALE-----LPQLEQQDAPEFHSLFMNLV----------------------------DQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFRE--IDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSY-DNSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQDWILYDDLNVQKLE 1122
            GL N+GNTCY NS+LQ  +     +E +  + V+    E ++T L  +F  +     K+  + P + I+ L           QQDA EF +  +N V                            +   + ID   +  +  GT    TRC  C   S  +  F +  +D++   S    L DF   E L  + KY C  C  K   +++  ++ LP +L     R+ Y +      K    V FP  L + N   D  N D+   Y + AV++H G  P  GHY T++  S+  W+L+DD  V+K++
Sbjct:   36 GLVNFGNTCYCNSVLQALYFCRPFRENVLAYKVQQKKKENLLTCLADLFHSIATQKKKVGVIPPKKFISRLRKENDLFDNYMQQDAHEFLNYLLNTVADILQEERKQEKQNGRLKNNGTAIATDTEPEQNKIDPTWVHEIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQNTSITHCLRDFSNTETLCSEYKYYCEMCCSKQEAQKRMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSGDAVNLDRM--YDLVAVVVHCGSGPNRGHYITIV-KSHGFWLLFDDDIVEKID 340          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Xenopus
Match: ptp4a2 (protein tyrosine phosphatase type IVA, member 2 [Source:Xenbase;Acc:XB-GENE-1007312])

HSP 1 Score: 329.331 bits (843), Expect = 1.337e-95
Identity = 294/1118 (26.30%), Postives = 482/1118 (43.11%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLN--NKSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFP---------------VEDIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDDNVIKSLIS----GTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIH-TSNQDWILYDDLNVQKLENID---DVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDF-TIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFND-----------STDIQDETNSSNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFE----YNNNEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFLSKDWYHFIEDESIFL-VWQSEWDKITNYYPDIEFENISIKSDFKLSSFPTLV----SSIIVCNSCFKIWSTLQTK----FENSVIYIRLISTK-------------------DDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDP--------NTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNLEI-----GFSGTKLM 3141
            M P+    K+ W + D +  EE       + Y +  +PC    C++NC  N  C+  +GE  WL   +++   N  + N        F  GL N G TCY N+ +QV+F  +EL+ A++ +                 E  P  I  +LQ +FA +Q S  + +DP   I AL L   +QQDA EF  LFM+L++   S   + ++K++I     G + Y+T C  C  ES++  +F E++L  +      + + +FLK E L  DN+Y C  C  K N  R+  L  LPP L  Q +R+ +D  +G KKK    +GF   L M+ Y++     D T  Y + AVLIH G+   SGHY   +      +W  ++D +++K+E       +++ L Q KT   K       K GK    IH  S NAYM+ Y  + V K   T     EVP+ L+  +++ N   E +  E+ + R+E V   +    + E + E +Q+L     +          EF+P+ WL KWL        I NS              +C H  L PD  I+ +K ++    D   + +       R    + C  C   +  + + +N    D+ ++ N V+ P    VE+ + +W+ KS LR+WR++    ++ +  D           S    +E         D     N D++C H  LSI  S+R L+ E  W K+ +YFP              P   +  E CS C  L  E  +        L K+  + ++      + +  + L+   P         T E F+  +   F+  W++FI+ P+    V  I  S + C HG  +        ED  +   +W +EWD I   +  I    I I          T      S   +C  C +     Q +    +  + IYI  +  +                   D+  +   DG +   +   NQ+N +   +++            VRRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L      L D   T+ N+GI P S++ L  D  +   A   +D +++     GF GT L+
Sbjct:    1 MAPRLQLEKAAWKWTDTVRPEEVGQEHIEAAYRVRLEPCVRGICRRNCKGNPNCLVGVGEHIWLGEIDENTFHNIDDPNSERRKKNTFV-GLTNLGATCYVNTFVQVWFLNMELRRALYLYENSWSAEKAEQCIQEDKEYEPQTICEHLQYLFALLQNSNRRYIDPSSFIKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKEPIVKNIIQEQFCGQYAYVTICSQCSRESRLVSKFYELELNIQGHKQLTECIAEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLDLPPTLNLQLMRFVFDRQTGHKKKLNTYIGFSETLDMDPYLD---QTDGTYSYELSAVLIHRGVSAYSGHYIAHVKDPQTGEWYKFNDEDIEKMEGKKLQLGIEEDLEQSKTAPRKP------KCGK---GIH-CSRNAYMLVYRLKTVEKQDVTF----EVPAFLQKLVELDNCKFEEWCVEMVDMRRESVDKGK---AKHEEVKELYQRLPAGADS--------AYEFVPLEWLQKWLDESTPTKPIDNS------------KCLCSHGKLHPD-KISLMKRISQHAADIFYKRYG---GSPRLTDDALCKDCVVERCRVLRLKNQLNEDYKSLTNMVKLP----VESNEGFWIGKSSLRRWRQLATEQLDQQEEDLAQGDWKVNGESPKACEEGIDEEKKEADSELGFNEDIICQHGGLSISESERRLISEAAWYKLKEYFPTA------------PEFRHSQESCSQCKVLEQEGERHEA-----LHKMMANDQKTALPNLFQDKNRPLLGSWPQD-------TAEFFV--VSQFFVEEWRKFIRRPTKSNPVMSIGNSLLLCPHGGLMISFTNMTKEDAKLIAPIWPAEWDAIQKLF--IVDHTIKISRTVVTREDRTFTVDYESDPKLCPDCREGLLCQQQRDLREYAQATIYIHKVVDRKKVMKEVAPELNVSSSDLEDEKDEPRADGETDPDF---NQVNGTAKRQKLSGQGHVSTQKQGVRRSTRHRKVRGERALLVSANQTLKELKIQIMHAFSVAPFDQNLSIEGKILSDDAATLGNLGIVPESVILLKADEPMADYA-AMDDVMQVCMPEEGFKGTGLL 1037          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Xenopus
Match: ptp4a2 (protein tyrosine phosphatase type IVA, member 2 [Source:Xenbase;Acc:XB-GENE-1007312])

HSP 1 Score: 326.25 bits (835), Expect = 1.086e-94
Identity = 291/1095 (26.58%), Postives = 471/1095 (43.01%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLN--NKSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIF---RFPVEDI-----------PDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDDNVIKSLIS----GTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIH-TSNQDWILYDDLNVQKLENID---DVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDF-TIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSF-----------KDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFE----YNNNEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFLSKDWYHFIEDESIFL-VWQSEWDKITNYYPDIEFENISIKSDFKLSSFPTLV----SSIIVCNSCFKIWSTLQTK----FENSVIYIRLISTK-------------------DDHYDVNEDGPSKKKYKVNNQINTSVNFKEI--------DPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIA 3090
            M P+    K+ W + D +  EE       + Y +  +PC    C++NC  N  C+  +GE  WL   +++   N  + N        F  GL N G TCY N+ +QV+F  +EL+ A++     P + +           P  I  +LQ +FA +Q S  + +DP   I AL L   +QQDA EF  LFM+L++   S   + ++K++I     G + Y+T C  C  ES++  +F E++L  +      + + +FLK E L  DN+Y C  C  K N  R+  L  LPP L  Q +R+ +D  +G KKK    +GF   L M+ Y++     D T  Y + AVLIH G+   SGHY   +      +W  ++D +++K+E       +++ L Q KT   K       K GK    IH  S NAYM+ Y  + V K   T     EVP+ L+  +++ N   E +  E+ + R+E V   +    + E + E +Q+L     +          EF+P+ WL KWL        I NS              +C H  L PD  I+ +K ++    D   + +       R    + C  C   +  + + +N    D+ ++ N V+ P    VE+ + +W+ KS LR+WR+   LA E       D+       NG              D     N D++C H  LSI  S+R L+ E  W K+ +YFP              P   +  E CS C  L  E  +        L K+  + ++      + +  + L+   P         T E F+  +   F+  W++FI+ P+    V  I  S + C HG  +        ED  +   +W +EWD I   +  I    I I          T      S   +C  C +     Q +    +  + IYI  +  +                   D+  +   DG +   +   NQ+N +   +++            VRRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L      L D   T+ N+GI P S++ L  D  +   A
Sbjct:    1 MAPRLQLEKAAWKWTDTVRPEEVGQEHIEAAYRVRLEPCVRGICRRNCKGNPNCLVGVGEHIWLGEIDENTFHNIDDPNSERRKKNTFV-GLTNLGATCYVNTFVQVWFLNMELRRALYLETSQPDQQVGETIRRHEKYEPQTICEHLQYLFALLQNSNRRYIDPSSFIKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKEPIVKNIIQEQFCGQYAYVTICSQCSRESRLVSKFYELELNIQGHKQLTECIAEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLDLPPTLNLQLMRFVFDRQTGHKKKLNTYIGFSETLDMDPYLD---QTDGTYSYELSAVLIHRGVSAYSGHYIAHVKDPQTGEWYKFNDEDIEKMEGKKLQLGIEEDLEQSKTAPRKP------KCGK---GIH-CSRNAYMLVYRLKTVEKQDVTF----EVPAFLQKLVELDNCKFEEWCVEMVDMRRESVDKGK---AKHEEVKELYQRLPAGADS--------AYEFVPLEWLQKWLDESTPTKPIDNS------------KCLCSHGKLHPD-KISLMKRISQHAADIFYKRYG---GSPRLTDDALCKDCVVERCRVLRLKNQLNEDYKSLTNMVKLP----VESNEGFWIGKSSLRRWRQ---LATEQLDQQEEDLAQGDWKVNGESPKACEDEEKKEADSELGFNEDIICQHGGLSISESERRLISEAAWYKLKEYFPTA------------PEFRHSQESCSQCKVLEQEGERHEA-----LHKMMANDQKTALPNLFQDKNRPLLGSWPQD-------TAEFFV--VSQFFVEEWRKFIRRPTKSNPVMSIGNSLLLCPHGGLMISFTNMTKEDAKLIAPIWPAEWDAIQKLF--IVDHTIKISRTVVTREDRTFTVDYESDPKLCPDCREGLLCQQQRDLREYAQATIYIHKVVDRKKVMKEVAPELNVSSSDLEDEKDEPRADGETDPDF---NQVNGTAKRQKLSGQGHVSTQKQGVRRSTRHRKVRGERALLVSANQTLKELKIQIMHAFSVAPFDQNLSIEGKILSDDAATLGNLGIVPESVILLKADEPMADYA 1012          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Xenopus
Match: ptp4a2 (protein tyrosine phosphatase type IVA, member 2 [Source:Xenbase;Acc:XB-GENE-1007312])

HSP 1 Score: 325.479 bits (833), Expect = 1.690e-94
Identity = 295/1087 (27.14%), Postives = 469/1087 (43.15%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLN--NKSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRF----PVEDI-----PDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDDNVIKSLIS----GTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIH-TSNQDWILYDDLNVQKLENID---DVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDF-TIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSF----------KDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNN--NEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFLSKDWYHFIEDESIFL-VWQSEWDKITNYYPDIEFENISIKSDFKLSSFPTLV----SSIIVCNSCFKIWSTLQTK----FENSVIYIRLISTK-------------------DDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDP--------NTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIA 3090
            M P+    K+ W + D +  EE       + Y +  +PC    C++NC  N  C+  +GE  WL   +++   N  + N        F  GL N G TCY N+ +QV+F  +EL+ A++ +      E       P  I  +LQ +FA +Q S  + +DP   I AL L   +QQDA EF  LFM+L++   S   + ++K++I     G + Y+T C  C  ES++  +F E++L  +      + + +FLK E L  DN+Y C  C  K N  R+  L  LPP L  Q +R+ +D  +G KKK    +GF   L M+ Y++     D T  Y + AVLIH G+   SGHY   +      +W  ++D +++K+E       +++ L Q KT   K       K GK    IH  S NAYM+ Y  + V K   T     EVP+ L+  +++ N   E +  E+ + R+E V   +    + E + E +Q+L           LA   EF+P+ WL KWL        I NS              +C H  L PD  I+ +K ++    D   + +       R    + C  C   +  + + +N    D+ ++ N V+ P    VE+ + +W+ KS LR+WR+   LA E       D+       NG             D     N D++C H  LSI  S+R L+ E  W K+ +YFP              P   +  E CS C  L  E  +        L K+  + ++    N   +K    L    QV    +    F  F    F+  W++FI+ P+    V  I  S + C HG  +        ED  +   +W +EWD I   +  I    I I          T      S   +C  C +     Q +    +  + IYI  +  +                   D+  +   DG +   +   NQ+N +   +++            VRRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L      L D   T+ N+GI P S++ L  D  +   A
Sbjct:    1 MAPRLQLEKAAWKWTDTVRPEEVGQEHIEAAYRVRLEPCVRGICRRNCKGNPNCLVGVGEHIWLGEIDENTFHNIDDPNSERRKKNTFV-GLTNLGATCYVNTFVQVWFLNMELRRALYLYENSWSAEKAHNKYEPQTICEHLQYLFALLQNSNRRYIDPSSFIKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKEPIVKNIIQEQFCGQYAYVTICSQCSRESRLVSKFYELELNIQGHKQLTECIAEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLDLPPTLNLQLMRFVFDRQTGHKKKLNTYIGFSETLDMDPYLD---QTDGTYSYELSAVLIHRGVSAYSGHYIAHVKDPQTGEWYKFNDEDIEKMEGKKLQLGIEEDLEQSKTAPRKP------KCGK---GIH-CSRNAYMLVYRLKTVEKQDVTF----EVPAFLQKLVELDNCKFEEWCVEMVDMRRESVDKGK---AKHEEVKELYQRLPAGA------GLA--YEFVPLEWLQKWLDESTPTKPIDNS------------KCLCSHGKLHPD-KISLMKRISQHAADIFYKRYG---GSPRLTDDALCKDCVVERCRVLRLKNQLNEDYKSLTNMVKLP----VESNEGFWIGKSSLRRWRQ---LATEQLDQQEEDLAQGDWKVNGESPKGIDEEKKEADSELGFNEDIICQHGGLSISESERRLISEAAWYKLKEYFPTA------------PEFRHSQESCSQCKVLEQEGERHEA-----LHKMMANDQKTALPNLFQDKNRPLLGSWPQV----LPSVPFPLF----FVEEWRKFIRRPTKSNPVMSIGNSLLLCPHGGLMISFTNMTKEDAKLIAPIWPAEWDAIQKLF--IVDHTIKISRTVVTREDRTFTVDYESDPKLCPDCREGLLCQQQRDLREYAQATIYIHKVVDRKKVMKEVAPELNVSSSDLEDEKDEPRADGETDPDF---NQVNGTAKRQKLSGQGHVSTQKQGVRRSTRHRKVRGERALLVSANQTLKELKIQIMHAFSVAPFDQNLSIEGKILSDDAATLGNLGIVPESVILLKADEPMADYA 1005          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Xenopus
Match: ptp4a2 (protein tyrosine phosphatase type IVA, member 2 [Source:Xenbase;Acc:XB-GENE-1007312])

HSP 1 Score: 325.094 bits (832), Expect = 3.467e-94
Identity = 291/1095 (26.58%), Postives = 471/1095 (43.01%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLN--NKSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIF---RFPVEDI-----------PDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDDNVIKSLIS----GTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIH-TSNQDWILYDDLNVQKLENID---DVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDF-TIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSF-----------KDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFE----YNNNEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFLSKDWYHFIEDESIFL-VWQSEWDKITNYYPDIEFENISIKSDFKLSSFPTLV----SSIIVCNSCFKIWSTLQTK----FENSVIYIRLISTK-------------------DDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDP--------NTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIA 3090
            M P+    K+ W + D +  EE       + Y +  +PC    C++NC  N  C+  +GE  WL   +++   N  + N        F  GL N G TCY N+ +QV+F  +EL+ A++     P + +           P  I  +LQ +FA +Q S  + +DP   I AL L   +QQDA EF  LFM+L++   S   + ++K++I     G + Y+T C  C  ES++  +F E++L  +      + + +FLK E L  DN+Y C  C  K N  R+  L  LPP L  Q +R+ +D  +G KKK    +GF   L M+ Y++     D T  Y + AVLIH G+   SGHY   +      +W  ++D +++K+E       +++ L Q KT   K       K GK    IH  S NAYM+ Y  + V K   T     EVP+ L+  +++ N   E +  E+ + R+E V   +    + E + E +Q+L     +          EF+P+ WL KWL        I NS              +C H  L PD  I+ +K ++    D   + +       R    + C  C   +  + + +N    D+ ++ N V+ P    VE+ + +W+ KS LR+WR+   LA E       D+       NG              D     N D++C H  LSI  S+R L+ E  W K+ +YFP              P   +  E CS C  L  E  +        L K+  + ++      + +  + L+   P         T E F+  +   F+  W++FI+ P+    V  I  S + C HG  +        ED  +   +W +EWD I   +  I    I I          T      S   +C  C +     Q +    +  + IYI  +  +                   D+  +   DG +   +   NQ+N +   +++            VRRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L      L D   T+ N+GI P S++ L  D  +   A
Sbjct:   19 MAPRLQLEKAAWKWTDTVRPEEVGQEHIEAAYRVRLEPCVRGICRRNCKGNPNCLVGVGEHIWLGEIDENTFHNIDDPNSERRKKNTFV-GLTNLGATCYVNTFVQVWFLNMELRRALYLETSQPDQQVGETIRRHEKYEPQTICEHLQYLFALLQNSNRRYIDPSSFIKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKEPIVKNIIQEQFCGQYAYVTICSQCSRESRLVSKFYELELNIQGHKQLTECIAEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLDLPPTLNLQLMRFVFDRQTGHKKKLNTYIGFSETLDMDPYLD---QTDGTYSYELSAVLIHRGVSAYSGHYIAHVKDPQTGEWYKFNDEDIEKMEGKKLQLGIEEDLEQSKTAPRKP------KCGK---GIH-CSRNAYMLVYRLKTVEKQDVTF----EVPAFLQKLVELDNCKFEEWCVEMVDMRRESVDKGK---AKHEEVKELYQRLPAGADS--------AYEFVPLEWLQKWLDESTPTKPIDNS------------KCLCSHGKLHPD-KISLMKRISQHAADIFYKRYG---GSPRLTDDALCKDCVVERCRVLRLKNQLNEDYKSLTNMVKLP----VESNEGFWIGKSSLRRWRQ---LATEQLDQQEEDLAQGDWKVNGESPKACEDEEKKEADSELGFNEDIICQHGGLSISESERRLISEAAWYKLKEYFPTA------------PEFRHSQESCSQCKVLEQEGERHEA-----LHKMMANDQKTALPNLFQDKNRPLLGSWPQD-------TAEFFV--VSQFFVEEWRKFIRRPTKSNPVMSIGNSLLLCPHGGLMISFTNMTKEDAKLIAPIWPAEWDAIQKLF--IVDHTIKISRTVVTREDRTFTVDYESDPKLCPDCREGLLCQQQRDLREYAQATIYIHKVVDRKKVMKEVAPELNVSSSDLEDEKDEPRADGETDPDF---NQVNGTAKRQKLSGQGHVSTQKQGVRRSTRHRKVRGERALLVSANQTLKELKIQIMHAFSVAPFDQNLSIEGKILSDDAATLGNLGIVPESVILLKADEPMADYA 1030          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Xenopus
Match: ptp4a2 (protein tyrosine phosphatase type IVA, member 2 [Source:Xenbase;Acc:XB-GENE-1007312])

HSP 1 Score: 324.324 bits (830), Expect = 6.131e-94
Identity = 288/1096 (26.28%), Postives = 471/1096 (42.97%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLN--NKSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFP---------------VEDIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDDNVIKSLIS----GTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIH-TSNQDWILYDDLNVQKLENID---DVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDF-TIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFND-----------STDIQDETNSSNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFE----YNNNEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFLSKDWYHFIEDESIFL-VWQSEWDKITNYYPDIEFENISIKSDFKLSSFPTLV----SSIIVCNSCFKIWSTLQTK----FENSVIYIRLISTK-------------------DDHYDVNEDGPSKKKYKVNNQINTSVNFKEI--------DPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIA 3090
            M P+    K+ W + D +  EE       + Y +  +PC    C++NC  N  C+  +GE  WL   +++   N  + N        F  GL N G TCY N+ +QV+F  +EL+ A++ +                 E  P  I  +LQ +FA +Q S  + +DP   I AL L   +QQDA EF  LFM+L++   S   + ++K++I     G + Y+T C  C  ES++  +F E++L  +      + + +FLK E L  DN+Y C  C  K N  R+  L  LPP L  Q +R+ +D  +G KKK    +GF   L M+ Y++     D T  Y + AVLIH G+   SGHY   +      +W  ++D +++K+E       +++ L Q KT   K       K GK    IH  S NAYM+ Y  + V K   T     EVP+ L+  +++ N   E +  E+ + R+E V   +    + E + E +Q+L     +          EF+P+ WL KWL        I NS              +C H  L PD  I+ +K ++    D   + +       R    + C  C   +  + + +N    D+ ++ N V+ P    VE+ + +W+ KS LR+WR++    ++ +  D           S    +E         D     N D++C H  LSI  S+R L+ E  W K+ +YFP              P   +  E CS C  L  E  +        L K+  + ++      + +  + L+   P         T E F+  +   F+  W++FI+ P+    V  I  S + C HG  +        ED  +   +W +EWD I   +  I    I I          T      S   +C  C +     Q +    +  + IYI  +  +                   D+  +   DG +   +   NQ+N +   +++            VRRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L      L D   T+ N+GI P S++ L  D  +   A
Sbjct:   16 MAPRLQLEKAAWKWTDTVRPEEVGQEHIEAAYRVRLEPCVRGICRRNCKGNPNCLVGVGEHIWLGEIDENTFHNIDDPNSERRKKNTFV-GLTNLGATCYVNTFVQVWFLNMELRRALYLYENSWSAEKAEQCIQEDKEYEPQTICEHLQYLFALLQNSNRRYIDPSSFIKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKEPIVKNIIQEQFCGQYAYVTICSQCSRESRLVSKFYELELNIQGHKQLTECIAEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLDLPPTLNLQLMRFVFDRQTGHKKKLNTYIGFSETLDMDPYLD---QTDGTYSYELSAVLIHRGVSAYSGHYIAHVKDPQTGEWYKFNDEDIEKMEGKKLQLGIEEDLEQSKTAPRKP------KCGK---GIH-CSRNAYMLVYRLKTVEKQDVTF----EVPAFLQKLVELDNCKFEEWCVEMVDMRRESVDKGK---AKHEEVKELYQRLPAGADS--------AYEFVPLEWLQKWLDESTPTKPIDNS------------KCLCSHGKLHPD-KISLMKRISQHAADIFYKRYG---GSPRLTDDALCKDCVVERCRVLRLKNQLNEDYKSLTNMVKLP----VESNEGFWIGKSSLRRWRQLATEQLDQQEEDLAQGDWKVNGESPKACEEGIDEEKKEADSELGFNEDIICQHGGLSISESERRLISEAAWYKLKEYFPTA------------PEFRHSQESCSQCKVLEQEGERHEA-----LHKMMANDQKTALPNLFQDKNRPLLGSWPQD-------TAEFFV--VSQFFVEEWRKFIRRPTKSNPVMSIGNSLLLCPHGGLMISFTNMTKEDAKLIAPIWPAEWDAIQKLF--IVDHTIKISRTVVTREDRTFTVDYESDPKLCPDCREGLLCQQQRDLREYAQATIYIHKVVDRKKVMKEVAPELNVSSSDLEDEKDEPRADGETDPDF---NQVNGTAKRQKLSGQGHVSTQKQGVRRSTRHRKVRGERALLVSANQTLKELKIQIMHAFSVAPFDQNLSIEGKILSDDAATLGNLGIVPESVILLKADEPMADYA 1031          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Mouse
Match: Usp48 (ubiquitin specific peptidase 48 [Source:MGI Symbol;Acc:MGI:2158502])

HSP 1 Score: 325.094 bits (832), Expect = 2.837e-94
Identity = 296/1108 (26.71%), Postives = 484/1108 (43.68%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPV---------------EDIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIH-TSNQDWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNK-KNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCI------------LNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNN--NEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFLSKDWYHFIEDES-IFLVWQSEWDKITN-YYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIRL----------------ISTKDDHYDVNEDGPSKKKYKVNNQINTSV--------NFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNLEI-----GFSGTKLM 3141
            M P+    K+ W + + +  EE       + Y +  +PC    C++NC  N  C+  +GE  WL      S +  +D        N   GL N G TCY N+ LQV+F  +EL++A++  P                +  P  I  +LQ +FA +Q S  + +DP   + AL L   +QQDA EF  LFM+L++   S   +    NV++    G + Y+T C  CG ES++  +F E++L  +        + +FLK E L  DN+Y C  C  K N  R+  L +LP  L  Q +R+ +D  +G KKK    +GF   L ME YV   ++   +  Y + AVLIH G+   SGHY   +    + +W  ++D +++K+E     KK+ LG ++ +   S   T K K GK     H  S NAYM+ Y  +   KNHT     V+VP+ L+  +   N   E +  E+   R++ V   +    + E + E +Q+         L + A   EF+ + WL KWL        I N+              +C H+ L PD  I+ +K ++    +     +       R  + + C  C   +  + + +N    D+   N + K  ++  +    +WV KS LR WR+   LA+E       + +      NGS  +                 N D+LCPH  LSI  ++R L+ +E W+K+  YFPK           EFP   +  E CS C  L  E  +        L K+  ++++    N   +K   CLS   +  +        LY +   F+  W++F++ P+    V+ I  + + C HG  +        ED   I L+W SEW  I   +  D   +   I+      S    +S   +C  C +     Q +    +  + IY+                  +S+ +   D  E  P  +K    NQ N S          +       +RRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L  +   L D   T+  +G+ P S++ L  D  +   A   +D +++     GF GT L+
Sbjct:    1 MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCRGNPNCLVGIGEHIWLGEIDENSFHSIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLCPSTCSDYTKGDGIHGGKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNVVQQQFCGEYAYVTVCNQCGRESKLVSKFYELELNIQGHKQLTDCISEFLKEERLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNAYIGFSESLDMEPYV---EHKGGSFVYELSAVLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEG----KKLQLGIEEDLAEPSKSQTRKPKCGK---GTH-CSRNAYMLVYRLQAQEKNHTM----VQVPAFLQELVDRDNSKFEEWCVEMAEMRKQSVDKGK---AKHEEVKELYQR---------LPAGAEPYEFVSLEWLQKWLDESTPTKPIDNN------------ACLCSHDKLHPD-KISIMKRISEYAANIFYSRYG---GGPRLTVKALCKDCVVERCRVLRLKNQLNEDYKAVNNLLKSTMKGSDG---FWVGKSSLRSWRQ---LALEQLDEQDGEAEQSNGKINGSTFNKDESKEEKKEEEEELNFNEDILCPHGELSISENERRLVSQEAWSKLQQYFPKAP---------EFP---SYRECCSQCKILEREGEENEA-----LHKMIANEQKTSLPNLFQDKNRPCLSNWPEDTDA-------LYIVSHFFLDEWRKFVRKPARSAPVSSIGNAALLCPHGGLMFTFPSLTKEDSKLIALIWPSEWQMIQKLFVVDKVIKITRIEVGDVNPSQTQYISEPSLCPDCREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKDPDFNQSNGSTKRQKTSQQGYVAYQKQVIRRSTRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKILNDDCATLGTLGVIPESVILLKADEPIADYA-AMDDVMQVCMPEEGFKGTGLL 1034          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Mouse
Match: Usp48 (ubiquitin specific peptidase 48 [Source:MGI Symbol;Acc:MGI:2158502])

HSP 1 Score: 317.775 bits (813), Expect = 1.647e-91
Identity = 292/1125 (25.96%), Postives = 481/1125 (42.76%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPV---------------EDIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIH-TSNQDWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCI------------LNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNN--NEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFL-------------------SKDWYHFIEDESIFLVWQSEWDKITN-YYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIRL----------------ISTKDDHYDVNEDGPSKKKYKVNNQINTSV--------NFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNLEI-----GFSGTKLM 3141
            M P+    K+ W + + +  EE       + Y +  +PC    C++NC  N  C+  +GE  WL      S +  +D        N   GL N G TCY N+ LQV+F  +EL++A++  P                +  P  I  +LQ +FA +Q S  + +DP   + AL L   +QQDA EF  LFM+L++   S   +    NV++    G + Y+T C  CG ES++  +F E++L  +        + +FLK E L  DN+Y C  C  K N  R+  L +LP  L  Q +R+ +D  +G KKK    +GF   L ME YV   ++   +  Y + AVLIH G+   SGHY   +    + +W  ++D +++K+E     KK+ LG ++ +          K GK     H  S NAYM+ Y  +   KNHT     V+VP+ L+  +   N   E +  E+   R++ V   +    + E + E +Q+         L + A   EF+ + WL KWL        I N+              +C H+ L PD  I+ +K ++    +     +       R  + + C  C   +  + + +N    D+   N     LL++      +WV KS LR WR+   LA+E       + +      NGS  +                 N D+LCPH  LSI  ++R L+ +E W+K+  YFPK           EFP   +  E CS C  L  E  +        L K+  ++++    N   +K   CLS   +  +        LY +   F+  W++F++ P+    V+ I  + + C HG  +                    +  +      +I L+W SEW  I   +  D   +   I+      S    +S   +C  C +     Q +    +  + IY+                  +S+ +   D  E  P  +K    NQ N S          +       +RRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L  +   L D   T+  +G+ P S++ L  D  +   A   +D +++     GF GT L+
Sbjct:    1 MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCRGNPNCLVGIGEHIWLGEIDENSFHSIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLCPSTCSDYTKGDGIHGGKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNVVQQQFCGEYAYVTVCNQCGRESKLVSKFYELELNIQGHKQLTDCISEFLKEERLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNAYIGFSESLDMEPYV---EHKGGSFVYELSAVLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEG----KKLQLGIEEDLEPSKSQTRKPKCGK---GTH-CSRNAYMLVYRLQAQEKNHTM----VQVPAFLQELVDRDNSKFEEWCVEMAEMRKQSVDKGK---AKHEEVKELYQR---------LPAGAEPYEFVSLEWLQKWLDESTPTKPIDNN------------ACLCSHDKLHPD-KISIMKRISEYAANIFYSRYG---GGPRLTVKALCKDCVVERCRVLRLKNQLNEDYKAVN----NLLKSTMKGDGFWVGKSSLRSWRQ---LALEQLDEQDGEAEQSNGKINGSTFNKDESKEEKKEEEEELNFNEDILCPHGELSISENERRLVSQEAWSKLQQYFPKAP---------EFP---SYRECCSQCKILEREGEENEA-----LHKMIANEQKTSLPNLFQDKNRPCLSNWPEDTDA-------LYIVSHFFLDEWRKFVRKPARSAPVSSIGNAALLCPHGGLMFTFPSLTKEDSKLCQPLERREGGWPTAAHNNIALIWPSEWQMIQKLFVVDKVIKITRIEVGDVNPSQTQYISEPSLCPDCREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKDPDFNQSNGSTKRQKTSQQGYVAYQKQVIRRSTRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKILNDDCATLGTLGVIPESVILLKADEPIADYA-AMDDVMQVCMPEEGFKGTGLL 1050          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Mouse
Match: Usp48 (ubiquitin specific peptidase 48 [Source:MGI Symbol;Acc:MGI:2158502])

HSP 1 Score: 226.098 bits (575), Expect = 1.819e-62
Identity = 193/676 (28.55%), Postives = 305/676 (45.12%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPV---------------EDIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIH-TSNQDWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNK-KNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGS 1992
            M P+    K+ W + + +  EE       + Y +  +PC    C++NC  N  C+  +GE  WL      S +  +D        N   GL N G TCY N+ LQV+F  +EL++A++  P                +  P  I  +LQ +FA +Q S  + +DP   + AL L   +QQDA EF  LFM+L++   S   +    NV++    G + Y+T C  CG ES++  +F E++L  +        + +FLK E L  DN+Y C  C  K N  R+  L +LP  L  Q +R+ +D  +G KKK    +GF   L ME YV   ++   +  Y + AVLIH G+   SGHY   +    + +W  ++D +++K+E     KK+ LG ++ +   S   T K K GK     H  S NAYM+ Y  +   KNHT     V+VP+ L+  +   N   E +  E+   R++ V   +    + E + E +Q+         L + A   EF+ + WL KWL        I N+              +C H+ L PD  I+ +K ++    +     +       R  + + C  C   +  + + +N    D+   N     LL++      +WV KS LR WR+   LA+E       + +      NGS
Sbjct:    1 MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCRGNPNCLVGIGEHIWLGEIDENSFHSIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLCPSTCSDYTKGDGIHGGKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNVVQQQFCGEYAYVTVCNQCGRESKLVSKFYELELNIQGHKQLTDCISEFLKEERLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNAYIGFSESLDMEPYV---EHKGGSFVYELSAVLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEG----KKLQLGIEEDLAEPSKSQTRKPKCGK---GTH-CSRNAYMLVYRLQAQEKNHTM----VQVPAFLQELVDRDNSKFEEWCVEMAEMRKQSVDKGK---AKHEEVKELYQR---------LPAGAEPYEFVSLEWLQKWLDESTPTKPIDNN------------ACLCSHDKLHPD-KISIMKRISEYAANIFYSRYG---GGPRLTVKALCKDCVVERCRVLRLKNQLNEDYKAVN----NLLKSTMKGDGFWVGKSSLRSWRQ---LALEQLDEQDGEAEQSNGKINGS 626          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Mouse
Match: Usp47 (ubiquitin specific peptidase 47 [Source:MGI Symbol;Acc:MGI:1922246])

HSP 1 Score: 100.908 bits (250), Expect = 6.469e-21
Identity = 102/442 (23.08%), Postives = 174/442 (39.37%), Query Frame = 1
Query:  280 NGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDEIITY----LQTIFAQMQLSVHKMVDPVELINALELPQLE---QQDAPEFHSLFMNLVDQRFSLIDD-NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--------KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKK-KNCCNVGFPSYLSMENYV------------------------------NDGKNDDKTNE------------------------YIIKAVLIHIGLQPTSGHYQTLIHT-SNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTELENQRQE 1389
            + ILN       GL N   TCY NSLLQ  F   E + A++++  ED  ++ +T     LQ +F  +Q S  + ++  ++  +      E   Q D  E   +  + ++Q++   +  ++I  L  G  +   RC  CGYE      + +I L        +   S ++AL  F++ E+L   N+Y C  C  KC+  +       P LL  Q  R+ +D +   + K    + FP  L M  ++                              ND   DD  +E                        Y + +V++H G     GHY   I + S+  W  ++D +V ++   +D+KK                +  +     +    S+NAYM+ Y  +D  +N   +    E P H+K  +Q   E  L E E +++E
Sbjct:  177 SSILNKSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEDSEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMSFPEELDMSTFIDIEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSTDDAVDEGICLESSSGSEKISKPGLEKNSLMYELFSVMVHSG-SAAGGHYYACIKSFSDDQWYSFNDQHVSRITQ-EDIKKT------------HGGSSGSRGYYSSAFASSTNAYMLIYRLKDPTRNAKFLEVD-EYPEHIKNLVQKERE--LEEQEKRQRE 601          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Mouse
Match: Usp47 (ubiquitin specific peptidase 47 [Source:MGI Symbol;Acc:MGI:1922246])

HSP 1 Score: 100.523 bits (249), Expect = 7.812e-21
Identity = 102/442 (23.08%), Postives = 174/442 (39.37%), Query Frame = 1
Query:  280 NGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDEIITY----LQTIFAQMQLSVHKMVDPVELINALELPQLE---QQDAPEFHSLFMNLVDQRFSLIDD-NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--------KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKK-KNCCNVGFPSYLSMENYV------------------------------NDGKNDDKTNE------------------------YIIKAVLIHIGLQPTSGHYQTLIHT-SNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTELENQRQE 1389
            + ILN       GL N   TCY NSLLQ  F   E + A++++  ED  ++ +T     LQ +F  +Q S  + ++  ++  +      E   Q D  E   +  + ++Q++   +  ++I  L  G  +   RC  CGYE      + +I L        +   S ++AL  F++ E+L   N+Y C  C  KC+  +       P LL  Q  R+ +D +   + K    + FP  L M  ++                              ND   DD  +E                        Y + +V++H G     GHY   I + S+  W  ++D +V ++   +D+KK                +  +     +    S+NAYM+ Y  +D  +N   +    E P H+K  +Q   E  L E E +++E
Sbjct:  157 SSILNKSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEDSEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINELYQGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMSFPEELDMSTFIDIEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSTDDAVDEGICLESSSGSEKISKPGLEKNSLMYELFSVMVHSG-SAAGGHYYACIKSFSDDQWYSFNDQHVSRITQ-EDIKKT------------HGGSSGSRGYYSSAFASSTNAYMLIYRLKDPTRNAKFLEVD-EYPEHIKNLVQKERE--LEEQEKRQRE 581          
BLAST of Ubiquitin specific peptidase 48 vs. UniProt/SwissProt
Match: sp|Q76LT8|UBP48_RAT (Ubiquitin carboxyl-terminal hydrolase 48 OS=Rattus norvegicus OX=10116 GN=Usp48 PE=1 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 1.632e-94
Identity = 300/1114 (26.93%), Postives = 487/1114 (43.72%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPV---------------EDIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIH-TSNQDWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNK-KNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDF-TIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQD-ETNSSNGSFKDLPCI----------------LNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNN--NEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFLSKDWYHFIEDES-IFLVWQSEWDKITN-YYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIRLI-------------------STKDDHYDVNEDGPSKKKYKVNN-----QINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNLEI-----GFSGTKLM 3141
            M P+    K+ W + + +  EE       + Y +  +PC    C++NC  N  C+  +GE  WL      S ++ +D        N   GL N G +CY N+ LQV+F  +EL++A++  P                +  P  I  +LQ +FA +Q S  + +DP   + AL L   +QQDA E   LFM+L++   S   +    NV++    G + Y+T C  CG ES++  +F E++L  +        + +FLK E L  DN+Y C  C  K N  R+  L +LP  L  Q +R+ +D  +G KKK    +GF   L ME YV   ++   +  Y + AVLIH G+   SGHY   +    + DW  ++D +++K+E     KK+ LG ++ +   S   T K K GK     H  S NAYM+ Y  +   KNHT     V+VP+ L+  +   N   E +  E+   R++ V        + E + E +Q+L          + A   EF+ + WL KWL        I N+              +C H+ L PD  I+ +K ++    D     +       R  + + C  C   +  I + +N    D+ T++N ++      ++    +WV KS LR WR+   LA+E       D QD E   SNG     P                   N D+LCPH  LSI  ++R L+ +E W+K+  YFPK           EFP   +  E CS C  L  E  +        L K+   +++    N   +K   CLS   +  + L       Y +   F+  W++F++ P+  T V+ +  + + C HG  +        ED   I L+W SEW  I   +  D   +   I+      S    +S   +C  C +     Q K    +  + IY+  +                    T++D  +   DG     +  +N     Q  +   +       +RRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L  +   L D   T+  +G+ P S++ L  D  +   A   +D +++     GF GT L+
Sbjct:    1 MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCRGNPNCLVGIGEHIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGASCYVNTFLQVWFLNLELRQALYLCPSTCSDYTKGDGIRGGKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQESSKLFMSLLEDTLSKQKNPDVRNVVQQQFCGEYAYVTVCSQCGRESKLVSKFYELELNIQGHKQLTDCISEFLKEERLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNAYIGFSESLDMEPYV---EHKGGSFVYELSAVLIHRGVSAYSGHYIAHVKDPQSGDWYKFNDEDIEKMEG----KKLQLGIEEDLTEPSKSQTRKPKCGK---GTH-CSRNAYMLVYRLQTQEKNHTM----VQVPAFLQELVDRDNSKFEEWCVEMAEMRRQSVDKGR---AKHEEVKELYQRL---------PAGAEPYEFVSLEWLQKWLDESTPTKPIDNN------------ACLCSHDKLHPD-KISIMKRISEYAADIFYSRYG---GGPRLTVKALCKDCVVERCRILRLKNQLNEDYKTVNNLLKA----TMKGSDGFWVGKSSLRSWRQ---LALEQ-----LDEQDGEAEQSNGKINGSPFSKDESKEEKKEEEEELNFNEDILCPHGELSISENERRLVSQEAWSKLQQYFPKAP---------EFP---SYKECCSQCKILEREGEENEA-----LHKMIAKEQKTSLPNLFQDKNRPCLSNWPEDTDAL-------YIVSHFFLDEWRKFVRKPARSTPVSSVGNAALLCPHGGLMFTFPSLTKEDSKLIALIWPSEWQMIQKLFVVDKVIKITRIEVGDVNPSQTQYISEPNLCPDCREGLLCQQQKDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKDPDFNQSNGGTKRQKTSQQGYVAYQKQVIRRSTRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKILNDDCATLGTLGVIPESVILLKADEPIADYA-AMDDVMQVCMPEEGFKGTGLL 1034          
BLAST of Ubiquitin specific peptidase 48 vs. UniProt/SwissProt
Match: sp|Q86UV5|UBP48_HUMAN (Ubiquitin carboxyl-terminal hydrolase 48 OS=Homo sapiens OX=9606 GN=USP48 PE=1 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 2.273e-94
Identity = 297/1110 (26.76%), Postives = 487/1110 (43.87%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPV---------------EDIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYI--IKAVLIHIGLQPTSGHYQTLIH-TSNQDWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNK-KNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDF-TIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCI-----------LNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNN--NEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFLSKDWYHFIEDES-IFLVWQSEWDKITN-YYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIRL----------------ISTKDDHYDVNEDGPSKKKYKVNNQINTSV--------NFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNLEI-----GFSGTKLM 3141
            M P+    K+ W + + +  EE       + Y +  +PC    C++NC  N  C+  +GE  WL      S ++ +D        N   GL N G TCY N+ LQV+F  +EL++A++  P                +  P  I  +LQ +FA +Q S  + +DP   + AL L   +QQDA EF  LFM+L++   S   +    N+++    G + Y+T C  CG ES++  +F E++L  +        + +FLK E L  DN+Y C  C  K N  R+  L +LP  L  Q +R+ +D  +G KKK    +GF   L ME YV     + K   Y+  + AVLIH G+   SGHY   +    + +W  ++D +++K+E     KK+ LG ++ +   S   T K K GK     H  S NAYM+ Y      +     N +V+VP+ L+  +   N   E +  E+   R++ V   +    + E + E +Q+         L + A   EF+ + WL KWL        I N               +C H+ L PD  I+ +K ++    D     +       R  + + C +C   +  I + +N    D+ T++N ++      V+    +WV KS LR WR+   LA+E       D +      NGS  +                N D+LCPH  L I  ++R L+ +E W+K+  YFPK           EFP   +  E CS C  L  E  +        L K+  ++++    N   +K   CLS   + D ++      LY +   F+  W++F++ P+  + V+ +  S + C HG  +        ED   I L+W SEW  I   +  D   +   I+      S    +S   +C  C +     Q +    +  + IY+                  +S+ +   D  E  P  +K    NQ N           N+       +RRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L  +   L D   T+  +G+ P S++ L  D  +   A   +D +++     GF GT L+
Sbjct:    1 MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGEHIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELELNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIGFSEILDMEPYV-----EHKGGSYVYELSAVLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEG----KKLQLGIEEDLAEPSKSQTRKPKCGK---GTH-CSRNAYMLVYR----LQTQEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGK---AKHEEVKELYQR---------LPAGAEPYEFVSLEWLQKWLDESTPTKPIDNH------------ACLCSHDKLHPD-KISIMKRISEYAADIFYSRYG---GGPRLTVKALCKECVVERCRILRLKNQLNEDYKTVNNLLKAA----VKGSDGFWVGKSSLRSWRQ---LALEQLDEQDGDAEQSNGKMNGSTLNKDESKEERKEEEELNFNEDILCPHGELCISENERRLVSKEAWSKLQQYFPKAP---------EFP---SYKECCSQCKILEREGEENEA-----LHKMIANEQKTSLPNLFQDKNRPCLSNWPE-DTDV------LYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCPHGGLMFTFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVNPSETQYISEPKLCPECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKDPDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIADYA-AMDDVMQVCMPEEGFKGTGLL 1033          
BLAST of Ubiquitin specific peptidase 48 vs. UniProt/SwissProt
Match: sp|Q5ZM45|UBP48_CHICK (Ubiquitin carboxyl-terminal hydrolase 48 OS=Gallus gallus OX=9031 GN=USP48 PE=2 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 4.032e-94
Identity = 297/1106 (26.85%), Postives = 493/1106 (44.58%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIF------RFPVEDIPDE-------IITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIH-TSNQDWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNK-KNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDF-TIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSF--KDLPCI----------LNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNN--NEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFLSKDWYHFIEDES-IFLVWQSEWDKITNYYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIRLI-----STKDDHYDVN-----------EDGPSKKKYKVNNQINTSVNFKEIDPNT--------VRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNLEI-----GFSGTKLM 3141
            M P+    K+ W + + +  E        + Y +  +PCQ  +C++NC  N  C+  +GE  WL      S ++ +D        N   GL N G TCY N+ LQ++F  +EL++A++          E IP +       I  +LQ +FA +Q S  + +DP   + AL L   +QQDA EF  LFM+L++   S   +    N+++    G + Y+T C  CG ES++  +F E++L  +        + +FLK E L  DN+Y C  C  K N  R+  L +LP  L  Q +R+ +D  +G KKK    +GF   L ME ++   +  +    Y + AVLIH G+   SGHY   +      +W  ++D +++K+E     KK+ LG ++ +   S   T K K GK     H  S NAYM+ Y  +   K+ T     VEVP+ L+  ++  N   E +  E+   R++ V   +  IK  E + E +Q+L  +  +          +F+ + WL KWL        I N+              +C H  L PD  I  +K ++    DF    +       R  + + C  C   +  I + +N    D+ T+ N ++      V+  + +WV K+ LR WR+   LA+E       D +      NG+   KD               N D++CPH +L I  ++R ++ +E W K+  YFPK           EFP   NK E CS C  L  E  +        L K+  S+++    N  ++K   CL    Q  +E       LY +   F+  W++F++ P+  + V+ +  S + C HG  +        ED   I L+W SEW++I   +       I+              S   +C  C       Q +    +  + IYI  +       KD   ++N           E+ P  ++    NQ N     +++   +        +RRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L+ +   L D   T+ ++GI P S++ L  D  +   A   +D +++     GF GT L+
Sbjct:    1 MAPRLQLEKAAWRWTETVPPEAVTQEHIEAAYRVGLEPCQRGTCRRNCRGNPNCLVGIGEHVWLGEIDENSFHNIDDPNCERRKKNAFVGLTNLGATCYVNTFLQMWFLNLELRQALYLCSSNEHAAGESIPKDKDYEPQTICEHLQYLFALLQNSKRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNIVQKQFCGEYAYVTVCNQCGRESKLVSKFYELELNIQGHKQLTDCITEFLKEEKLEGDNRYFCETCQSKQNATRKIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNTYIGFSELLDMEPFM---EQKNGVYVYELSAVLIHRGVSAYSGHYIAHVKDPQTGEWYKFNDEDIEKMEG----KKLQLGIEEDLAEPSKSQTRKPKCGK---GTH-CSRNAYMLVYRLQTREKSLT-----VEVPAFLQELVERDNCKFEEWCNEMAEMRKQSVARGK--IKHEE-VKELYQRLPAEAGS--------PYDFISLEWLQKWLDESTPPKPIDNT------------ACLCSHGKLHPD-KICIMKRISEYVADFFYRRYG---GGPRLNVKALCKDCVVERCRILRLKNQLNEDYKTVTNLLKI----TVKGSEGFWVGKASLRSWRQ---LALEQLNEQDEDAEHSNGKLNGNAPNKDEVNEEKREEEEELNFNEDIVCPHGDLCISENERRVVSKEAWKKLKQYFPKAP---------EFP--SNK-ECCSQCKILEREGEENEA-----LHKMMASEQKTSLQNLFHDKCRPCLGSWPQETDE-------LYIVSQFFVEEWRKFVRRPTRCSPVSSLGNSALLCPHGGLMFTYASMTKEDSKLIALIWPSEWERIQKLFVVDHVIKITRTRAAGEPESALYSSEPQLCPECRGGLLCQQQRDLREYTQATIYIHKVVDNKKVMKDAAPELNVSSSEAEEEREENKPEGEQDPDFNQSNGGAKRQKLSHQSYISYQKQGIRRSTRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFDQNLLIDGKILSDDTATLGSLGIIPESVILLKADEPIADYA-AMDDVMQVCMPEEGFKGTGLL 1031          
BLAST of Ubiquitin specific peptidase 48 vs. UniProt/SwissProt
Match: sp|Q3V0C5|UBP48_MOUSE (Ubiquitin carboxyl-terminal hydrolase 48 OS=Mus musculus OX=10090 GN=Usp48 PE=1 SV=2)

HSP 1 Score: 317.775 bits (813), Expect = 1.152e-90
Identity = 292/1125 (25.96%), Postives = 481/1125 (42.76%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPV---------------EDIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIH-TSNQDWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCI------------LNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNN--NEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFL-------------------SKDWYHFIEDESIFLVWQSEWDKITN-YYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIRL----------------ISTKDDHYDVNEDGPSKKKYKVNNQINTSV--------NFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNLEI-----GFSGTKLM 3141
            M P+    K+ W + + +  EE       + Y +  +PC    C++NC  N  C+  +GE  WL      S +  +D        N   GL N G TCY N+ LQV+F  +EL++A++  P                +  P  I  +LQ +FA +Q S  + +DP   + AL L   +QQDA EF  LFM+L++   S   +    NV++    G + Y+T C  CG ES++  +F E++L  +        + +FLK E L  DN+Y C  C  K N  R+  L +LP  L  Q +R+ +D  +G KKK    +GF   L ME YV   ++   +  Y + AVLIH G+   SGHY   +    + +W  ++D +++K+E     KK+ LG ++ +          K GK     H  S NAYM+ Y  +   KNHT     V+VP+ L+  +   N   E +  E+   R++ V   +    + E + E +Q+         L + A   EF+ + WL KWL        I N+              +C H+ L PD  I+ +K ++    +     +       R  + + C  C   +  + + +N    D+   N     LL++      +WV KS LR WR+   LA+E       + +      NGS  +                 N D+LCPH  LSI  ++R L+ +E W+K+  YFPK           EFP   +  E CS C  L  E  +        L K+  ++++    N   +K   CLS   +  +        LY +   F+  W++F++ P+    V+ I  + + C HG  +                    +  +      +I L+W SEW  I   +  D   +   I+      S    +S   +C  C +     Q +    +  + IY+                  +S+ +   D  E  P  +K    NQ N S          +       +RRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L  +   L D   T+  +G+ P S++ L  D  +   A   +D +++     GF GT L+
Sbjct:    1 MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCRGNPNCLVGIGEHIWLGEIDENSFHSIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLCPSTCSDYTKGDGIHGGKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQKNPDVRNVVQQQFCGEYAYVTVCNQCGRESKLVSKFYELELNIQGHKQLTDCISEFLKEERLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFVFDRQTGHKKKLNAYIGFSESLDMEPYV---EHKGGSFVYELSAVLIHRGVSAYSGHYIAHVKDPQSGEWYKFNDEDIEKMEG----KKLQLGIEEDLEPSKSQTRKPKCGK---GTH-CSRNAYMLVYRLQAQEKNHTM----VQVPAFLQELVDRDNSKFEEWCVEMAEMRKQSVDKGK---AKHEEVKELYQR---------LPAGAEPYEFVSLEWLQKWLDESTPTKPIDNN------------ACLCSHDKLHPD-KISIMKRISEYAANIFYSRYG---GGPRLTVKALCKDCVVERCRVLRLKNQLNEDYKAVN----NLLKSTMKGDGFWVGKSSLRSWRQ---LALEQLDEQDGEAEQSNGKINGSTFNKDESKEEKKEEEEELNFNEDILCPHGELSISENERRLVSQEAWSKLQQYFPKAP---------EFP---SYRECCSQCKILEREGEENEA-----LHKMIANEQKTSLPNLFQDKNRPCLSNWPEDTDA-------LYIVSHFFLDEWRKFVRKPARSAPVSSIGNAALLCPHGGLMFTFPSLTKEDSKLCQPLERREGGWPTAAHNNIALIWPSEWQMIQKLFVVDKVIKITRIEVGDVNPSQTQYISEPSLCPDCREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEKDPDFNQSNGSTKRQKTSQQGYVAYQKQVIRRSTRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKILNDDCATLGTLGVIPESVILLKADEPIADYA-AMDDVMQVCMPEEGFKGTGLL 1050          
BLAST of Ubiquitin specific peptidase 48 vs. UniProt/SwissProt
Match: sp|A3AF13|UBP26_ORYSJ (Ubiquitin carboxyl-terminal hydrolase 26 OS=Oryza sativa subsp. japonica OX=39947 GN=UBP26 PE=3 SV=2)

HSP 1 Score: 157.918 bits (398), Expect = 8.820e-38
Identity = 121/415 (29.16%), Postives = 188/415 (45.30%), Query Frame = 1
Query:  250 KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPD-----EIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLID----DNVIKSLISGTFRYLTRCKGCGYESQMNCQFR-----EIDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSY-DNSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIH-TSNQDWILYDDLNVQKL------ENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNI-------HFVSSNAYMVFYEREDVFKNHTTIN-----NSVEVPSHLKGNIQMTNESYLTELENQRQEK 1392
            ++L  N   D   L   T   AGL N G TCY NS+LQ  +     +  IF       PD      ++  L  +FAQ+  S    +D    I  LEL    QQD+ EF +LF++L++   S         +++ L  G+  ++TRC  CG +S+ + +       E+++K + + +Q+L D+L  E L  +N+Y C  C  + +  R   L++LPP++ FQ  RY +   + TKKK      FP  L M   ++   N   +  Y + A+LIH G    SGHY   +   SN  W  +DD +V KL      E          QK    + +D +TN  N    +          F S++AYM+ Y+R  + K+   I      ++  +P H    I   N SY+ E E    +K
Sbjct:   88 RALGPNPSTD---LRDSTETPAGLTNLGATCYANSILQCLYMNTSFRLGIFSLE----PDILKMHPVLDQLARLFAQLHSSKMAFIDSAPFIKTLELDNGVQQDSHEFLTLFLSLLEGSLSHSKVPGARTIVQHLFRGSVSHVTRCSSCGRDSEASSKMEDFYELELNIKGLNNLEQSLDDYLSTEALDGENQYFCESCQKRVDATRCIKLRSLPPVVNFQLKRYVFLPKTTTKKKISSAFSFPGQLDMGKRLS---NPSSSYTYGLSAILIHKGSAANSGHYVAHVKDESNGQWWEFDDEHVSKLGLHPFGEKPGKSSDKTDQKPQGSSTADSVTNDDNNSCHEAAFTSTMEEMFSSTDAYMLMYKR--IAKDENGIESNNISSNNSLPHHFVDEIDERNTSYVKECEEYESKK 490          
BLAST of Ubiquitin specific peptidase 48 vs. TrEMBL
Match: A0A2I4D0U3 (ubiquitin carboxyl-terminal hydrolase 48 isoform X1 OS=Austrofundulus limnaeus OX=52670 GN=usp48 PE=3 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 4.236e-99
Identity = 298/1113 (26.77%), Postives = 498/1113 (44.74%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIF-----RFPVEDI-----PDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTS-NQDWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYE-REDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKV---KTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFT-IDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPC-------------ILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNNNEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFL-SKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISIKSDFKLSS---FPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIRLI-----------------------------STKDDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNLEI-----GFSGTKLM 3141
            M P+    K+ W++ D +  EE         Y ++   C+  +C++NC  N  C+  +GE  WL      + ++ +D      D N   GL N G TCY N+ LQV+F+ +EL+ +++     R           P  I  +LQ +FA MQ S  K +DP  L+ AL L   +QQDA EF  LF++L++   S   +    NVI+    G F Y+T C  CG  S    +F E++L  +   +  + + +FLK E L  DN+Y C  C  K N  R+  L +LPP L  Q +R+ +D  +G KKK    + FP  L M  ++ DG+ D K   Y + AVLIH G+   SGHY   +  +   DW  ++D  ++K+E     KK+ LG ++ +   ++ + ++    +    +  S NAYM+ Y+ +ED  +N +     VEVP+ L+  +   N   E + TE+ + R++ V   K +   +KE   ++ A                  + EF+P  WL KWL +      I NS              +C H  L PD  + ++K V+    D L E +       R   SS C +C   +  + + +N    DF  + N +++ +     + + +WVSK+ LR WR+   LA++    D  + Q   + +NG      C               N DL+C H  L I  ++R L+  E+W+K+ +YFPK             P  +   + C  C +L  E      + K+      N      +  N   L      T V          LY +P  F+  WK+FI+ P+  + V+ +  + + C HG F+ + D     E + + L+W +EW+ I+  +  I  + ISI    + +         +   +C  C + +   Q +    +  + IYIR +                               KD  +  ++DG  + K   N+ +  +   K      +RRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L      L D + T+ N+G+ P SI+ L  D  +   A   +D  ++     GF GT L+
Sbjct:    1 MAPRVQLEKAAWSWVDTVKPEEIRQEHIELAYRINLPACKRGACRRNCKGNPNCLVGIGEQAWLGQIDENTFHNIDDPNSERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRSLYLCHNSRAQEHSTESDYEPQSICEHLQYLFALMQNSNRKYIDPSGLVKALGLDTGQQQDAQEFSKLFLSLLEDTLSKQKNPNLQNVIQQQFCGQFSYVTVCGQCGRSSARPSRFYELELNIQGHKNLTECITEFLKEENLDGDNRYYCESCKSKQNATRRIRLHSLPPTLNLQLMRFVFDRQTGHKKKLNTFISFPEQLDMGPFL-DGRQDQKC-VYELSAVLIHRGISAYSGHYIAHVKDALTGDWYKFNDEEIEKMEG----KKLQLGIEEDI---AETVKSQSRKPKCSKGYHCSRNAYMLVYKIQED--ENSSNSITKVEVPAFLQRLVDQDNRKFEEWCTEMADMRKQSVDKGKAKHEEVKELYKLLPAED--------------GEQYEFIPSDWLKKWLDDSTATKEIENS------------LFLCSHGKLHPD-KMGEVKRVSLRAADLLYERYG---GGPRLDGSSLCIECVGQRCRVLRLKNQLNEDFKEVSNLIKRSV-----SGEGFWVSKASLRSWRQ---LALDQLEEDEIETQHNNSKTNGQGPHTNCKEFDSNLPEDDMKTFNEDLVCSHGALCILETERKLVSTEVWSKLRNYFPKA------------PEFNQNQDPCQQCLTLEQEEKDNEAVSKMMALDQKNQLLNLFHEKNRPTLTKWPQGTDV----------LYIVPLFFVEEWKKFIRRPTKSSPVSNVGNTLLLCPHGGFMFTYDSLVTGEAQHVALLWPNEWEVISRLF--IVDQPISIHCLTQTTPNGCTTQYTTQPDLCWECRESFLFQQQRDLREYTQATIYIRKVIDDKRDPAPEVIASSSEAEEEREEHPKVDGEKDPDFSQSQDGAKRLKLCDNSALPVTTVTK---AGGIRRSTRHRKLRGEKALIVSANQTLKELKIQIMHAFSVAPFDQNLSIEGKSLTDDSATLGNLGVIPESIICLKADEPIADYA-AMDDAYQVRVPEEGFKGTGLL 1036          
BLAST of Ubiquitin specific peptidase 48 vs. TrEMBL
Match: A0A1A7X529 (Ubiquitin specific peptidase 48 OS=Iconisemion striatum OX=60296 GN=USP48 PE=3 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 2.163e-98
Identity = 304/1115 (27.26%), Postives = 498/1115 (44.66%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNNKSLSRN---DKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIF-----RFPVEDI-----PDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTS-NQDWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKV---KTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFT-IDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSN-------------GSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNNNEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFLSKDWYHFIEDES--IFLVWQSEWDKITNYYPDIEFENISI------KSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK-FENSVIYIRLI----STKDDHYDVNE---------------DGPS----------KKKYKVNNQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNLEI-----GFSGTKLM 3141
            M P+    K+ W + + +  EE         Y ++   C+  +C++NC  N  C+  +GE  WL    +  N     +D      D N   GL N G TCY N+ LQV+F+ +EL+ +++     R    +I     P  I  +LQ +FA +Q S  K +DP  L+ AL L   +QQDA EF  LF++L++   S   +    NVI+    G F Y+T C  CG  S +  +F E++L  +   +  + + +FLK E L  DN+Y C  C  K N  R+  L +LPP L  Q +R+ +D  +G KKK    + FP  L M  ++ D K D K   Y + AVLIH G+   SGHY   +  +   DW  ++D  ++K+E     KK+ LG ++ +    D + ++    +    +  S NAYM+ Y+ +    +  T    VEVPS L+  +   N   E + TE+ + R++ V   K +   +KE  T++ A                  + +F+PM WL KWL +      I+NS              +C H  L PD  + ++K ++    + L E +       R   SS C +C   +  + + +N    DF  + N V++ +     + + YWV K+ LR WR++  + +E   +++     +TN                   +D     N D++C H  LSI   +R L+  E+W K+  YFPK + E  + Q L           C  C +L  E      I K+      N      +  N   L      T+V          LY +P  F+  WK+FI+ P+  + V+ +  + + C HG F+   +   I  E+  + L+W  EW+ I+  +  I   +ISI      KS+   + F T       C   F        + +  + IYIR I      KD   ++N                DG +           K+ K+++     V      P  +RRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L  N   L D + T+ ++G+ P SI+ L  D  +   A   +D  ++     GF GT L+
Sbjct:    1 MAPRVQLEKAAWRWVETVKPEEIKQEHIELAYRINLPACKTGACRRNCKGNPNCLVGIGEQAWLGE--IDENVFHSIDDPNSERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRSLYQCHNSRAEEHNIQSDYEPQSICEHLQYLFALLQNSNRKYIDPSGLVKALGLDTGQQQDAQEFSKLFLSLLEDTLSKQKNPSLQNVIQQQFCGQFSYVTVCNQCGRSSALPSRFYELELNIQGHKNLTECITEFLKEEKLDGDNRYFCESCQSKQNATRRIKLHSLPPTLNLQLMRFIFDRQTGHKKKLNTFISFPEQLDMGPFLED-KQDQKCI-YELSAVLIHRGISAYSGHYIAHVKDALTGDWYKFNDEEIEKMEG----KKLQLGVEEDI---GDTVKSQSRKPKCSKGYHCSRNAYMLVYKIQGEETSDPT-RTKVEVPSFLQRLVDQDNRKFEEWCTEMADMRKQSVDKGKAKHEEVKELYTLLSAED--------------GEQYDFIPMDWLKKWLDDSTVSKEINNS------------PFLCSHGKLHPD-KVGEVKRISFQAANVLYERYG---GGPRLNGSSLCRECVSQQCRVLRLKNQLSEDFKEVSNLVKRSI-----SGEGYWVGKASLRSWRQLALVQLEEDEHETKPSNSQTNGQGLHTNNKDFASDLSEGLEDEMKTFNEDIVCCHGGLSILELERKLVSTEVWTKLRKYFPK-SPEFSQNQEL-----------CQQCLTLEQEEKDNEAISKMMALDQKNQLLNLFHEKNRPTLTKWPQGTEV----------LYIVPVFFVDEWKKFIRRPTKSSPVSNVGNTLLLCPHGGFMFT-YESLINGEAQHVALLWPDEWEVISRLF--IVDHSISIHCLKQSKSNGGSTQFTTQPELCWECRESFLFQQQRDLREYTQATIYIRKILEDKGMKDAAPELNASSSEAEEDREELPRVDGETDPDFSQSQDNAKRLKLSDGAALFVT-NVTKPGGIRRSTRHRKLRGEKALIVSANQTLKELKIQIMHAFSVAPFDQNLSINGKGLTDDSATLGSLGVIPESIICLKADEPIADYA-VMDDAYQVRMPEEGFKGTGLL 1041          
BLAST of Ubiquitin specific peptidase 48 vs. TrEMBL
Match: A0A0R4IB93 (Ubiquitin-specific peptidase 48 OS=Danio rerio OX=7955 GN=usp48 PE=1 SV=1)

HSP 1 Score: 345.895 bits (886), Expect = 2.248e-98
Identity = 303/1128 (26.86%), Postives = 506/1128 (44.86%), Query Frame = 1
Query:   64 MKPK---RKSKWNFDNINWEEFMSHQFLSI-YNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDI----------PDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSN-QDWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKV---KTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVI-----RLAIENKFNDSTDIQDET-----------NSSNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNNNEKKLICL-----SPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFL-SKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISI---------KSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIR-------------------------------LISTKDDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNL------EIGFSGTKLM 3141
            M P+    K+ W +      E ++H+ + + Y +    C+  +C++NC  N  C+  +GE  WL      + ++ +D      D N   GL N G TCY N+ LQV+F+ +EL+ A++RF               P  I  +LQ +FA +Q S  + +DP  L+ AL L   +QQDA EF  LF++L++   S   D    NVI+    G F Y+T C  CG ES +  +F E++L  +   +  + + +FLK E L  DN+Y C  C  K N  R+  LQ+LP  L FQ +R+ +D  SG KKK    + FP  L ME ++ +G+ +  T  Y + AVLIH G+   SGHY   +  ++  DW  ++D  ++K+E     KK+ LG ++ +   +   T K   K  +  H  S NAYM+ Y+++    N T   + V+VP+ L+  ++  N   E + +E+ + R++ V   K +   +KE   ++ A                    EF+P+ WL KWL +   +  I NS              +C H  L PD  I + K ++    D L   +       R   SS C  C   +  + + +N    D+     + K  L++ E+   +W+ K+ LR WR++          E K N+S    +++           +S +G  +++    N D+LC H  LSI  + R L+  E+WNK+  YFPK             P      + C  C  L  E             K   +  R   N  +  L+ L      P+ Q   +   +   LY +P  F+  WK+FI+ P+    V+ +  S + C HG F+ + D     + + I L+W +EW+ I+  +  +  + ISI           + +  + P L      C  C + +   Q +    +  + +Y+R                               L   KD  +   E G  ++K      + T+V       + +RRS R ++ R +  L ++++ T+KD+K+Q+M+ +SV+P DQ+L  +   L D + T+ ++G+ P SI+ L  D  +   A  + D++      E GF GT L+
Sbjct:    1 MAPRLQLEKAAWRWAEAVRPEDITHEHIELAYRIAVSACKRGACRRNCKGNPNCLVGIGEQSWLGEIDENTFHNIDDPNSERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRALYRFQNSRAEGHNTDSDYEPRTICEHLQYLFALLQNSNRRYIDPSGLVKALGLDTGQQQDAQEFSKLFLSLLEDTLSKQKDPNLQNVIQQQFCGQFSYVTVCNKCGRESPLPSRFYELELNIQGHKNLTECVTEFLKEEKLDGDNRYYCESCQSKQNATRRIKLQSLPRTLNFQLMRFVFDRQSGHKKKLNTFISFPEVLDMEPFL-EGREEKCT--YELSAVLIHRGVSAYSGHYIAHVRDAHTNDWYKFNDEEIEKMEG----KKLQLGIEEDIAETAKSQTRKP--KCSKGYH-CSRNAYMLVYKQQTEEINQT--ESPVDVPAFLQKLVEQDNRKFEEWCSEMSDMRKQSVDKGKAKHEEVKELYELLPAED--------------GQSYEFVPLEWLKKWLDDSTAIKEIDNSQ------------FLCTHGKLHPD-KIGEAKRISLKAADLLFSRYGGGPRLDR---SSLCRDCVTQRCRVIRLKNQLNEDYREVTNLAKSALKSEESG--FWIGKASLRSWRQLALDQLEEDEEETKHNNSKINGEKSSPGTKADGVKGDSEDGDGEEMK-NFNEDILCYHGGLSILENDRRLVSAEVWNKLRMYFPKA------------PEFTQDHDPCQQCMRLERE------------GKENEALNRMMANEQKSSLLNLFQEKNRPTLQ---KWPQDTDILYIVPLYFVEEWKKFIRRPAKGNPVSNVGNSILLCPHGGFMFTYDSMLQGDAQHIALLWPAEWEVISKMF--LVDQVISICRIHDKTQDNGNVQYQTHPDL------CRECREGFIFQQQRDMREYTQATVYVRKVIDKKRMIKESAPEFSVSGSDVEDEKEEPKLDGEKDPDFSQTEGGAKRQKLNDTVSLPTAV-VTTTSKSGIRRSTRHRKLRGEKALIVSANQTLKDLKIQIMHAFSVAPFDQNLSIDGRCLKDDSATLGSLGVIPESIICLKADEPIADYA--AMDDVYQVCMPEEGFKGTGLL 1045          
BLAST of Ubiquitin specific peptidase 48 vs. TrEMBL
Match: I3JQ00 (Ubiquitin specific peptidase 48 OS=Oreochromis niloticus OX=8128 PE=3 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 4.237e-98
Identity = 293/1109 (26.42%), Postives = 495/1109 (44.63%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNNKSLSR-NDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIF-----RFPVEDI-----------PDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQ-DWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESY------LTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFT-IDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNS----SNGSFKDLPCI------LNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNNNEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFL-SKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISI-------------KSDFKLSSFPTLVSSIIVCNSCFKI-------------WSTLQTKFENSVIYIRLISTKDDHYDVNEDGPSKKKYKVNNQINTS---VNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNL------EIGFSGTKLM 3141
            M P+    K+ W + + +  EE         Y ++   C+  +C++NC  N  C+  +GE  WL     S  +  +D      + N   GL N G TCY N+ LQV+F+ +EL+ +++     R    D            P  I  +LQ +FA +Q S  K +DP  L+ AL L   +QQDA EF  LF++L++   S   +    NVI+    G F Y+T C  CG  S +  +F E++L  +   +  + + +FLK E L  +N+Y C  C  K N  R+  L +LPP L  Q +R+ +D  +G KKK    + FP  L M  ++ + K D+K   Y + AVLIH G+   SGHY   +  +   DW  ++D  ++K+E     KK+ LG ++ +       T K   K  +  H  S NAYM+ Y+ +   +N      +VEVP+ L+  +   N  +      +T++  Q  +K K +   +KE   ++ A                    EF+P+ WL KWL +      I +S              +C H+ L PD  +   + V+      L E +       R   SS C +C   +  + + +N    D+  I N V++       +   +WV K+ LR WR++    +E   +++T    +TN     +N S +   C        N D++C H  LSI  ++R L+  E+W K  +YFPK             P      E C  C ++  E      + K+      N      +  N   L      T V          LY +P  F+  W++FI+ P+  + V+ +  + + C HG F+ + D     E + + L+W +EWD I+  +  I  + ISI             +   +    P   +S ++C +  ++               TL  +F ++   +  +S  +    V++DG  + K   ++ ++T+   V      P  +RRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L  +   L D + T+ ++GI P SI+ L  D  +   A  + D++      E GF GT L+
Sbjct:    1 MAPRVQLEKAAWRWVETVKPEEIRQEHIELAYRINLPACKRGACRRNCKGNPNCLVGIGEQAWLGEIDESAFHSIDDPNSERREKNTFVGLTNLGATCYVNTFLQVWFHNLELRRSLYQCQNSRAEEHDTESGISQNSDYEPQSICEHLQYLFALLQNSNRKYIDPSGLVKALGLDTGQQQDAQEFSKLFLSLLEDTLSKQKNPNLRNVIQQQFCGQFSYVTVCNQCGRSSALPSRFYELELNIQGHKNLTECVTEFLKEEKLDGENRYFCETCQSKQNATRRIKLHSLPPTLNLQLMRFVFDRQTGHKKKLNSFISFPEQLDMGPFLEE-KQDEKCV-YELSAVLIHRGISAYSGHYIAHVKDARTGDWYKFNDEEIEKMEG----KKLQLGIEEDIAETVKSQTKKP--KCSKGYH-CSRNAYMLVYKVQQE-ENSGPFRTNVEVPAFLQRLVDQDNHKFEEWCSEMTDMRKQSVDKGKAKHEEVKELYKLLPARD--------------GEPYEFIPLDWLKKWLDDSTATKEIDSS------------RFLCSHDKLHPD-KVGDTRKVSMQAAQLLYERYG---GGPRLNESSLCRECVSQRCRVLRLKNQLSEDYKEISNLVKRTF-----SGAGFWVGKASLRSWRQLALEQLEEDEHETTHNNSQTNGQGPHTNNSKELSECTEDEMKTFNEDIVCSHGGLSILETERKLVSPEVWTKFREYFPKA------------PEFTQDQEPCQQCLTMEQEEKDNEAVSKMMALDQKNQLLNLFHEKNRPALTKWPQGTDV----------LYIVPLFFVDEWRKFIRRPTKSSPVSNVSNTLLLCPHGGFMFTYDSLINGEAQHVALLWPNEWDVISRLF--IVDQPISIHCLKRTTPSGSTTQYTTQPGKSPKQYTSHLLCQNQERVTRYCNGLLYILHQMKTLGVRFRSAPAQLPAVSYVEKDPAVSQDGAKRLKLS-DSSVSTAAAGVVTNVAKPGGIRRSTRHRKLRGEKALIVSANQTLKELKIQIMHAFSVAPFDQNLFIDGKSLTDDSATLGSLGIIPESIICLKADEPIADYA--AMDDVYQVRMPEEGFKGTGLL 1037          
BLAST of Ubiquitin specific peptidase 48 vs. TrEMBL
Match: E7EY58 (Ubiquitin-specific peptidase 48 OS=Danio rerio OX=7955 GN=usp48 PE=1 SV=2)

HSP 1 Score: 344.739 bits (883), Expect = 1.173e-97
Identity = 303/1128 (26.86%), Postives = 506/1128 (44.86%), Query Frame = 1
Query:   64 MKPK---RKSKWNFDNINWEEFMSHQFLSI-YNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDI----------PDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQ-DWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKV---KTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVI-----RLAIENKFNDSTDIQDET-----------NSSNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNNNEKKLICL-----SPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFL-SKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISI---------KSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIR-------------------------------LISTKDDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNL------EIGFSGTKLM 3141
            M P+    K+ W +      E ++H+ + + Y +    C+  +C++NC  N  C+  +GE  WL      + ++ +D      D N   GL N G TCY N+ LQV+F+ +EL+ A++RF               P  I  +LQ +FA +Q S  + +DP  L+ AL L   +QQDA EF  LF++L++   S   D    NVI+    G F Y+T C  CG ES +  +F E++L  +   +  + + +FLK E L  DN+Y C  C  K N  R+  LQ+LP  L FQ +R+ +D  SG KKK    + FP  L ME ++ +G+ +  T  Y + AVLIH G+   SGHY   +  ++  DW  ++D  ++K+E     KK+ LG ++ +   +   T K   K  +  H  S NAYM+ Y+++    N T   + V+VP+ L+  ++  N   E + +E+ + R++ V   K +   +KE   ++ A                    EF+P+ WL KWL +   +  I NS              +C H  L PD  I + K ++    D L   +       R   SS C  C   +  + + +N    D+     + K  L++ E+   +W+ K+ LR WR++          E K N+S    +++           +S +G  +++    N D+LC H  LSI  + R L+  E+WNK+  YFPK             P      + C  C  L  E             K   +  R   N  +  L+ L      P+ Q   +   +   LY +P  F+  WK+FI+ P+    V+ +  S + C HG F+ + D     + + I L+W +EW+ I+  +  +  + ISI           + +  + P L      C  C + +   Q +    +  + +Y+R                               L   KD  +   E G  ++K      + T+V       + +RRS R ++ R +  L ++++ T+KD+K+Q+M+ +SV+P DQ+L  +   L D + T+ ++G+ P SI+ L  D  +   A  + D++      E GF GT L+
Sbjct:   46 MAPRLQLEKAAWRWAEAVRPEDITHEHIELAYRIAVSACKRGACRRNCKGNPNCLVGIGEQSWLGEIDENTFHNIDDPNSERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRALYRFQNSRAEGHNTDSDYEPRTICEHLQYLFALLQNSNRRYIDPSGLVKALGLDTGQQQDAQEFSKLFLSLLEDTLSKQKDPNLQNVIQQQFCGQFSYVTVCNKCGRESPLPSRFYELELNIQGHKNLTECVTEFLKEEKLDGDNRYYCESCQSKQNATRRIKLQSLPRTLNFQLMRFVFDRQSGHKKKLNTFISFPEVLDMEPFL-EGREEKCT--YELSAVLIHRGVSAYSGHYIAHVRDAHTNDWYKFNDEEIEKMEG----KKLQLGIEEDIAETAKSQTRKP--KCSKGYH-CSRNAYMLVYKQQTEEINQT--ESPVDVPAFLQKLVEQDNRKFEEWCSEMSDMRKQSVDKGKAKHEEVKELYELLPAED--------------GQSYEFVPLEWLKKWLDDSTAIKEIDNSQ------------FLCTHGKLHPD-KIGEAKRISLKAADLLFSRYGGGPRLDR---SSLCRDCVTQRCRVIRLKNQLNEDYREVTNLAKSALKSEESG--FWIGKASLRSWRQLALDQLEEDEEETKHNNSKINGEKSSPGTKADGVKGDSEDGDGEEMK-NFNEDILCYHGGLSILENDRRLVSAEVWNKLRMYFPKA------------PEFTQDHDPCQQCMRLERE------------GKENEALNRMMANEQKSSLLNLFQEKNRPTLQ---KWPQDTDILYIVPLYFVEEWKKFIRRPAKGNPVSNVGNSILLCPHGGFMFTYDSMLQGDAQHIALLWPAEWEVISKMF--LVDQVISICRIHDKTQDNGNVQYQTHPDL------CRECREGFIFQQQRDMREYTQATVYVRKVIDKKRMIKESAPEFSVSGSDVEDEKEEPKLDGEKDPDFSQTEGGAKRQKLNDTVSLPTAV-VTTTSKSGIRRSTRHRKLRGEKALIVSANQTLKDLKIQIMHAFSVAPFDQNLSIDGRCLKDDSATLGSLGVIPESIICLKADEPIADYA--AMDDVYQVCMPEEGFKGTGLL 1090          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Cavefish
Match: usp48 (ubiquitin specific peptidase 48 [Source:NCBI gene;Acc:103027634])

HSP 1 Score: 316.235 bits (809), Expect = 3.966e-91
Identity = 288/1132 (25.44%), Postives = 494/1132 (43.64%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIF-----RFPVEDI-----PDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQ-DWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKV---KTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFT-IDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNS-------------SNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNN--NEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFL-SKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISI---------KSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIRLI-------------------------------STKDDHYDVNEDGPSKKKYKVN----------NQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNLEI-----GFSGTKLM 3141
            M P+    K+ W + D++  E+         Y +    C+  +C++NC  N  C+  +GE  WL      + ++ +D      D N   GL N G TCY N+ LQV+F+ +EL+  ++     R    +I     P  I  +LQ +FA +Q S  + +DP  L+ AL L   +QQDA EF  LF++L++   S   D    NVI+    G F Y+T C  C   S +  +F E++L  +   +  + + +FLK E L  DN+Y C  C  K +  R+  L +LPP L  Q +R+ +D  SG KKK    + FP  L M  ++   +  D+   Y + AVLIH G+   SGHY   +  +   DW  ++D  ++K+E     KK+ LG ++ +       T K   K  +  H  S NAYM+ Y+ +    + T IN  VEVP+ L+  +   N   E + +E+ + R++ V   K +   +KE   ++ A                    EF+P+ WL +WL +   +  I NS            + +C H  L PD  +   K ++    + L   +       R   S  C  C   +  + + +N    D+  + N  +  L         +WV K+ LRQWR++    +E +  ++     +TN               N    D     N D+LC H  LSI  ++R L+  E+W+K+  YFPK             P    + + C  C  L  E  +        L+++  S+++    N   EK    L    Q D ++      LY +P  F+  W++FI+ P+    V+ +  S + C HG F+ + D     + + I L+W +EW+ +   +  +  + ISI           + +  + P L      C  C + +   Q +    +  + +Y+R +                                 KD  ++ ++DG  ++K                  T+     +  +++RRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L  +   L D + T+ ++G+ P SI+ L  D  +   A   +D  ++     GF GT L+
Sbjct:    1 MAPRIQLEKAAWRWVDSVRPEDITQEHIDLAYRIAVSACKRGTCRRNCKGNPNCLVGIGEHLWLGEIDENTFHNIDDPNSERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRMLYMCQNSRAEGHNIESDYEPRTICEHLQYLFALLQNSNRRYIDPSGLVKALGLDTGQQQDAQEFSKLFLSLLEDTLSKQKDPSLQNVIQQQFCGQFSYVTVCNQCSRSSALPSRFYELELNIQGHKNLTECITEFLKEEKLDGDNRYYCESCQSKQSATRRIKLHSLPPTLNLQLMRFVFDRQSGHKKKLNTFISFPEVLDMSPFL---EAKDEKCTYELSAVLIHRGVSAYSGHYIAHVRDARTNDWYKFNDEEIEKMEG----KKLQLGTEEDLAETVKSQTRKP--KSSKGYH-CSRNAYMLVYKLQMEEADQTQIN--VEVPAFLQRLVDQDNKKFEEWCSEMADMRKQSVDKGKAKHVEVKELYELLPAQD--------------GEPYEFVPVEWLKEWLDDSTAIKAIDNS------------SFLCSHGKLHPD-RVGDAKRISHTAAEILYGRYGGGPRIDR---SFLCGDCVTQRCHVLRLKNQLNEDYREVTNLAKAQLKSGDPG---FWVGKASLRQWRQLALEQLEEEEEETKHTNCKTNGEKTSSTSSKDSVKENDGDTDEMKSFNEDILCCHGGLSIQETERRLVSAEVWSKLKVYFPKA------------PEFTQQQDSCQQCMRLEREGKENEA-----LNRMMASEQKSSLLNLFQEKNRPTLQKWPQ-DTDI------LYIVPLFFVDEWRKFIRRPAKSNPVSSVGNSILLCPHGGFMFTYDSMLQGDAQHIALLWPAEWEVVCRLF--LVDQTISICRICDPTQDNGNVQYHTQPEL------CRECREGFIFQQQRDLREYAQATVYVRKVIDNKRMIKEAPPEFSMSGSEAEDEKEEPKVEGEKDPDFNQSQDGAKRQKLSEGCSAVALPSGPPPTATATATVSMAKSSIRRSMRHRKLRGEKALIVSANQTLKELKIQIMHAFSVAPFDQNLSIDGRCLTDDSATLGSLGVFPESIICLKADEPIADYA-AMDDAYQVCLPEEGFKGTGLL 1054          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Cavefish
Match: usp48 (ubiquitin specific peptidase 48 [Source:NCBI gene;Acc:103027634])

HSP 1 Score: 311.997 bits (798), Expect = 9.863e-90
Identity = 283/1087 (26.03%), Postives = 480/1087 (44.16%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIF-----RFPVEDI-----PDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVN-DGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQ-DWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTN---ESYLTELENQRQEKV---KTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFT-IDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNS--------SNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNN--NEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFL-SKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISI---------KSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIRLISTKDDHYDVNEDGP-----------SKKKYKVNNQINTSVNFKEIDPN-----------TVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIA 3090
            M P+    K+ W + D++  E+         Y +    C+  +C++NC  N  C+  +GE  WL      + ++ +D      D N   GL N G TCY N+ LQV+F+ +EL+  ++     R    +I     P  I  +LQ +FA +Q S  + +DP  L+ AL L   +QQDA EF  LF++L++   S   D    NVI+    G F Y+T C  C   S +  +F E++L  +   +  + + +FLK E L  DN+Y C  C  K +  R+  L +LPP L  Q +R+ +D  SG KKK    + FP  L M  ++   G        Y + AVLIH G+   SGHY   +  +   DW  ++D  ++K+E     KK+ LG ++ +       T K   K  +  H  S NAYM+ Y+ +    + T IN  VEVP+ L+  +   N   E + +E+ + R++ V   K +   +KE   ++ A                    EF+P+ WL +WL +   +  I NS            + +C H  L PD  +   K ++    + L   +       R   S  C  C   +  + + +N    D+  + N  +  L         +WV K+ LRQWR++    +E +  ++     +TN          N    D     N D+LC H  LSI  ++R L+  E+W+K+  YFPK             P    + + C  C  L  E  +        L+++  S+++    N   EK    L    Q D ++      LY +P  F+  W++FI+ P+    V+ +  S + C HG F+ + D     + + I L+W +EW+ +   +  +  + ISI           + +  + P L      C  C + +   Q +    +  + +Y+R +   D+   + E  P            K++ KV  + +   N  +                +RRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L  +   L D + T+ ++G+ P SI+ L  D  +   A
Sbjct:    1 MAPRIQLEKAAWRWVDSVRPEDITQEHIDLAYRIAVSACKRGTCRRNCKGNPNCLVGIGEHLWLGEIDENTFHNIDDPNSERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRMLYMCQNSRAEGHNIESDYEPRTICEHLQYLFALLQNSNRRYIDPSGLVKALGLDTGQQQDAQEFSKLFLSLLEDTLSKQKDPSLQNVIQQQFCGQFSYVTVCNQCSRSSALPSRFYELELNIQGHKNLTECITEFLKEEKLDGDNRYYCESCQSKQSATRRIKLHSLPPTLNLQLMRFVFDRQSGHKKKLNTFISFPEVLDMSPFLEAKGILLLSFCTYELSAVLIHRGVSAYSGHYIAHVRDARTNDWYKFNDEEIEKMEG----KKLQLGTEEDLAETVKSQTRKP--KSSKGYH-CSRNAYMLVYKLQMEEADQTQIN--VEVPAFLQRLVDQDNKKFEEWCSEMADMRKQSVDKGKAKHVEVKELYELLPA--------------QDGEPYEFVPVEWLKEWLDDSTAIKAIDNS------------SFLCSHGKLHPD-RVGDAKRISHTAAEILYGRYGGGPRIDR---SFLCGDCVTQRCHVLRLKNQLNEDYREVTNLAKAQLKSGDPG---FWVGKASLRQWRQLALEQLEEEEEETKHTNCKTNGEKTSNSVKENDGDTDEMKSFNEDILCCHGGLSIQETERRLVSAEVWSKLKVYFPKA------------PEFTQQQDSCQQCMRLEREGKENEA-----LNRMMASEQKSSLLNLFQEKNRPTLQKWPQ-DTDI------LYIVPLFFVDEWRKFIRRPAKSNPVSSVGNSILLCPHGGFMFTYDSMLQGDAQHIALLWPAEWEVVCRLF--LVDQTISICRICDPTQDNGNVQYHTQPEL------CRECREGFIFQQQRDLREYAQATVYVRKVI--DNKRMIKEAPPEFSMSGSEAEDEKEEPKVEGEKDPDFNQSQDGAKRQKLSEGCSAVAIRRSMRHRKLRGEKALIVSANQTLKELKIQIMHAFSVAPFDQNLSIDGRCLTDDSATLGSLGVFPESIICLKADEPIADYA 1011          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Cavefish
Match: usp47 (ubiquitin specific peptidase 47 [Source:NCBI gene;Acc:103037636])

HSP 1 Score: 100.523 bits (249), Expect = 6.354e-21
Identity = 105/441 (23.81%), Postives = 176/441 (39.91%), Query Frame = 1
Query:  286 ILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDEIITY----LQTIFAQMQLSVHKMVDPVELINALELPQLE---QQDAPEFHSLFMNLVDQRFSLIDD-NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--------KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKK-KNCCNVGFPSYLSMENYV------------------------------NDGKNDDKTNEYI---------------------IKAVLIHIGLQPTSGHYQTLIHT-SNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSS-NAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTELENQRQEKVK 1398
            ILN       GL N   TCY NSLLQ  F   E + A++++  E+  ++ +T     LQ +F  +Q S  + ++  ++  +      E   Q D  E   +  + ++Q++   +  ++I  L  G  +   RC  CGYES     + +I L        +   S ++AL  F++ E L   N+Y C  C  KC+  +       P LL  Q  R+ +D +   + K    + FP  L M  ++                              ND   DD  +E I                     + +V++H G     GHY   I + S+  W  ++D +V K+   DD++K  G                      +  F SS NAYM+ Y  +D  +N   ++   + P H+K  +Q   ES   E + +RQ +++
Sbjct:  183 ILNKSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKLKDYVRCLECGYESWRIDTYLDIPLVIRPFGASQAFGSVEEALQAFIQPETLDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSPFIDLEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSTDDGVDEGICLDSTSATERVLKPKSSLTFELFSVMVHSG-SAAGGHYYACIKSFSDGQWYSFNDQHVSKITQ-DDIRKTYGGSSGSRGYY-------------SSAFASSTNAYMLIYRLKDPSRNAKYLDVE-DFPEHIKRLVQTEKES---EEQEKRQREIE 604          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Cavefish
Match: usp47 (ubiquitin specific peptidase 47 [Source:NCBI gene;Acc:103037636])

HSP 1 Score: 100.138 bits (248), Expect = 7.674e-21
Identity = 105/441 (23.81%), Postives = 176/441 (39.91%), Query Frame = 1
Query:  286 ILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDEIITY----LQTIFAQMQLSVHKMVDPVELINALELPQLE---QQDAPEFHSLFMNLVDQRFSLIDD-NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--------KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKK-KNCCNVGFPSYLSMENYV------------------------------NDGKNDDKTNEYI---------------------IKAVLIHIGLQPTSGHYQTLIHT-SNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSS-NAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTELENQRQEKVK 1398
            ILN       GL N   TCY NSLLQ  F   E + A++++  E+  ++ +T     LQ +F  +Q S  + ++  ++  +      E   Q D  E   +  + ++Q++   +  ++I  L  G  +   RC  CGYES     + +I L        +   S ++AL  F++ E L   N+Y C  C  KC+  +       P LL  Q  R+ +D +   + K    + FP  L M  ++                              ND   DD  +E I                     + +V++H G     GHY   I + S+  W  ++D +V K+   DD++K  G                      +  F SS NAYM+ Y  +D  +N   ++   + P H+K  +Q   ES   E + +RQ +++
Sbjct:  163 ILNKSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKLKDYVRCLECGYESWRIDTYLDIPLVIRPFGASQAFGSVEEALQAFIQPETLDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSPFIDLEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSTDDGVDEGICLDSTSATERVLKPKSSLTFELFSVMVHSG-SAAGGHYYACIKSFSDGQWYSFNDQHVSKITQ-DDIRKTYGGSSGSRGYY-------------SSAFASSTNAYMLIYRLKDPSRNAKYLDVE-DFPEHIKRLVQTEKES---EEQEKRQREIE 584          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Cavefish
Match: usp47 (ubiquitin specific peptidase 47 [Source:NCBI gene;Acc:103037636])

HSP 1 Score: 97.0561 bits (240), Expect = 6.989e-20
Identity = 104/441 (23.58%), Postives = 175/441 (39.68%), Query Frame = 1
Query:  286 ILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDEIITY----LQTIFAQMQLSVHKMVDPVELINALELPQLE---QQDAPEFHSLFMNLVDQRFSLIDD-NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--------KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKK-KNCCNVGFPSYLSMENYV------------------------------NDGKNDDKTNEYI---------------------IKAVLIHIGLQPTSGHYQTLIHT-SNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSS-NAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTELENQRQEKVK 1398
            ILN       GL N   TCY NSLLQ  F   E + A++++  E+  ++ +T     LQ +F  +Q S  + ++  ++  +      E   Q D  E   +  + ++Q++   +  ++I  L  G  +   RC  CGYES     + +I L        +   S ++AL  F++ E L   N+Y C  C  KC+  +       P LL  Q  R+ +D +   + K    + FP  L M  ++                              ND   DD  +E I                     + +V++H G     GHY   I + S+  W  ++D +V K+  I+                   TN         ++F SS NAYM+ Y  +D  +N   ++   + P H+K  +Q   ES   E + +RQ +++
Sbjct:  177 ILNKSETGYVGLVNQAMTCYLNSLLQTLFMTPEFRNALYKWEFEESEEDPVTSIPYQLQRLFVLLQTSKKRAIETTDVTRSFGWDSSEAWQQHDVQELCRVMFDALEQKWKQTEQADLINQLYQGKLKDYVRCLECGYESWRIDTYLDIPLVIRPFGASQAFGSVEEALQAFIQPETLDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPEELDMSPFIDLEDEKSPQTESCTDSGAENEGSCHSDQMSNDFSTDDGVDEGICLDSTSATERVLKPKSSLTFELFSVMVHSG-SAAGGHYYACIKSFSDGQWYSFNDQHVSKVSQIE-------------------TNDL-------LYFNSSTNAYMLIYRLKDPSRNAKYLDVE-DFPEHIKRLVQTEKES---EEQEKRQREIE 586          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001446.1 (pep scaffold:Pmarinus_7.0:GL476913:23272:104531:1 gene:ENSPMAG00000001292.1 transcript:ENSPMAT00000001446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.7449 bits (234), Expect = 9.439e-20
Identity = 98/392 (25.00%), Postives = 163/392 (41.58%), Query Frame = 1
Query:  316 GLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDEIITY--LQTIFAQMQLSVHKMVDPVE-----LINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREI--DLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDN-SGTKKKNCCNVGFPSYLSMENYVND---GKND-----------------DKTNEYIIKAVLIHIGLQPTSGHYQTLIHT-------SNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYER----EDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTE 1368
            GL N G TCY  S +Q  + I + ++A+F     D      T   LQ +F  +  S  K  +P       +++ L L   EQ+D  EF +  +  +++  S    N +K+L  G          C + SQ   +F  +   +  M +  ++L +    + L  DN Y CS C  K   E++   + LP +L F  +RY+++  +  K+K   +  FP  L M  Y      G++D                 +++ EY +  V +H G     GHY + I          N  W L++D  V+  ++     +  G + T     D +T+K      +  H    +AYM+FY+R    EDV K  T      ++P  L   I   N  +L +
Sbjct: 1955 GLTNLGATCYMASTIQQLYMIPQARQAVFTAKYTDDMKHKTTLFELQKMFTYLMESERKAYNPRSFCKNYMMDKLPLNTGEQKDMTEFFTDLITKIEE-MSPELKNTVKTLFGGVITNNVVSLDCDHVSQTVEEFYTVRCQVADMKNIYESLDEVTVKDTLEGDNMYTCSQCGKKVRAEKRACFKKLPQILSFNTMRYTFNMVTMMKEKVNTHFSFPLRLDMTPYTERWLMGRSDRAEGLKVEEGAGGVAKAEESYEYDLIGVTVHTG-TADGGHYYSFIRDIINPAAYRNNKWYLFNDAEVKPFDSTQLASECFGGEMT-TKTYDSVTDKFMDFSFEKTH----SAYMLFYKRVESSEDVGKEST-----FDIPPELLEWIWHDNMQFLQD 2334          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Sea Lamprey
Match: usp7 (ubiquitin specific peptidase 7 (herpes virus-associated) [Source:ZFIN;Acc:ZDB-GENE-030131-3656])

HSP 1 Score: 90.1225 bits (222), Expect = 1.501e-18
Identity = 91/354 (25.71%), Postives = 148/354 (41.81%), Query Frame = 1
Query:  313 AGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVE--DIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLE---QQDAPEFHSLFMNLVDQRF-SLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCN-GERQTVLQTLPPLLCFQFLRYSYDNSGTKK-KNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHT-SNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQ 1341
             GLKN G TCY NSLLQ  +   +L++A+++ P E  D    +   LQ +F ++Q S  K V   +L  +     L+   Q D  E   + ++ V+ +      +  I  L  G      +CK   Y S+    + +I L  K   +  ++  D++ VE L  DNKYD     H     E+     + PP+L  Q +R+ YD    +  K      FP  L +++++     +D    YI+ AVL+H G     GHY   ++   +  W  +DD  V +                   K + I +   G +        +NAYM+ Y RE        +    ++P  L   +Q
Sbjct:  193 VGLKNQGATCYMNSLLQTLYFTNQLRKAVYQMPTEGDDSSKSVPLALQRVFYELQHS-DKPVGTKKLTKSFGWETLDSFMQHDVQELSRVLLDNVENKMKGTCVEGTIPKLFGGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIYESFNDYVAVEQLDGDNKYDAG--EHGLQEAEKGVKFLSFPPVLHLQLMRFMYDPQTDQNIKINDRFEFPERLILDDFLQKLDAEDSAT-YILHAVLVHSG-DNHGGHYVVYLNPMGDGKWCKFDDDVVSR-----------------CTKKEAIEHNYGGLDDDFSVRHCTNAYMLVYIRESKLDYVLQMVKDTDIPMQLVDRLQ 524          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005124.1 (pep scaffold:Pmarinus_7.0:GL490092:2610:6304:1 gene:ENSPMAG00000004660.1 transcript:ENSPMAT00000005124.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 3.347e-17
Identity = 67/235 (28.51%), Postives = 102/235 (43.40%), Query Frame = 1
Query:  316 GLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPD------------EIITYLQTIFAQMQLSVHKMVDPVELINALELPQLE---QQDAPEFHS-LFMNLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLKPM--LSFDQALLD-FLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKK-KNCCNVGFPSYLSMENY 960
            G++N G TCY NSLLQ  F+  E++EAIF    E++ D             I   LQ +FAQ+ L   + V    L ++      E   Q D  E    LF  L       +  ++I  L  GT      C+ CG  ++    F+++ +        ++AL   + + E +  DN+Y C  C       +   L+TLP +L F  LR+S+D    ++ K      FP  L M  Y
Sbjct:   42 GIQNLGATCYLNSLLQTLFHTPEMREAIFSLKPEELGDLADKDKPGAKVRVIPLQLQRLFAQLLLLDQQAVSTAALTDSFGWTHTEEGHQHDVQELSRILFGALECSLVGTMGHDLISRLYHGTVVNQITCRDCGRRNEREETFQDLTMAVHGNRGLEEALSSYYCESEEMEGDNRYCCDECARLVCATKSAKLRTLPTILTFSLLRFSFDFVKCERYKETGRFTFPRLLDMRPY 276          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Sea Lamprey
Match: usp12a (ubiquitin specific peptidase 12a [Source:NCBI gene;Acc:565736])

HSP 1 Score: 83.1889 bits (204), Expect = 4.017e-17
Identity = 80/311 (25.72%), Postives = 132/311 (42.44%), Query Frame = 1
Query:  316 GLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDE-IITYLQTIFAQMQLSVHKM--VDPVELINALE-----LPQLEQQDAPEFHSLFMNLV----------DQRFSLIDDNV-------------------IKSLISGTFRYLTRCKGCGYESQMNCQFRE--IDLKPMLSFDQAL--LDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSY-DNSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQDWILYDDLNVQKLE 1122
            GL N+GNTCY NS+LQ  +     +E +  + V+    E ++T L  +F  +     K+  + P + I+ L           QQDA EF +  +N +          +++   + + V                   +  +  GT    TRC  C   S  +  F +  +D++   S    L    F   E L  + KY C  C  K   +++  ++ LP +L     R+ Y +      K    V FP  L + N   D  N D+   Y + AV++H G  P  GHY T++  S+  W+L+DD  V+K++
Sbjct:   36 GLVNFGNTCYCNSVLQALYFCKPFREKVLDYKVQPKKKENLLTCLADLFHSIATQKKKVGVIPPKKFISRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEEKKQERQNGKLKNGVAAAAAAADGDDSTKTEPTWVHDIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQNTSITHCLSPRGFSNTETLCSEYKYYCEQCCSKQEAQKRMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRM--YDLVAVVVHCGSGPNRGHYITIV-KSHGFWLLFDDDIVEKID 343          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008243.1 (pep scaffold:Pmarinus_7.0:GL481682:14201:19993:-1 gene:ENSPMAG00000007452.1 transcript:ENSPMAT00000008243.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 8.612e-15
Identity = 81/318 (25.47%), Postives = 127/318 (39.94%), Query Frame = 1
Query:  316 GLKNYGNTCYFNSLLQVYFNIVELKEAIFRFP-VEDI---------PDEIITYLQTIFAQMQLSVHKMVDPVE---LINAL--ELPQLEQQDAPEF-----------------------------HSLFMNLVDQRFSLIDDNVIKSLISGTFRYLTRCKGC-----GYESQMNCQFR-EIDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCNVGFP-SYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQD-WILYDDLNVQ 1113
            GL+N GNTCY NS++Q   N   L E       V +I           +++     I   +    ++ + P +   +I  L  +    EQ D+ E                               S+   L    +  I+++++ +L  G FR   +C  C      +E  MN       D     +    L  F K E +TD N+Y CS C  +    +   +  LPP+L     R+SY     K+K   NVGFP + L M+ Y+ +   D++ +EY + AV  H G     GHY    H + +D W  +DD  V+
Sbjct:   97 GLRNLGNTCYMNSVVQCLSNTTSLAEYFLTSQYVNNINSRNNPLGRKGQVVEEFAVIVRALWSGQYRSITPRDFKFMIGRLNDQFCGTEQHDSQELLIFLLDGLHEDLNQAKRVRVKEEKTEHLSDSMAAQLAWDAYKHINESILVTLFHGQFRSTIKCLTCQKVSRTFEVFMNLTLHLPSDTTSKCTLQDCLQMFSKPEKMTDANRYLCSHCKQRRESVKTMEIWKLPPVLIIHLKRFSYSGRW-KQKLQTNVGFPLTSLDMKPYIIN--KDNRYSEYNLYAVSNHYG-SLDGGHYTAYTHNTVRDSWFKFDDHEVE 410          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Yeast
Match: UBP15 (Ubiquitin-specific protease involved in protein deubiquitination; forms a complex with AAA peroxins Pex1p and Pex6p; deubiquitinates mono- and polyubiquitinated forms of Pex5p; deubiquitinates Clb5p, counteracting APC activity, and facilitating both Clb5p accumulation and S phase entry; physically interacts with anaphase-promoting complex/cyclosome (APC/C) activator, Cdh1p; catalytic activity regulated by an N-terminal TRAF-like domain and and C-terminal sequences [Source:SGD;Acc:S000004920])

HSP 1 Score: 89.7373 bits (221), Expect = 1.700e-18
Identity = 89/358 (24.86%), Postives = 162/358 (45.25%), Query Frame = 1
Query:  313 AGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVE-DIP-DEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLE---QQDAPEFHSLFMNLVDQRFSLID-DNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVN--------DGKNDDKTNEYI--IKAVLIHIGLQPTSGHYQTLIHTSNQD-WILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHL 1326
             G +N G TCY NSLLQ YF     ++ ++  P E + P + +   LQ  F Q+Q+S   + D +EL  +      E   Q D  E + + M+ ++        +  +  +  G  +   +C    YES     F ++ L  K   +  ++  +++++EL+  +N+Y  +      + ++  + ++ PP+L  Q  R+ YD N     K      FP  + +  +V+        D +N DK N Y+  +  VL+H G   ++GHY TLI    +D W  +DD  V ++      ++  G  +    K   +T    G+ Q  I    ++AYM+ Y R++  ++        +VP H+
Sbjct:  205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTEHESPNNSVPLALQRAFYQLQVSDIPL-DTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTPVEGKLNEIFVGKMKSYIKCINVDYESARVEDFWDLQLNVKNFKNLQESFDNYIEMELMNGENQY-AAQDYGLQDAQKGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSENKDK-NPYVYNLHGVLVHSG-DISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQVFQENFGCDRLPDEKVRTMT---RGEYQNYIIQRHTSAYMLVYIRQEQEEDLLRPVLESDVPKHV 555          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Yeast
Match: UBP9 (Ubiquitin-specific protease that cleaves ubiquitin-protein fusions; UBP9 has a paralog, UBP13, that arose from the whole genome duplication [Source:SGD;Acc:S000000900])

HSP 1 Score: 68.1662 bits (165), Expect = 5.386e-12
Identity = 73/287 (25.44%), Postives = 114/287 (39.72%), Query Frame = 1
Query:  388 KEAIFRFPVEDI-----PDEIITY---LQTIFAQM--QLSVHKMVDPVELINALE-----LPQLEQQDAPEFHSLFMN--------------LVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQF----------REIDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCC---NVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQDWILYDDLNVQKLE 1122
            K A+ R PV ++     P E  T    L+ IF  +   LS+  +V P E +  L+        + QQDA EF +  +N                 Q+    +DN I  L  GT     +C  C   +  +  F           E D++ ML        + + E+L   NK+ C+ C      ER   L+ LP +L     R+ Y  S  +K N      + +P  L + +  N         +Y +  V+IH+G  P  GHY  +       W+LYDD  V+ ++
Sbjct:  368 KAALIRGPVLNVDHLLYPTEEATLYNGLKDIFESITENLSLTGIVSPTEFVKILKKENVLFNTMMQQDAHEFLNFLLNDFSEYIQRNNPRMRFGPQKTDNSNDNFITDLFKGTLTNRIKCLTCDNITSRDEPFLDFPIEVQGDEETDIQKMLK------SYHQREMLNGVNKFYCNKCYGLQEAERMVGLKQLPHILSLHLKRFKY--SEEQKSNIKLFNKILYPLTLDVSSTFNTSV----YKKYELSGVVIHMGSGPQHGHYVCICRNEKFGWLLYDDETVESIK 642          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Yeast
Match: UBP8 (Ubiquitin-specific protease component of the SAGA acetylation complex; required for SAGA (Spt-Ada-Gcn5-Acetyltransferase)-mediated deubiquitination of histone H2B [Source:SGD;Acc:S000004836])

HSP 1 Score: 62.3882 bits (150), Expect = 1.956e-10
Identity = 79/325 (24.31%), Postives = 129/325 (39.69%), Query Frame = 1
Query:  313 AGLKNYGNTCYFNSLLQV-----YF------------NIVELKEAIFRFPVEDIPDEIITYLQTIFAQMQ-LSVHKMVDPVELINAL-----ELPQLEQQDAPEFHSLFMNLVDQRFSLIDDN--------------VIKSLISGTFRYLTRCKGCGYESQMNCQ-FREI--DLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNE--------YIIKAVLIHIGLQPTSGHYQTLIHTSNQDWILYDDLNVQKLENIDDVKK 1143
            +GL N G+TC+ +S+LQ      YF              V   +  F   ++ I  E+   L T  A     S ++    + L+         L    QQDA EF    +N + Q + L   N              ++ ++  G+      C GC   S+     F ++  D+K      + L  F K E L D N Y C  C    +  +Q  +  LP +L  Q  R+ +  +G+ +K    + FP+YL+M+NY +  K  DK +E        Y +  ++ H G     GHY      S   W  ++D  V  +   + +K+
Sbjct:  137 SGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYGALNTKQASSSSTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQSYVLDLPNAKEVSRANNKQCECIVHTVFEGSLESSIVCPGCQNNSKTTIDPFLDLSLDIKDKKKLYECLDSFHKKEQLKDFN-YHCGECNSTQDAIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCST-KEKDKHSENGKVPDIIYELIGIVSHKG-TVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKE 458          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Yeast
Match: UBP13 (Ubiquitin-specific protease that cleaves Ub-protein fusions; UBP13 has a paralog, UBP9, that arose from the whole genome duplication [Source:SGD;Acc:S000000163])

HSP 1 Score: 58.151 bits (139), Expect = 5.283e-9
Identity = 65/286 (22.73%), Postives = 118/286 (41.26%), Query Frame = 1
Query:  388 KEAIFRFPVEDI------PDEIITY--LQTIFAQMQLSVH--KMVDPVELINALELPQL-----EQQDAPEFHSLFMNLV-------DQRFSLID----------DNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLKPMLSFDQALLDFLKV----ELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCC-----NVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQDWILYDDLNVQKLE 1122
            K A+ R PV +I       D+   Y  L+ IF  +  + +   +V P   ++ L+   +       QDA EF +  +N +       +++ +  D           N I  L  GT     +C  C   +  +  F +  ++     +  + + LK     E+L   NK+ C  C      ER   L+ LP  L     R+ Y    ++K+NC      N+ +P  L++ + +N         +Y +  +++H+G  P  GHY +L       W+L+DD  V+ ++
Sbjct:  366 KSALIRGPVLNIDHSLNGSDKATLYSSLRDIFECITENTYLTGVVSPSSFVDVLKRENVLFNTTMHQDAHEFFNFLLNELSEYIERENKKIAASDINSDSEPSKSKNFISDLFQGTLTNQIKCLTCDNITSRDEPFLDFPIEVQGDEETDIQEILKSYHQREMLNGSNKFYCDECCGLQEAERLVGLKQLPDTLTLHLKRFKY----SEKQNCNIKLFNNIHYPLTLNVCSSINS----KVCQKYELAGIVVHMGGGPQHGHYVSLCKHEKFGWLLFDDETVEAVK 643          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Nematostella
Match: EDO34745 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SNG8])

HSP 1 Score: 87.8113 bits (216), Expect = 1.547e-17
Identity = 101/387 (26.10%), Postives = 157/387 (40.57%), Query Frame = 1
Query:  313 AGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVE--DIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLE---QQDAPEF-HSLFMNLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVL-QTLPPLLCFQFLRYSYDN-SGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHT-SNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTELENQRQEKVKTQEHFIKESETIIE 1440
             GLKN G TCY NSLLQ  +    L++A+++ P E  D+   +   LQ +F ++Q S  K V   +L  +     L+   Q D  E    L  N+  +      +  I  L+ G      +C    Y S     F +I L  K   +   +  ++   ELL  DNKYD     H     ++ V+ +  PP+L  Q +R+ YD  +    K      F   + ++ Y+ +   +D    Y + AVL+H G     GHY   I+   +  W  +DD  V                 ++  K + I N   G E        +NAYM+ Y R+           + E+P  L   +Q         LE QR+ K +T+ H     E + E
Sbjct:  197 VGLKNQGATCYMNSLLQTLYFTCALRKAVYQMPTENDDLGKSVAFALQRVFYELQHS-DKAVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNMESKMKGTCVEGTIPRLLEGKLFSYIKCTKVDYVSTRLEPFYDIQLNVKGKKNIHDSFKEYCASELLDGDNKYDAG--EHGLQEAKKGVMFKKFPPVLHLQLMRFQYDPVADANVKINDRYEFYDKIDLDRYLQE--LEDTPAVYTLHAVLVHSG-DNHGGHYVVYINPKGDGRWCKFDDDVV-----------------SLATKQEAIDNNFGGYEDDVTVKHCTNAYMLVYIRDSHINEILEEVTNNEIPDTLVSRLQEER-----RLEVQRR-KERTEAHLYITVEVVTE 554          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Nematostella
Match: EDO35056 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SMM5])

HSP 1 Score: 77.0258 bits (188), Expect = 4.133e-14
Identity = 70/296 (23.65%), Postives = 126/296 (42.57%), Query Frame = 1
Query:  535 EQQDAPEFHSLFMNLVDQRFSLIDDNVIKS-LISGTFRYLTRCKGCGYESQMNCQFRE--IDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCC-----NVGFPSYLSMENYVN------DGKNDDK-------------------TNEYIIKAVLIHIGLQPTSGHYQ--------TLIHTSNQDWILYDDLNVQ--KLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTT 1293
            EQ DA EF +  ++ +D+   ++ +  I S ++ G+F     CKGC +       F    +D++   S   ++  F+K +LL   N Y C  C  K +  ++  +  LP ++  Q  R+ YD     ++ C         FP  + ME Y        +GK  D+                   +  Y ++ +L+H G Q + GHY          L+   +  W  +DD +V   K+E+ +++K      + +    D +  + + + Q+       NAY++FYERED+     T
Sbjct: 1691 EQHDALEFFNNLLDNLDEGMKVLGNEPIFSKVLGGSFADQKICKGCPHRYSREAPFIALNVDIRNHQSLHDSMEQFVKGDLLEGANAYHCEKCDKKVDTVKRMCISKLPRVMAIQLKRFDYD----WERECAVKFNDYFEFPREIDMEPYTELGLAKAEGKALDQIPPELVAESEKHDPPPQALSTHYRLRGILVHSG-QASGGHYYCYILQRYCILLSDDSHRWYKFDDGDVSECKMEDDEEMKAQCFGGEYMGEVFDHMLKRMSYRRQKRWW----NAYILFYEREDIIDTSNT 1977          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Nematostella
Match: EDO44319 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVY4])

HSP 1 Score: 76.2554 bits (186), Expect = 6.618e-14
Identity = 73/234 (31.20%), Postives = 100/234 (42.74%), Query Frame = 1
Query:  316 GLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQ-----LEQQDAPEFHSLFMNLVDQR----FSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLKPM-LSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTV----LQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDG 972
            GLKN G TCY NS+LQ  +    ++E     P       +   +Q++F  +  S  +   P +     +L        EQQDA EF   F NL DQ      S   D + K    G F     CK C +  +    F  + +     +   +L  F+  E+L  DN Y C     KCN  R TV    ++TLPP+L  Q  R+ YD  +G   K      FP  L ME Y +DG
Sbjct: 1557 GLKNAGATCYMNSVLQQLYMQPGIREVRKPHPC------VFYQIQSLFGCLMDSKLQYFAPEQFWKCFKLWGQPVNVREQQDAFEF---FCNLTDQLDEHLKSKKQDQLFKKTFCGMFADQKICKECNHRYEREEAFYSLPVTVKNHNLQDSLEQFVNGEILEGDNAYFC----EKCNKRRTTVKRMCIKTLPPVLVIQLKRFGYDWEAGRALKFDDYFEFPWTLDMEPYTSDG 1777          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Nematostella
Match: EDO44477 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7RVM0])

HSP 1 Score: 72.4034 bits (176), Expect = 2.423e-13
Identity = 61/221 (27.60%), Postives = 96/221 (43.44%), Query Frame = 1
Query:  616 IKSLISGTFRYLTRCKGCGYESQMNCQFRE--IDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTK-KKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQDWILYDDLNVQKLE--NIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYE 1263
            +  +  GT    TRC  C   S  +  F +  +D++   S    L  F   E L  + KY C  C  K   +++  ++ LP LL     R+ Y     +  K    V FP  L + N  +D  N+D+   Y + +V+IH G  P  GHY T++  S+  W+L+DD  V+K+E   I+D   +                        +IH  S + Y++FYE
Sbjct:  188 VHEMFEGTLTNETRCLCCESVSSKDESFLDLSVDVEQNTSITHCLRGFSSTETLCSEYKYFCETCCTKQEAQKRMRVKKLPKLLALHLKRFKYMEQLQRYTKLSYRVVFPFELRLFNTSDDAVNNDQL--YDLVSVVIHCGSGPNRGHYITIV-KSHGFWLLFDDDIVEKIEPHTIEDFYGL----------------------TSDIHKSSESGYILFYE 383          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Nematostella
Match: EDO36756 (Ubiquitin carboxyl-terminal hydrolase [Source:UniProtKB/TrEMBL;Acc:A7SHS4])

HSP 1 Score: 72.4034 bits (176), Expect = 8.392e-13
Identity = 81/351 (23.08%), Postives = 141/351 (40.17%), Query Frame = 1
Query:  313 AGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDEIITYLQTIFAQMQLSVHKMVDPVELINALEL-PQL----EQQDAPEFHSLFMNLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREI--DLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDN-SGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNE-------------------YIIKAVLIHIGLQPTSGHYQTLIHTSN---QD-WILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYERED 1272
             G+ N G TCY  S +Q  F + + + +I                       ++S  K  +P        +  QL    EQ+D  EF +  ++ +++    + D +++ L  G          C + S+   +F  +   +  M +  ++L +    + L  DN Y CS C  K   E++     LP +LCF  +RY+++  +  K+K   +  FP  L+M  Y  +    DK +E                   Y +  V++H G     GHY + I   +   QD W L++D  V+  +      +  G + T     D ++ K      +  H    +AYM+FYER D
Sbjct:  117 VGIINLGATCYMASCIQQLFLMPQARCSIL--------------------NAKMSERKAYNPRSFCRTYTMDKQLINTGEQKDMTEFFTDLISKLEEMSPSLRD-LVRELFCGVITNNVVSLDCSHVSKTKEEFYSVRCTVADMKNLYESLDEVTVKDTLDGDNMYTCSQCGKKVRAEKRACFTVLPRILCFNTMRYTFNMVTMMKEKVNTHFSFPLQLNMAPYSEEYLMGDKVDEVPNYSYSVVADAEKDPNYWYNLIGVVVHTG-TAEGGHYYSFIRNRSYPQQDKWFLFNDAEVKPFDPSQIAGECFGGEMT-TKTYDVVSEKFMDLSFEKTH----SAYMLFYERCD 440          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Medaka
Match: usp48 (ubiquitin specific peptidase 48 [Source:NCBI gene;Acc:101157362])

HSP 1 Score: 331.643 bits (849), Expect = 1.356e-96
Identity = 292/1123 (26.00%), Postives = 496/1123 (44.17%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIF-----RFPVEDI-----PDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLKPML--SFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTS-NQDWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTIN-NSVEVPSHLKGNIQMTNESY------LTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFT-IDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNS---------------SNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNN--NEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFL-SKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIRLI-----STKDDHYDVN--------------------------------EDGPSKKKYKVNNQINTSVNF-KEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDNLEI-----GFSGTKLM 3141
            M P+    K+ W + +++  EE         Y ++   C+  +C++NC  N  C+  +GE  WL      + ++ +D      D N   GL N G TCY N+ LQV+F+ +EL+  ++     R    D      P  I  +LQ +FA +Q S  K +DP  L+ AL L   +QQDA EF  LF++L++   S   +    NVI+    G F Y+T C  CG  S +  +F E++L  +   +  + + +FLK E L  +N+Y C  C  K +  R+  L +LPP L  Q +R+ +D  +G KKK    + FP  L ME ++       + + Y + AVLIH G+   SGHY   +  +   DW  ++D  ++K+E     KK+ LG ++ +       + K   K  +  H  S NAYM+ Y+ +     H  ++  SVEVP+ L+  +   N  +      ++++  Q  +K K +   +KE   ++ A                  + EF+P+ WL KWL +      I  S              +C H  L PD  +   K V+    + L   +       R   SS C  C   +  + + +N    D+  + N V++ L     + + YWV K+ LR WR++    +E   ++      +TN                S G+ +++    N D+LC H  LSI  ++R L+  E+W+K+ +YFPK   E  EKQ           E C  C +L  E           +SK+    ++ +  N  +EK    LS   Q  +        LY +P  F+  W++FI+ P+  + V+ +  S + C HG F+ + D     + + I L+W SEW+ I+  +   +  +I    +    S P   +   +C  C + +   Q K    +  + IYIR +       KD   ++N                                +DG  + +         ++          +RRS R ++ R +  L ++++ T+K++K+Q+M+ +SV+P DQ+L  +   L D + T+ ++G+ P SI+ L  D  +   A   +D  ++     GF GT L+
Sbjct:    1 MAPRVQLEKAAWRWVEHVKPEEITQEHIELAYRINLPACKRGACRRNCKGNPNCLVGIGEQAWLGEIDENTFHNIDDPNSERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRILYQCHNSRAQEHDTDTDYDPQSISEHLQYLFALLQNSNRKYIDPSGLVKALGLDTGQQQDAQEFSKLFLSLLEDTLSKQKNPNLHNVIQQQFCGQFFYVTVCNQCGRSSALPSRFYELELNILGHKNLTECITEFLKEEKLDGENRYFCESCQSKQSATRRIKLHSLPPTLNLQLMRFVFDRQTGHKKKLNTFISFPEQLDMEPFLE--ARPGQKSVYELSAVLIHRGISAYSGHYIAHVKDALTGDWYKFNDEEIEKMEG----KKLQLGIEEDIAEAVKSPSRKP--KCSKGYH-CSRNAYMLVYKVQ--ADEHPDLSETSVEVPAFLQRLVDRDNHRFEEWCMEMSDMRKQSVDKGKAKHEEVKELYELLPARD--------------GEQYEFIPLEWLKKWLDDSTATKEIDTS------------LFLCSHGKLHPD-KVADCKRVSLQAAELLYRRYG---GGPRLDGSSLCRDCVSWRCRVLRLKNQLNEDYKEVSNLVKRTL-----SGEGYWVGKASLRSWRQLALEQLEEDEHEGKHSDSQTNGQGPHTNNIKEFCSDLSGGTEEEMK-TFNEDILCSHGGLSILEAERKLVSPEVWSKLREYFPKA-PEFTEKQ-----------EACRQCLTLEQEEKDNEA-----VSKMMALDQKNQLLNLFHEKNRPTLSKWPQNTD-------VLYVVPLFFVEEWRKFIRRPTKSSPVSNVGNSLLLCPHGGFMFTYDSLISGDAQHIALLWPSEWEVISRLFIVDQAISIHCLRESTEGSTPQYTTQPELCWDCRESFLFQQQKDLREYNQATIYIRKVLEDARMVKDVTPEMNASSSEAEEEREEHLKLEGGEDPDFSQSALLQSQDGAKRLRLADGTVAPAALPVTTSAKVGGIRRSTRHRKLRGEKALIVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKSLTDDSATLGSLGVVPESIICLKADEPIADYA-AMDDAYQVRLPEEGFKGTGLL 1051          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Medaka
Match: usp48 (ubiquitin specific peptidase 48 [Source:NCBI gene;Acc:101157362])

HSP 1 Score: 300.056 bits (767), Expect = 7.796e-86
Identity = 274/1056 (25.95%), Postives = 462/1056 (43.75%), Query Frame = 1
Query:   64 MKPK---RKSKWNF-DNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYCINKLGETKWLNN-KSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIF-----RFPVEDI-----PDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDD----NVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLKPML--SFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTS-NQDWILYDDLNVQKLENIDDVKKI-LGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTIN-NSVEVPSHLKGNIQMTNESY------LTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFT-IDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQ--------DETNSSNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNN--NEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFL-SKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTK----FENSVIYIRLISTKDDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIA 3090
            M P+    K+ W + +++  EE         Y ++   C+  +C++NC  N  C+  +GE  WL      + ++ +D      D N   GL N G TCY N+ LQV+F+ +EL+  ++     R    D      P  I  +LQ +FA +Q S  K +DP  L+ AL L   +QQDA EF  LF++L++   S   +    NVI+    G F Y+T C  CG  S +  +F E++L  +   +  + + +FLK E L  +N+Y C  C  K +  R+  L +LPP L  Q +R+ +D  +G KKK    + FP  L ME ++       + + Y + AVLIH G+   SGHY   +  +   DW  ++D  ++K+E     KK+ LG ++ +   ++ + +     +    +  S NAYM+ Y+ +     H  ++  SVEVP+ L+  +   N  +      ++++  Q  +K K +   +KE   ++ A                  + EF+P+ WL KWL +      I  S              +C H  L PD  +   K V+    + L   +       R   SS C  C   +  + + +N    D+  + N V++ L     + + YWV K+ LR WR++    +E   ++   I          E +  +G  ++     N D+LC H +LSI  ++R L+  E+W+K+ +YFPK             P    K E C  C +L  E           +SK+    ++ +  N  +EK    LS   Q  +        LY +P  F+  W++FI+ P+  + V+ +  S + C HG F+ + D     + + I L+W SEW+ I+  +  I  + ISI             S+  +C  C + +   Q K    +  + IYIR +   +D   V +  P         +     + K                     L+   D        Q+M+ +SV+P DQ+L  +   L D + T+ ++G+ P SI+ L  D  +   A
Sbjct:    1 MAPRVQLEKAAWRWVEHVKPEEITQEHIELAYRINLPACKRGACRRNCKGNPNCLVGIGEQAWLGEIDENTFHNIDDPNSERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRILYQCHNSRAQEHDTDTDYDPQSISEHLQYLFALLQNSNRKYIDPSGLVKALGLDTGQQQDAQEFSKLFLSLLEDTLSKQKNPNLHNVIQQQFCGQFFYVTVCNQCGRSSALPSRFYELELNILGHKNLTECITEFLKEEKLDGENRYFCESCQSKQSATRRIKLHSLPPTLNLQLMRFVFDRQTGHKKKLNTFISFPEQLDMEPFL-------EKSVYELSAVLIHRGISAYSGHYIAHVKDALTGDWYKFNDEEIEKMEG----KKLQLGIEEDI---AEAVKSPSRKPKCSKGYHCSRNAYMLVYKVQ--ADEHPDLSETSVEVPAFLQRLVDRDNHRFEEWCMEMSDMRKQSVDKGKAKHEEVKELYELLPARD--------------GEQYEFIPLEWLKKWLDDSTATKEIDTS------------LFLCSHGKLHPD-KVADCKRVSLQAAELLYRRYG---GGPRLDGSSLCRDCVSWRCRVLRLKNQLNEDYKEVSNLVKRTL-----SGEGYWVGKASLRSWRQLALEQLEEDEHEGKHIVICLNGETLHEKDYLSGGTEEEMKTFNEDILCSHGSLSILEAERKLVSPEVWSKLREYFPKA------------PEFTEKQEACRQCLTLEQEEKDNEA-----VSKMMALDQKNQLLNLFHEKNRPTLSKWPQNTD-------VLYVVPLFFVEEWRKFIRRPTKSSPVSNVGNSLLLCPHGGFMFTYDSLISGDAQHIALLWPSEWEVISRLF--IVDQAISIHC--------LRESTEELCWDCRESFLFQQQKDLREYNQATIYIRKVL--EDARMVKDVTPEMNASSSEAEEEREEHLK---------------------LEGGEDPDFS----QIMHAFSVAPFDQNLSIDGKSLTDDSATLGSLGVVPESIICLKADEPIADYA 944          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Medaka
Match: usp46 (ubiquitin specific peptidase 46 [Source:NCBI gene;Acc:101155670])

HSP 1 Score: 91.6633 bits (226), Expect = 3.454e-19
Identity = 83/307 (27.04%), Postives = 130/307 (42.35%), Query Frame = 1
Query:  316 GLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDE-IITYLQTIFAQMQLSVHKM--VDPVELINALE-----LPQLEQQDAPEFHSLFMNLV-----------DQRFSL----------------IDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFRE--IDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSY-DNSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQDWILYDDLNVQKLE 1122
            GL N+GNTCY NS+LQ  +     +E +  +  +    E ++T L  +F  +     K+  + P + I+ L           QQDA EF +  +N V            Q   L                I+   +  +  GT    TRC  C   S  +  F +  +D++   S    L DF   E L  + KY C  C  K   +++  ++ LP +L     R+ Y +      K    V FP  L + N   D  N D+   Y + AV++H G  P  GHY T++  S+  W+L+DD  V+K++
Sbjct:   36 GLVNFGNTCYCNSVLQALYFCRPFRENVLAYKAQQKKKENLLTCLADLFHSIATQKKKVGVIPPKKFISRLRKENDLFDNYMQQDAHEFLNYLLNTVADILQEEKKQEKQNGRLKNNGTPVTSEPEMENKIEPTWVHDIFQGTLTNETRCLNCETVSSKDEDFLDLSVDVEQNTSITHCLRDFSNTETLCSEYKYYCETCCSKQEAQKRMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSGDAVNLDRM--YDLVAVVVHCGSGPNRGHYITIV-KSHGFWLLFDDDIVEKID 339          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Medaka
Match: usp7 (ubiquitin specific peptidase 7 [Source:NCBI gene;Acc:101165311])

HSP 1 Score: 94.3597 bits (233), Expect = 4.541e-19
Identity = 99/387 (25.58%), Postives = 159/387 (41.09%), Query Frame = 1
Query:  313 AGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVE--DIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLE---QQDAPEFHSLFMNLVDQRF-SLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCN-GERQTVLQTLPPLLCFQFLRYSYDNSGTKK-KNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHT-SNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTELENQRQEKVKTQEHFIKESETIIE 1440
             GLKN G TCY NSLLQ  F   +L+ A++  P E  D    +   LQ +F ++Q S  K V   +L  +     L+   Q D  E   + ++ V+ +      +  I  L  G      +CK   Y S+    + +I L  K   +  ++  D++  E L  DNKYD     H     E+     T PP+L  Q +R+ YD    +  K      FP  L ++ ++    + D  N YI+ AVL+H G     GHY   ++   +  W  +DD  V +                   K + I +   G +        +NAYM+ Y RE            V++P  L   +Q         +E Q++ K + + H   + + ++E
Sbjct:  214 VGLKNQGATCYMNSLLQTLFFTNQLRRAVYMMPTEGDDSSKSVPLALQRVFYELQHS-DKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFKDYVATEQLDGDNKYDAG--EHGLQEAEKGVKFLTFPPILHLQLMRFMYDPQTDQNIKINDRFEFPDQLPLDEFLQKTDSKDPAN-YILHAVLVHSG-DNHGGHYVVYLNPKGDGKWCKFDDDVVSR-----------------CTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQPLTDVDIPPQLVERLQEEK-----RVEAQKR-KERQEAHLYMQVQIVME 572          
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Medaka
Match: usp7 (ubiquitin specific peptidase 7 [Source:NCBI gene;Acc:101165311])

HSP 1 Score: 91.2781 bits (225), Expect = 3.267e-18
Identity = 99/394 (25.13%), Postives = 158/394 (40.10%), Query Frame = 1
Query:  313 AGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVE--DIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLE---QQDAPEFHSLFMNLVDQRF-SLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDL--KPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCN-GERQTVLQTLPPLLCFQFLRYSYDNSGTKK-KNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQD--------WILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTELENQRQEKVKTQEHFIKESETIIE 1440
             GLKN G TCY NSLLQ  F   +L+ A++  P E  D    +   LQ +F ++Q S  K V   +L  +     L+   Q D  E   + ++ V+ +      +  I  L  G      +CK   Y S+    + +I L  K   +  ++  D++  E L  DNKYD     H     E+     T PP+L  Q +R+ YD    +  K      FP  L ++ ++    + D  N YI+ AVL+H G     GHY   ++             W  +DD  V +                   K + I +   G +        +NAYM+ Y RE            V++P  L   +Q         +E Q++ K + + H   + + ++E
Sbjct:  197 VGLKNQGATCYMNSLLQTLFFTNQLRRAVYMMPTEGDDSSKSVPLALQRVFYELQHS-DKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKHVDYRSERIEDYYDIQLSIKGKKNIFESFKDYVATEQLDGDNKYDAG--EHGLQEAEKGVKFLTFPPILHLQLMRFMYDPQTDQNIKINDRFEFPDQLPLDEFLQKTDSKDPAN-YILHAVLVHSG-DNHGGHYVVYLNPKGDGKVSAKEPIWCKFDDDVVSR-----------------CTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQPLTDVDIPPQLVERLQEEK-----RVEAQKR-KERQEAHLYMQVQIVME 562          
BLAST of Ubiquitin specific peptidase 48 vs. Planmine SMEST
Match: SMESG000031842.1 (SMESG000031842.1)

HSP 1 Score: 1201.81 bits (3108), Expect = 0.000e+0
Identity = 599/604 (99.17%), Postives = 600/604 (99.34%), Query Frame = 1
Query:  487 MVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNNN 2298
            MVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNG KVLTIS SDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCSSLLSEILKKSEIEKVNLSKIFNSKKRFE + N
Sbjct:    1 MVDPVELINALELPQLEQQDAPEFHSLFMNLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGHKVLTISISDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCSSLLSEILKKSEIEKVNLSKIFNSKKRFEIDPN 604          

HSP 2 Score: 190.66 bits (483), Expect = 1.550e-49
Identity = 115/217 (53.00%), Postives = 137/217 (63.13%), Query Frame = 1
Query: 2458 SEIFCQHGKFLSKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTKFENSVIYIRLISTKDDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDN 3108
            S++ C H           I+     L+ +  W+KI +Y+P +  E      + +   FP + + +  C++C  + S +  K E   + +  I              SKK++             EIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDN
Sbjct:  512 SDLLCPHENL-------SIDTSKRVLLGEELWNKILDYFPKVNSE----LEEKQYLEFPLIDNKLEGCSNCSSLLSEILKKSEIEKVNLSKIFN------------SKKRF-------------EIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDN 692          
BLAST of Ubiquitin specific peptidase 48 vs. Planmine SMEST
Match: SMESG000044971.1 (SMESG000044971.1)

HSP 1 Score: 1124 bits (2906), Expect = 0.000e+0
Identity = 571/572 (99.83%), Postives = 571/572 (99.83%), Query Frame = 1
Query: 1393 VKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCXXXXXXXXXXXXXXXVNLSKIFNSKKRFEYNNNEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFLSKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTKFENSVIYIRLISTKDDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDN 3108
            VKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCSSLLSEILKKSEIEKVNLSKIFNSKKRFEYNNNEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFLSKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFK WSTLQTKFENSVIYIRLISTKDDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDN
Sbjct:  557 VKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNCSSLLSEILKKSEIEKVNLSKIFNSKKRFEYNNNEKKLICLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSEIFCQHGKFLSKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFKSWSTLQTKFENSVIYIRLISTKDDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDN 1128          

HSP 2 Score: 309.301 bits (791), Expect = 1.489e-87
Identity = 145/157 (92.36%), Postives = 150/157 (95.54%), Query Frame = 1
Query:  541 QDAPEFHSLFMNLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKA 1011
            +DAPEFHSLFMNLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCNVGFPSYLSMENYV   ++  K +E II+A
Sbjct:  417 KDAPEFHSLFMNLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCNVGFPSYLSMENYVKTQEHFIKESETIIEA 573          
BLAST of Ubiquitin specific peptidase 48 vs. Planmine SMEST
Match: SMESG000031842.1 (SMESG000031842.1)

HSP 1 Score: 1120.92 bits (2898), Expect = 0.000e+0
Identity = 541/543 (99.63%), Postives = 541/543 (99.63%), Query Frame = 1
Query:  571 MNLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLTISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNC 2199
            MNLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNG KVLTIS SDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNC
Sbjct:    1 MNLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTELENQRQEKVKTQEHFIKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGHKVLTISISDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFFIPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVENQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCILNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFPLIDNKLEGCSNC 543          

HSP 2 Score: 418.698 bits (1075), Expect = 1.846e-129
Identity = 208/209 (99.52%), Postives = 208/209 (99.52%), Query Frame = 1
Query: 2482 KFLSKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFKIWSTLQTKFENSVIYIRLISTKDDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDN 3108
            KFLSKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFK WSTLQTKFENSVIYIRLISTKDDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDN
Sbjct:  558 KFLSKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISIKSDFKLSSFPTLVSSIIVCNSCFKSWSTLQTKFENSVIYIRLISTKDDHYDVNEDGPSKKKYKVNNQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDDTIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLILDTELIKIAEPSNDN 766          
BLAST of Ubiquitin specific peptidase 48 vs. Planmine SMEST
Match: SMESG000050890.1 (SMESG000050890.1)

HSP 1 Score: 101.293 bits (251), Expect = 2.444e-21
Identity = 101/371 (27.22%), Postives = 166/371 (44.74%), Query Frame = 1
Query:  313 AGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVE--DIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQLE---QQDAPEF-HSLFMNLVDQRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFREIDLKPMLSFD--QALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYD-NSGTKKKNCCNVGFPSYLSMENYVNDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQ-DWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYEREDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTELENQRQEKV 1395
             GLKN G TCY NSLLQ  F   +L++A++  P E  D    +   LQ +F ++Q    K V    L  +     L+   Q DA E    L  NL  +      ++ I +L  G      RC     ES+    F +I LK   + D  +A  +++ +E L  DNKYD      + + E+  +    PP+L  Q +R+ YD  +    K      FP  L +  Y+ +  N     +YI+  VL+H G     GHY   ++ S + +W  +D          DDV     +++ ++  S++  N ++   +Q      +NAYM+ Y  E   K      +  ++P++L    + TNE ++   + +R+EK 
Sbjct:  256 VGLKNQGATCYMNSLLQALFFTNKLRKAVYLLPTETDDEQRSVALALQRVFYELQYG-EKAVGTKRLTKSFGWETLDTFMQHDAQELCRVLLDNLESKMKGTRVEDTIPNLFCGKMVSFIRCVKVPVESKREEAFYDIQLKVKGNSDIYEAFDEYITIETLDGDNKYDAGEYGMQ-DAEKGIMFLKFPPVLYLQLMRFQYDYETDANIKINDRFEFPYSLDLSKYLENSHN--SKTKYILHTVLVHSG-DNHGGHYVAYLNPSGENEWYKFD----------DDVVSRCSRREAIL--SNYGGNDEDMSIKQ-----CTNAYMLVYMSEGDIKELLQPISRDDIPTNLHQ--RFTNEKHIE--DQKRKEKA 600          
BLAST of Ubiquitin specific peptidase 48 vs. Planmine SMEST
Match: SMESG000031961.1 (SMESG000031961.1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.259e-20
Identity = 95/396 (23.99%), Postives = 176/396 (44.44%), Query Frame = 1
Query:  289 LNSDTNFAAGLKNYGNTCYFNSLLQVYFNIVELKEAIFRFPVEDIPDEIITYLQTIFAQMQLSVHKMVDPVELINALELPQL-----EQQDAPEFHSLFMNLVD--QRFSLIDDNVIKSLISGTFRYLTRCKGCGYESQMNCQFR--EIDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHKCNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCN-VGFPSYLSMENYVNDGKNDDKTN-------EYIIKAVLIHIGLQPTSGHYQTLI--------------HTSNQDWILYDDLNVQKLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQ----NIHFVSSNAYMVFYEREDVFKNHT-TINNSVEVPSHLKGNIQMTNESYLTE 1368
            L  +T F  G+ N G TCY  + LQ  F I E ++ I       +  +    LQ+IF+ +Q S    ++P    +  E+ +      EQ+D  EF   F +L+   +  SLI  N IK+L  G          C ++S++  +F    +++  M S  Q+   F++ ++L  +NKY CS C      E++T L  LP +LC   +RY +D +  +++   N   FP  L +E ++       +         +Y +  + +H G    SGHY + I              ++++  W  ++D  ++  +  +   +  G             NK+N +  Q       + ++NAYM+FYER  +  N   + +  + +P ++   I++ N+ +L +
Sbjct: 1925 LREETGFC-GIINLGATCYLATTLQHLFMIPECRKLILECTESGL--KWFNKLQSIFSFLQFSERSGLNPKAFCDVYEMNKQVINTGEQKDMSEF---FGDLIGKLETVSLILKNGIKNLFGGESSSYIVSLDCPHQSRIPEEFYFLSLNVNNMTSLQQSFAHFVEKDILDGNNKYRCSDCDSLVRAEKRTCLTKLPTILCLNIMRYYFDVNTLRREKLNNFFEFPMQLDVEPFMKHSLMAGEPEIGVAGNCKYRLIGITVHSG-TSESGHYYSFIKDRSDGKTLYWNDQNSASDKWFCFNDSKIKCFDPTNIPSECFGGLN---------VNKRNIETSQLFLGTSEYKTNNAYMLFYERVSIGDNRKESKSMEILIPQNIYSAIEIENQKFLRD 2304          
The following BLAST results are available for this feature:
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
USP484.734e-9526.76ubiquitin specific peptidase 48 [Source:HGNC Symbo... [more]
USP483.538e-9126.20ubiquitin specific peptidase 48 [Source:HGNC Symbo... [more]
USP487.127e-8526.49ubiquitin specific peptidase 48 [Source:HGNC Symbo... [more]
USP486.799e-5130.27ubiquitin specific peptidase 48 [Source:HGNC Symbo... [more]
USP481.243e-2723.55ubiquitin specific peptidase 48 [Source:HGNC Symbo... [more]
back to top
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp-486.904e-2426.10Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
math-333.338e-2024.86Ubiquitin carboxyl-terminal hydrolase 7 [Source:U... [more]
math-333.450e-2024.86Ubiquitin carboxyl-terminal hydrolase 7 [Source:U... [more]
math-333.481e-2024.86Ubiquitin carboxyl-terminal hydrolase 7 [Source:U... [more]
math-333.629e-2025.07Ubiquitin carboxyl-terminal hydrolase 7 [Source:U... [more]
back to top
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp71.593e-1925.68gene:FBgn0030366 transcript:FBtr0073641[more]
Usp71.791e-1925.68gene:FBgn0030366 transcript:FBtr0342732[more]
puf4.557e-1824.55gene:FBgn0039214 transcript:FBtr0084667[more]
puf6.183e-1824.55gene:FBgn0039214 transcript:FBtr0330309[more]
puf1.344e-1724.60gene:FBgn0039214 transcript:FBtr0306172[more]
back to top
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp481.005e-10126.86ubiquitin specific peptidase 48 [Source:ZFIN;Acc:Z... [more]
usp485.243e-10126.86ubiquitin specific peptidase 48 [Source:ZFIN;Acc:Z... [more]
usp485.746e-6531.27ubiquitin specific peptidase 48 [Source:ZFIN;Acc:Z... [more]
usp471.016e-2024.04ubiquitin specific peptidase 47 [Source:ZFIN;Acc:Z... [more]
usp464.884e-2026.95ubiquitin specific peptidase 46 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptp4a21.337e-9526.30protein tyrosine phosphatase type IVA, member 2 [S... [more]
ptp4a21.086e-9426.58protein tyrosine phosphatase type IVA, member 2 [S... [more]
ptp4a21.690e-9427.14protein tyrosine phosphatase type IVA, member 2 [S... [more]
ptp4a23.467e-9426.58protein tyrosine phosphatase type IVA, member 2 [S... [more]
ptp4a26.131e-9426.28protein tyrosine phosphatase type IVA, member 2 [S... [more]
back to top
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Usp482.837e-9426.71ubiquitin specific peptidase 48 [Source:MGI Symbol... [more]
Usp481.647e-9125.96ubiquitin specific peptidase 48 [Source:MGI Symbol... [more]
Usp481.819e-6228.55ubiquitin specific peptidase 48 [Source:MGI Symbol... [more]
Usp476.469e-2123.08ubiquitin specific peptidase 47 [Source:MGI Symbol... [more]
Usp477.812e-2123.08ubiquitin specific peptidase 47 [Source:MGI Symbol... [more]
back to top
BLAST of Ubiquitin specific peptidase 48 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q76LT8|UBP48_RAT1.632e-9426.93Ubiquitin carboxyl-terminal hydrolase 48 OS=Rattus... [more]
sp|Q86UV5|UBP48_HUMAN2.273e-9426.76Ubiquitin carboxyl-terminal hydrolase 48 OS=Homo s... [more]
sp|Q5ZM45|UBP48_CHICK4.032e-9426.85Ubiquitin carboxyl-terminal hydrolase 48 OS=Gallus... [more]
sp|Q3V0C5|UBP48_MOUSE1.152e-9025.96Ubiquitin carboxyl-terminal hydrolase 48 OS=Mus mu... [more]
sp|A3AF13|UBP26_ORYSJ8.820e-3829.16Ubiquitin carboxyl-terminal hydrolase 26 OS=Oryza ... [more]
back to top
BLAST of Ubiquitin specific peptidase 48 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2I4D0U34.236e-9926.77ubiquitin carboxyl-terminal hydrolase 48 isoform X... [more]
A0A1A7X5292.163e-9827.26Ubiquitin specific peptidase 48 OS=Iconisemion str... [more]
A0A0R4IB932.248e-9826.86Ubiquitin-specific peptidase 48 OS=Danio rerio OX=... [more]
I3JQ004.237e-9826.42Ubiquitin specific peptidase 48 OS=Oreochromis nil... [more]
E7EY581.173e-9726.86Ubiquitin-specific peptidase 48 OS=Danio rerio OX=... [more]
back to top
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp483.966e-9125.44ubiquitin specific peptidase 48 [Source:NCBI gene;... [more]
usp489.863e-9026.03ubiquitin specific peptidase 48 [Source:NCBI gene;... [more]
usp476.354e-2123.81ubiquitin specific peptidase 47 [Source:NCBI gene;... [more]
usp477.674e-2123.81ubiquitin specific peptidase 47 [Source:NCBI gene;... [more]
usp476.989e-2023.58ubiquitin specific peptidase 47 [Source:NCBI gene;... [more]
back to top
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001446.19.439e-2025.00pep scaffold:Pmarinus_7.0:GL476913:23272:104531:1 ... [more]
usp71.501e-1825.71ubiquitin specific peptidase 7 (herpes virus-assoc... [more]
ENSPMAT00000005124.13.347e-1728.51pep scaffold:Pmarinus_7.0:GL490092:2610:6304:1 gen... [more]
usp12a4.017e-1725.72ubiquitin specific peptidase 12a [Source:NCBI gene... [more]
ENSPMAT00000008243.18.612e-1525.47pep scaffold:Pmarinus_7.0:GL481682:14201:19993:-1 ... [more]
back to top
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
UBP151.700e-1824.86Ubiquitin-specific protease involved in protein de... [more]
UBP95.386e-1225.44Ubiquitin-specific protease that cleaves ubiquitin... [more]
UBP81.956e-1024.31Ubiquitin-specific protease component of the SAGA ... [more]
UBP135.283e-922.73Ubiquitin-specific protease that cleaves Ub-protei... [more]
back to top
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO347451.547e-1726.10Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO350564.133e-1423.65Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO443196.618e-1431.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444772.423e-1327.60Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
EDO367568.392e-1323.08Ubiquitin carboxyl-terminal hydrolase [Source:Uni... [more]
back to top
BLAST of Ubiquitin specific peptidase 48 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp481.356e-9626.00ubiquitin specific peptidase 48 [Source:NCBI gene;... [more]
usp487.796e-8625.95ubiquitin specific peptidase 48 [Source:NCBI gene;... [more]
usp463.454e-1927.04ubiquitin specific peptidase 46 [Source:NCBI gene;... [more]
usp74.541e-1925.58ubiquitin specific peptidase 7 [Source:NCBI gene;A... [more]
usp73.267e-1825.13ubiquitin specific peptidase 7 [Source:NCBI gene;A... [more]
back to top
BLAST of Ubiquitin specific peptidase 48 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031842.11.550e-4999.17SMESG000031842.1[more]
SMESG000044971.11.489e-8799.83SMESG000044971.1[more]
SMESG000031842.11.846e-12999.63SMESG000031842.1[more]
SMESG000050890.12.444e-2127.22SMESG000050890.1[more]
SMESG000031961.12.259e-2023.99SMESG000031961.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016846 ID=SMED30016846|Name=Ubiquitin specific peptidase 48|organism=Schmidtea mediterranea sexual|type=transcript|length=3270bp
GATTAATTAAAATAATTTTTTAAATTGTTTTGTTTAAATAATACCTAAAT
TCAAATTTAAAATATGAAACCCAAACGGAAATCTAAATGGAATTTCGATA
ATATAAATTGGGAAGAATTTATGTCACATCAGTTTTTGTCTATTTATAAT
TTAGACAAGAAACCTTGTCAAATAAATAGTTGCAAAAAAAATTGTAGTGA
CAATCTATACTGTATCAATAAATTAGGTGAAACGAAATGGTTAAACAATA
AATCTTTAAGCAGAAATGACAAGGAAGATAATGGGATTTTGAATTCAGAC
ACAAATTTTGCAGCTGGATTAAAAAATTACGGAAATACCTGTTATTTTAA
TTCATTGCTACAAGTTTATTTTAATATTGTTGAACTGAAAGAAGCTATAT
TTAGATTTCCTGTTGAAGATATTCCTGACGAAATCATTACGTATTTACAA
ACAATATTTGCACAAATGCAATTATCAGTTCACAAAATGGTCGATCCTGT
TGAATTAATTAATGCTTTAGAGTTACCACAGTTGGAACAACAGGATGCTC
CGGAATTTCATAGTTTATTTATGAATTTGGTAGATCAGCGGTTTTCTTTA
ATCGATGATAATGTTATTAAGAGCCTTATCAGTGGAACATTCAGATATTT
AACGAGATGCAAAGGTTGTGGTTATGAGTCCCAAATGAACTGTCAATTTA
GAGAAATAGATCTGAAACCAATGCTGTCTTTTGATCAAGCTCTTTTAGAT
TTTTTGAAGGTAGAGCTTCTTACTGACGACAACAAATATGATTGTTCTTG
TTGTATGCATAAGTGCAATGGTGAGCGTCAAACGGTTTTACAAACCTTGC
CACCGTTGTTATGCTTTCAGTTCCTGCGATATTCATATGATAATTCCGGA
ACGAAAAAGAAAAACTGTTGCAATGTTGGATTTCCTTCGTATTTATCAAT
GGAAAATTATGTAAATGATGGGAAAAATGATGACAAAACAAATGAATACA
TTATAAAAGCGGTTTTAATCCACATTGGCCTTCAACCAACAAGTGGACAT
TATCAAACTCTTATTCATACCTCTAATCAAGATTGGATACTTTATGATGA
TCTCAACGTTCAAAAATTAGAGAATATTGACGATGTAAAAAAAATTCTCG
GACAAAAAAAAACTGTTGTAAATAAGTCTGACTTTATTACCAATAAAAAG
AACGGTAAAGAACAACAAAACATCCATTTTGTTTCATCTAATGCATATAT
GGTGTTTTATGAAAGGGAAGATGTTTTCAAAAATCATACAACAATTAATA
ATTCTGTGGAAGTCCCTTCACACCTTAAAGGGAATATTCAAATGACAAAT
GAATCATATCTGACAGAACTAGAAAATCAGCGCCAAGAAAAAGTGAAAAC
TCAGGAGCATTTTATCAAAGAGTCAGAAACTATAATTGAGGCCTTTCAGA
AATTGTTTTTCAAAGGATCTACTGAAAATTTATTATCATTAGCTAATGAA
TTGGAATTTCTACCAATGAGTTGGTTAACAAAATGGCTGACCAATGGTCG
CAAAGTGCTAACTATTTCAAATTCCGATGGAAATCAATCTGATGATCTCG
ATGAATGGAAAACATTAATATGTCGACATGAAATGTTGGGGCCCGATATT
CCGATTAATCAATTGAAAATTGTCAATTCTGTCGGTGTCGATTTCTTAAT
TGAAAACTTCTTCATTCCCGTTACGTACAAGCGAAAACGTCTATCAAGTT
TCTGTAATAAATGTTGGCGTTTGAAATTTGAAATAAAGAAATTTGAAAAT
ATTAGTAGAAATGATTTTACTATTGACAATTTCGTGAGAAAACCTCTTCT
GGAAAATGTAGAAAATCAGAAATGCTATTGGGTGAGTAAATCCCATTTAC
GACAATGGAGGAAAGTAATAAGACTTGCTATTGAAAACAAGTTCAATGAC
TCAACTGACATTCAAGATGAAACTAACAGCAGCAATGGCAGTTTCAAAGA
TTTACCGTGCATTCTTAATTCTGATTTGTTGTGTCCCCATGAAAATCTTT
CAATAGATACATCTAAGAGAGTTTTATTGGGAGAAGAATTATGGAATAAA
ATTCTTGATTATTTCCCTAAAGTTAATAGTGAATTAGAAGAGAAACAGTA
TTTGGAGTTTCCACTTATTGATAACAAACTTGAAGGTTGTTCTAACTGTT
CATCTTTATTGTCAGAAATTTTAAAAAAATCCGAGATTGAGAAAGTTAAT
TTATCTAAAATATTCAACTCAAAGAAACGTTTTGAGTATAATAATAATGA
GAAAAAATTGATTTGTCTATCACCTTCCACGCAGGTAGATAATGAATTAA
TTACCGAGGAAGTTTTTTTATATTTCATTCCATCATCTTTTATAGCAATG
TGGAAACGGTTTATTAAAAACCCATCAGTTGACACACTAGTCACAGAAAT
TGATTATTCTGAAATATTTTGTCAGCATGGAAAGTTTCTCTCTAAAGATT
GGTATCATTTCATTGAAGATGAATCTATATTTCTTGTTTGGCAATCAGAA
TGGGATAAAATCACTAATTATTATCCAGATATCGAATTTGAAAACATTTC
AATTAAGTCTGACTTCAAATTGTCTTCATTTCCCACCTTAGTGTCTTCGA
TAATTGTTTGCAATTCATGTTTTAAGATTTGGAGTACCCTTCAAACCAAA
TTTGAAAATAGCGTTATTTATATTCGCCTGATTTCAACTAAAGATGACCA
TTATGATGTTAATGAAGACGGTCCTTCAAAAAAGAAATATAAAGTGAATA
ATCAAATTAATACAAGCGTGAATTTTAAAGAAATCGATCCAAATACTGTT
CGGCGTTCCGCTAGATCTAAAAGACATCGCAATGATATTATACTGAAAAT
CAATTCAGATGATACGATCAAAGATATAAAATTGCAATTAATGAATATAT
ATAGTGTCAGTCCCATGGATCAGCATTTGATATTTAATGAATTGGAACTG
GTTGATTCAAATTTAACTATTTCCAATGTTGGTATAAAGCCAGCAAGCAT
TTTATATTTAATTCTCGACACAGAATTAATCAAAATTGCAGAGCCTTCTA
ATGATAACTTAGAAATAGGATTCAGTGGTACAAAGTTAATGCAATCTCTT
CGGTAAAACTTTCTACGTATTTAATTGTATAAACTTGTAAATAAAGAATC
TTGTCTTATTGTGTATTTAAATTATAAAAATTGATTTTCCACTCATTATT
TTATTGACTTTTACATACTG
back to top

protein sequence of SMED30016846-orf-1

>SMED30016846-orf-1 ID=SMED30016846-orf-1|Name=SMED30016846-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1031bp
MKPKRKSKWNFDNINWEEFMSHQFLSIYNLDKKPCQINSCKKNCSDNLYC
INKLGETKWLNNKSLSRNDKEDNGILNSDTNFAAGLKNYGNTCYFNSLLQ
VYFNIVELKEAIFRFPVEDIPDEIITYLQTIFAQMQLSVHKMVDPVELIN
ALELPQLEQQDAPEFHSLFMNLVDQRFSLIDDNVIKSLISGTFRYLTRCK
GCGYESQMNCQFREIDLKPMLSFDQALLDFLKVELLTDDNKYDCSCCMHK
CNGERQTVLQTLPPLLCFQFLRYSYDNSGTKKKNCCNVGFPSYLSMENYV
NDGKNDDKTNEYIIKAVLIHIGLQPTSGHYQTLIHTSNQDWILYDDLNVQ
KLENIDDVKKILGQKKTVVNKSDFITNKKNGKEQQNIHFVSSNAYMVFYE
REDVFKNHTTINNSVEVPSHLKGNIQMTNESYLTELENQRQEKVKTQEHF
IKESETIIEAFQKLFFKGSTENLLSLANELEFLPMSWLTKWLTNGRKVLT
ISNSDGNQSDDLDEWKTLICRHEMLGPDIPINQLKIVNSVGVDFLIENFF
IPVTYKRKRLSSFCNKCWRLKFEIKKFENISRNDFTIDNFVRKPLLENVE
NQKCYWVSKSHLRQWRKVIRLAIENKFNDSTDIQDETNSSNGSFKDLPCI
LNSDLLCPHENLSIDTSKRVLLGEELWNKILDYFPKVNSELEEKQYLEFP
LIDNKLEGCSNCSSLLSEILKKSEIEKVNLSKIFNSKKRFEYNNNEKKLI
CLSPSTQVDNELITEEVFLYFIPSSFIAMWKRFIKNPSVDTLVTEIDYSE
IFCQHGKFLSKDWYHFIEDESIFLVWQSEWDKITNYYPDIEFENISIKSD
FKLSSFPTLVSSIIVCNSCFKIWSTLQTKFENSVIYIRLISTKDDHYDVN
EDGPSKKKYKVNNQINTSVNFKEIDPNTVRRSARSKRHRNDIILKINSDD
TIKDIKLQLMNIYSVSPMDQHLIFNELELVDSNLTISNVGIKPASILYLI
LDTELIKIAEPSNDNLEIGFSGTKLMQSLR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0002109X1 cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR035927DUSP-like_sf
IPR000626Ubiquitin-like_dom
IPR006615Pept_C19_DUSP
IPR001394Peptidase_C19_UCH
IPR018200USP_CS
IPR028889USP_dom
IPR029071Ubiquitin-like_domsf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004843thiol-dependent ubiquitin-specific protease activity
GO:0036459thiol-dependent ubiquitinyl hydrolase activity
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0016579protein deubiquitination
GO:0006511ubiquitin-dependent protein catabolic process
GO:0006508proteolysis
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005739mitochondrion
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 34..54
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 540..607
e-value: 2.9E-8
score: 35.5
NoneNo IPR availableCDDcd01795Ubl_USP48coord: 549..630
e-value: 1.84511E-18
score: 78.8662
IPR000626Ubiquitin-like domainSMARTSM00213ubq_7coord: 536..607
e-value: 8.7E-4
score: 28.6
IPR000626Ubiquitin-like domainPFAMPF00240ubiquitincoord: 545..607
e-value: 5.8E-7
score: 29.2
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 534..606
score: 11.377
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 545..606
IPR035927DUSP-like superfamilySUPERFAMILYSSF143791DUSP-likecoord: 201..290
IPR035927DUSP-like superfamilySUPERFAMILYSSF143791DUSP-likecoord: 373..443