SH3 domain-binding protein 5-like

Overview
NameSH3 domain-binding protein 5-like
Smed IDSMED30016832
Length (bp)1274
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SH3 domain-binding protein 5-like (SMED30016832) t-SNE clustered cells

Violin plots show distribution of expression levels for SH3 domain-binding protein 5-like (SMED30016832) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SH3 domain-binding protein 5-like (SMED30016832) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SH3 domain-binding protein 5-like (SMED30016832) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016832

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30016832SMESG000061052.1 Contig4742newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30016832SMESG000061052.1 Contig4742newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30016832SMESG000061052.1 Contig4742newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30016832SMESG000061052.1 Contig4742uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30016832SMESG000061052.1 Contig4742uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30016832SMESG000061052.1 Contig4742uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30016832SMESG000022856.1 Contig4742newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30016832SMESG000022856.1 Contig4742newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30016832SMESG000022856.1 Contig4742newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30016832SMESG000022856.1 Contig4742uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30016832SMESG000022856.1 Contig4742uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30016832SMESG000022856.1 Contig4742uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X2 cellSMED30016832SMESG000061052.1 SmedASXL_013482SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Human
Match: SH3BP5L (SH3 binding domain protein 5 like [Source:HGNC Symbol;Acc:HGNC:29360])

HSP 1 Score: 114.005 bits (284), Expect = 2.483e-27
Identity = 82/242 (33.88%), Postives = 125/242 (51.65%), Query Frame = 3
Query:  138 DLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYE-AACVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERN---HLLGP-RGEGVGSE 848
            +L+P +Q ELE LN AS +IN++E +L E R +Y   L +    L   G+ +G+  I K RPY   +R   E Q+E+Q AA RYE A  +  +  + V    + +  +  +LD +  E+LN A  KVN ++ ++     EHQ      +  E R++ L+K  +  I K++PYF       + L+E K  +   E +V   K  Y+ +L+ LE IS  IH  R      H LGP R   VG+E
Sbjct:   55 ELDPRIQEELEHLNQASEEINQVELQLDEARTTYRRILQESARKLNTQGSHLGS-CIEKARPYYEARRLAKEAQQETQKAALRYERAVSMHNAAREMVFVAEQGVMADKNRLDPTWQEMLNHATCKVNEAEEERLRGEREHQRVTRLCQQAEARVQALQKTLRRAIGKSRPYFELKAQFSQILEEHKAKVTELEQQVAQAKTRYSVALRNLEQISEQIHARRRGGLPPHPLGPRRSSPVGAE 295          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Human
Match: SH3BP5 (SH3 domain binding protein 5 [Source:HGNC Symbol;Acc:HGNC:10827])

HSP 1 Score: 113.235 bits (282), Expect = 9.160e-27
Identity = 82/255 (32.16%), Postives = 132/255 (51.76%), Query Frame = 3
Query:  141 LNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEA--LAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSELVSVAHCNTGDNKEQSD 899
            ++P +Q ELEKLN ++  IN  E +L++ R  +   L + T  L EL  KIG   +   +PY   +R   + Q E+Q A   ++ A   L  +   +S  E   L  +  + D +  E+LN A  +V  ++  K  +   H+    +Y     R+RQLEKK K  I K+KPYF        +L++ K  +D  + K+ + K  Y  +L+ LE IS++IH +R R+  +GPRG GVG+E  S +  +   +K + D
Sbjct:   41 VDPRIQGELEKLNQSTDDINRRETELEDARQKFRSVLVEATVKLDELVKKIGK-AVEDSKPYWEARRVARQAQLEAQKATQDFQRATEVLRAAKETISLAEQRLLEDDKRQFDSAWQEMLNHATQRVMEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKPYFELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIH-ERRRSSAMGPRGCGVGAEGSSTSVEDLPGSKPEPD 293          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Human
Match: SH3BP5 (SH3 domain binding protein 5 [Source:HGNC Symbol;Acc:HGNC:10827])

HSP 1 Score: 69.707 bits (169), Expect = 7.496e-14
Identity = 44/120 (36.67%), Postives = 68/120 (56.67%), Query Frame = 3
Query:  489 ILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSE 848
            +LN A  +V  ++  K  +   H+    +Y     R+RQLEKK K  I K+KPYF        +L++ K  +D  + K+ + K  Y  +L+ LE IS++IH +R R+  +GPRG GVG+E
Sbjct:    1 MLNHATQRVMEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKPYFELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIH-ERRRSSAMGPRGCGVGAE 119          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Human
Match: SH3BP5 (SH3 domain binding protein 5 [Source:HGNC Symbol;Acc:HGNC:10827])

HSP 1 Score: 70.4774 bits (171), Expect = 7.397e-13
Identity = 47/137 (34.31%), Postives = 75/137 (54.74%), Query Frame = 3
Query:  489 ILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSELVSVAHCNTGDNKEQSD 899
            +LN A  +V  ++  K  +   H+    +Y     R+RQLEKK K  I K+KPYF        +L++ K  +D  + K+ + K  Y  +L+ LE IS++IH +R R+  +GPRG GVG+E  S +  +   +K + D
Sbjct:    1 MLNHATQRVMEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKPYFELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIH-ERRRSSAMGPRGCGVGAEGSSTSVEDLPGSKPEPD 136          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Human
Match: SH3BP5 (SH3 domain binding protein 5 [Source:HGNC Symbol;Acc:HGNC:10827])

HSP 1 Score: 70.4774 bits (171), Expect = 7.397e-13
Identity = 47/137 (34.31%), Postives = 75/137 (54.74%), Query Frame = 3
Query:  489 ILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSELVSVAHCNTGDNKEQSD 899
            +LN A  +V  ++  K  +   H+    +Y     R+RQLEKK K  I K+KPYF        +L++ K  +D  + K+ + K  Y  +L+ LE IS++IH +R R+  +GPRG GVG+E  S +  +   +K + D
Sbjct:    1 MLNHATQRVMEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKPYFELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIH-ERRRSSAMGPRGCGVGAEGSSTSVEDLPGSKPEPD 136          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Celegans
Match: rei-2 (Guanine nucleotide exchange factor rei-2 [Source:UniProtKB/Swiss-Prot;Acc:Q21194])

HSP 1 Score: 81.2629 bits (199), Expect = 1.710e-16
Identity = 70/219 (31.96%), Postives = 114/219 (52.05%), Query Frame = 3
Query:  162 ELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVS-KNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHL 815
            ELEKLN ++  IN++E +L   R  + ET  + +  L EL  +  +  I K RP+  LK ++  +++ESQ AA R+E A   L  +   VS   E+L++++  L +  +E+LN  I +V   + ++  A + H    +    + E+IR +EK ++  I K++ YF       + L+  K  I   E +VR  K  Y  SL+ LE IS  IH +R    L
Sbjct:   42 ELEKLNISTDVINKMEVQLDLARADFRETQVQWSEKLKELSKQYSSQ-IAKARPFYELKIKERSLREESQKAAERFERATSILGIAKQQVSLTQESLSRQTSVLPE-CLEVLNHHIQRVREVEEERTAAESLHASKAHAMLHLAEKIRAMEKDNRYAIKKSRLYFEKRLEFTKILEAQKATILCLEAEVRQKKNDYTTSLRNLERISERIHEERSTGSL 258          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Fly
Match: pcs (gene:FBgn0033988 transcript:FBtr0301507)

HSP 1 Score: 124.02 bits (310), Expect = 8.158e-31
Identity = 85/255 (33.33%), Postives = 140/255 (54.90%), Query Frame = 3
Query:  117 YNNINDGDLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEALAKE-------SPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDR-ERNHLLGPRGEGVGSELVS 857
             ++  DG+L+P++Q+ELE LN+A+ +IN+LE +L+E  +++   L++ T  L     K+GN  I K RPY     +  E Q E Q AA +++ A    +   A   +  ALA++         + D++  E+LN A  KV  ++ +K + H EHQ     +   E++++QLE + +  I K++PYF   +   ++L+  K  I   + +V   K  Y+ +L+ LE IS DIHR R +     GPR  GVG+EL S
Sbjct:    1 MSSAEDGELDPQIQIELENLNSATDEINKLEIELEEANSTFRILLNESTRRLKVSSKKLGN-CIEKARPYYEALDKAREAQIECQKAAVKFQRA----NEIHAAAKETVALAEQRFMSNSHEWQFDNAWQEMLNHATQKVMDAETQKADCHAEHQRLTKLFNAAEQKLQQLEDRFRRSINKSRPYFEEKQVCQDQLQTQKNRIQELQQQVAGAKSTYSTALRNLERISEDIHRQRGDFPTPPGPREPGVGAELNS 250          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Fly
Match: CG14408 (gene:FBgn0030581 transcript:FBtr0073990)

HSP 1 Score: 107.071 bits (266), Expect = 1.298e-24
Identity = 75/228 (32.89%), Postives = 124/228 (54.39%), Query Frame = 3
Query:  141 LNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAA-CVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDR-ERNHLL 818
            ++P VQ+ELEKLN+A+  IN  E +L E +  +   L++    +    +K+GN+ I   +PY   +    ++ KE+Q+AA  +E A  +  +  + V    + L ++S  LD +  E+L+ A SKVN S+L+  +  N  +    K      R+ +L+ + K  +  ++PY+      +  LK  K  ++  E KV   KL YNE+L+ LE IS DIHR R +RN+LL
Sbjct:    9 VDPRVQVELEKLNSATDNINRYEVELDEAKCEFKRLLAESVVRIKAAAHKLGNS-IDAAKPYYESRIYAAQLAKETQLAAANHEKAKSIHAAAKEMVYLAEQGLGEKST-LDTACQEMLSHAASKVNQSQLEVTDTRNALKMCQLKLEVANNRVGKLQGQLKQALRASRPYYETRANYNGLLKAQKTRVNELEAKVSAAKLTYNEALKNLEQISEDIHRQRQQRNNLL 234          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Fly
Match: CG14408 (gene:FBgn0030581 transcript:FBtr0339447)

HSP 1 Score: 93.9745 bits (232), Expect = 2.266e-20
Identity = 76/253 (30.04%), Postives = 123/253 (48.62%), Query Frame = 3
Query:  141 LNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAA-CVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDI-------------------------TKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDR-ERNHLL 818
            ++P VQ+ELEKLN+A+  IN  E +L E +  +   L++    +    +K+GN+ I   +PY   +    ++ KE+Q+AA  +E A  +  +  + V    + L ++S  LD +  E+L+ A SKVN S+L+  +  N  +    K      R+ +L+ + K  +                         T   PY+      +  LK  K  ++  E KV   KL YNE+L+ LE IS DIHR R +RN+LL
Sbjct:    9 VDPRVQVELEKLNSATDNINRYEVELDEAKCEFKRLLAESVVRIKAAAHKLGNS-IDAAKPYYESRIYAAQLAKETQLAAANHEKAKSIHAAAKEMVYLAEQGLGEKST-LDTACQEMLSHAASKVNQSQLEVTDTRNALKMCQLKLEVANNRVGKLQGQLKQALRASRLQLKRNLLLLRYFSIMHALYCTLCSPYYETRANYNGLLKAQKTRVNELEAKVSAAKLTYNEALKNLEQISEDIHRQRQQRNNLL 259          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Fly
Match: CG14408 (gene:FBgn0030581 transcript:FBtr0340466)

HSP 1 Score: 93.5893 bits (231), Expect = 3.795e-20
Identity = 76/253 (30.04%), Postives = 123/253 (48.62%), Query Frame = 3
Query:  141 LNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAA-CVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDI-------------------------TKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDR-ERNHLL 818
            ++P VQ+ELEKLN+A+  IN  E +L E +  +   L++    +    +K+GN+ I   +PY   +    ++ KE+Q+AA  +E A  +  +  + V    + L ++S  LD +  E+L+ A SKVN S+L+  +  N  +    K      R+ +L+ + K  +                         T   PY+      +  LK  K  ++  E KV   KL YNE+L+ LE IS DIHR R +RN+LL
Sbjct:    9 VDPRVQVELEKLNSATDNINRYEVELDEAKCEFKRLLAESVVRIKAAAHKLGNS-IDAAKPYYESRIYAAQLAKETQLAAANHEKAKSIHAAAKEMVYLAEQGLGEKST-LDTACQEMLSHAASKVNQSQLEVTDTRNALKMCQLKLEVANNRVGKLQGQLKQALRASRLQLKRNLLLLRYFSIMHALYCTLCSPYYETRANYNGLLKAQKTRVNELEAKVSAAKLTYNEALKNLEQISEDIHRQRQQRNNLL 259          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Fly
Match: CG14408 (gene:FBgn0030581 transcript:FBtr0305580)

HSP 1 Score: 93.5893 bits (231), Expect = 3.795e-20
Identity = 76/253 (30.04%), Postives = 123/253 (48.62%), Query Frame = 3
Query:  141 LNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAA-CVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDI-------------------------TKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDR-ERNHLL 818
            ++P VQ+ELEKLN+A+  IN  E +L E +  +   L++    +    +K+GN+ I   +PY   +    ++ KE+Q+AA  +E A  +  +  + V    + L ++S  LD +  E+L+ A SKVN S+L+  +  N  +    K      R+ +L+ + K  +                         T   PY+      +  LK  K  ++  E KV   KL YNE+L+ LE IS DIHR R +RN+LL
Sbjct:    9 VDPRVQVELEKLNSATDNINRYEVELDEAKCEFKRLLAESVVRIKAAAHKLGNS-IDAAKPYYESRIYAAQLAKETQLAAANHEKAKSIHAAAKEMVYLAEQGLGEKST-LDTACQEMLSHAASKVNQSQLEVTDTRNALKMCQLKLEVANNRVGKLQGQLKQALRASRLQLKRNLLLLRYFSIMHALYCTLCSPYYETRANYNGLLKAQKTRVNELEAKVSAAKLTYNEALKNLEQISEDIHRQRQQRNNLL 259          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Zebrafish
Match: sh3bp5la (SH3-binding domain protein 5-like, a [Source:ZFIN;Acc:ZDB-GENE-040426-2187])

HSP 1 Score: 115.931 bits (289), Expect = 4.724e-28
Identity = 82/261 (31.42%), Postives = 140/261 (53.64%), Query Frame = 3
Query:  117 YNNINDGDLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLL-GP------RGEGVGSELVSVAHCNTG 878
            +  + + +L+P ++ ELE LN  S +IN++E +LQE+R+S+   +S+    L    +++G+  I K RPY   +R+  E Q+E+Q AA  +E A    S +  +V   E        LD +  E+LN A +KVN ++ ++ ++ +EH       ++ E R+++L+K  K  I K+K YF      ++ L+E K  I   ED++   K+ Y+ +L+ LE IS +IH  R ++  + GP      R   VG+E VS      G
Sbjct:   61 HGKLTEEELDPRIKEELECLNETSEEINKMELELQEVRSSHRRIMSESVLKLKAKSSELGS-CIEKARPYYEARRKAKEAQQETQKAALSFERAVSMHSAAREMVHVAEQGLTVVKTLDPTWQEMLNHATAKVNEAEEERLKSEHEHMRVTQLCQEAEARVQELQKSLKRAIVKSKSYFELKAQFNDILEEHKARILQLEDRISKAKVNYSSTLRNLEQISEEIHAQRGQDQTMNGPISTCSGRSPPVGAETVSSTGTEGG 320          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Zebrafish
Match: sh3bp5la (SH3-binding domain protein 5-like, a [Source:ZFIN;Acc:ZDB-GENE-040426-2187])

HSP 1 Score: 115.931 bits (289), Expect = 4.724e-28
Identity = 82/261 (31.42%), Postives = 140/261 (53.64%), Query Frame = 3
Query:  117 YNNINDGDLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLL-GP------RGEGVGSELVSVAHCNTG 878
            +  + + +L+P ++ ELE LN  S +IN++E +LQE+R+S+   +S+    L    +++G+  I K RPY   +R+  E Q+E+Q AA  +E A    S +  +V   E        LD +  E+LN A +KVN ++ ++ ++ +EH       ++ E R+++L+K  K  I K+K YF      ++ L+E K  I   ED++   K+ Y+ +L+ LE IS +IH  R ++  + GP      R   VG+E VS      G
Sbjct:   61 HGKLTEEELDPRIKEELECLNETSEEINKMELELQEVRSSHRRIMSESVLKLKAKSSELGS-CIEKARPYYEARRKAKEAQQETQKAALSFERAVSMHSAAREMVHVAEQGLTVVKTLDPTWQEMLNHATAKVNEAEEERLKSEHEHMRVTQLCQEAEARVQELQKSLKRAIVKSKSYFELKAQFNDILEEHKARILQLEDRISKAKVNYSSTLRNLEQISEEIHAQRGQDQTMNGPISTCSGRSPPVGAETVSSTGTEGG 320          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Zebrafish
Match: sh3bp5a (SH3-domain binding protein 5a (BTK-associated) [Source:ZFIN;Acc:ZDB-GENE-111111-2])

HSP 1 Score: 113.235 bits (282), Expect = 4.299e-27
Identity = 78/236 (33.05%), Postives = 124/236 (52.54%), Query Frame = 3
Query:  147 PEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEA--LAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSE 848
            P +Q ELEKLN ++  IN+ E +L++ R  +   L + T  L E   KIG   + + +PY   +R   + Q E+Q A   Y+ A   L  +   ++  E   L ++S + D +  E+LN A  +V  ++  +  +  EH+    KY      +RQLEKK K  I K++PYF        +L++ K  +D  + K+   K  Y  +L+ LE IS++IH +R R   +GPRG GVG+E
Sbjct:   24 PRIQGELEKLNQSTDNINQWETELEDSRQKFRAVLVEATVKLDEQVKKIGK-AVEESKPYWEARRAARQAQVEAQKATQEYQRAIEILRAAKETIALAEERLLEEDSRQFDSAWQEMLNHATQRVMEAEQSRTRSEMEHRETAAKYNAAISHMRQLEKKLKRTINKSRPYFELKAKYYLQLEQLKRRVDERQAKLTQAKAEYRSALRNLETISDEIH-ERRRLSAIGPRGRGVGAE 257          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Zebrafish
Match: gtf2h4 (general transcription factor IIH, polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-030131-6779])

HSP 1 Score: 110.923 bits (276), Expect = 3.680e-26
Identity = 78/219 (35.62%), Postives = 117/219 (53.42%), Query Frame = 3
Query:  147 PEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYE-AACVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDR 800
            P +Q ELE LN AS +IN LE +L E R+SY   L+     L   G+++G   I K RPY   +R   E Q+E+Q AA RYE A  +  +  + V    + L  +   LD +  E+LN A +KVN ++ ++  +  EHQ      ++ E R++ L+K  K  I K+KPYF      +  L+E K  + + E++V   K  Y+ +L+ LE IS  IH  R
Sbjct:   79 PRIQEELEHLNQASDEINRLELQLDEARSSYRRILTDSARKLNAQGSQLGA-CIEKARPYYEARRLAKEAQQETQKAALRYERAVSMHTAAREMVYVAEQGLLADRNTLDPTWQEMLNHATAKVNEAEEERLRSEREHQRVTQLCQEAEARVQTLQKALKRVIIKSKPYFELKAQFNHILEEHKSKVVLLEERVAKVKTRYSVALRNLEQISEQIHAQR 296          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Zebrafish
Match: sh3bp5b (SH3-domain binding protein 5b (BTK-associated) [Source:ZFIN;Acc:ZDB-GENE-040426-2813])

HSP 1 Score: 102.834 bits (255), Expect = 1.636e-23
Identity = 75/238 (31.51%), Postives = 124/238 (52.10%), Query Frame = 3
Query:  141 LNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEA--LAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSE 848
            ++P +Q ELEKLN ++  IN  E +L++ R  +   L + T  L EL  KIG   + + +PY   +R   + Q E+Q +   ++ A   L  +   ++  E   L  +  + D +  E+LN A  +V  ++  K  +   H+     Y     R++Q EKK K  I K+KPYF        +L++ K N+D  + K+   K  Y  +L++LE IS++IH +R R+  +GPR  GVG+E
Sbjct:   22 VDPRIQGELEKLNQSTDDINRCETELEDARQKFRSVLVEATLKLDELVKKIGK-AVEESKPYWEARRVARQTQLEAQRSTQDFQRATEVLRAAKETIALAEQRLLEDDKRQFDSAWQEMLNHATQRVMEAEQIKTRSELLHKETAANYTAAMSRMKQQEKKLKRTINKSKPYFEMKAKYYLQLEQLKKNVDDLQAKLTQAKGEYKSALRKLEMISDEIH-ERRRSLGIGPRERGVGAE 257          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Xenopus
Match: sh3bp5l (SH3-binding domain protein 5 like [Source:NCBI gene;Acc:100101740])

HSP 1 Score: 122.479 bits (306), Expect = 1.356e-30
Identity = 88/268 (32.84%), Postives = 141/268 (52.61%), Query Frame = 3
Query:  102 VKMQEYNNINDG-------DLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYE-AACVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSEL-VSVAHCNTG 878
            +K+ E +N  DG       +L+P +Q ELE+LN AS +IN LE +L E R +Y   L++    L  L  ++G   I K RPY   +R   E Q+++  AA RYE A  +  +  + V    + +  +  +LD +  E+LN A  KVN ++ ++  +  EHQ    +  + E +++ L+K  K  I K++PYF     ++  L+E K  +   E+ V   KL Y+ +L+ LE IS +IH  R ++ LL  R   +G+E   SV    TG
Sbjct:   39 IKLSESSN--DGKKEEIEEELDPRIQEELERLNQASEEINLLELQLDEARTAYRRILTESARRLNGLATQLGA-CIDKARPYYEARRLAKEAQQDTHSAALRYERAVSMHAAAREMVFVAEQGVTADKNRLDPTWQEMLNHATCKVNEAEEERLRSEFEHQRVTRQCHEAEAKVQTLQKSLKRFIIKSRPYFELKSQLNTILEEHKSRVTSLENSVAQAKLRYSGTLRNLEQISEEIHARRTQSSLLSQRAPPLGAEAPPSVKDGETG 303          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Xenopus
Match: prr14l (proline rich 14-like [Source:Xenbase;Acc:XB-GENE-980699])

HSP 1 Score: 113.62 bits (283), Expect = 4.965e-27
Identity = 79/239 (33.05%), Postives = 126/239 (52.72%), Query Frame = 3
Query:  138 DLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEA--LAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSE 848
            +++P +Q ELEKLN ++  IN  E +L++ R  +   L++ T  L E+  KIG   +   +PY   ++   + Q E+Q A   ++ A   L  +   +S  E   L  +  + D +  E+LN A  +V   + KK  +   H+    KY     R++QLEKK K  I K+KPYF        +L++ K  +D  + K+ + K  Y  +L+ LE IS++IH +R R   +GPRG GVGSE
Sbjct:   22 EVDPRIQGELEKLNQSTDDINRREIELEDARQKFRSVLTEATLKLDEMVKKIGK-AVEDSKPYWEARKVARQAQLEAQKATQDFQRATEVLRAAKETISLAEQRLLEDDKRQFDSAWQEMLNHATQRVMEEEQKKTRSELVHKETAAKYNAAMGRMKQLEKKLKRTINKSKPYFELKAKYYLQLEQLKKTVDELQAKLSLAKGEYKTALKNLEMISDEIH-ERRRTSAMGPRGRGVGSE 258          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Xenopus
Match: prr14l (proline rich 14-like [Source:Xenbase;Acc:XB-GENE-980699])

HSP 1 Score: 77.411 bits (189), Expect = 5.669e-15
Identity = 67/239 (28.03%), Postives = 109/239 (45.61%), Query Frame = 3
Query:  138 DLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEA--LAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSE 848
            +++P +Q ELEKLN ++  IN  E +L++ R  +   L++ T  L E+  KIG   +   +PY   ++   + Q E+Q A   ++ A   L  +   +S  E   L  +  + D +  E+LN A  +V   + KK  +   H+    KY        QL+K                             +D  + K+ + K  Y  +L+ LE IS++IH +R R   +GPRG GVGSE
Sbjct:   14 EVDPRIQGELEKLNQSTDDINRREIELEDARQKFRSVLTEATLKLDEMVKKIG-KAVEDSKPYWEARKVARQAQLEAQKATQDFQRATEVLRAAKETISLAEQRLLEDDKRQFDSAWQEMLNHATQRVMEEEQKKTRSELVHKETAAKYN------AQLKK----------------------------TVDELQAKLSLAKGEYKTALKNLEMISDEIH-ERRRTSAMGPRGRGVGSE 216          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Mouse
Match: Sh3bp5 (SH3-domain binding protein 5 (BTK-associated) [Source:MGI Symbol;Acc:MGI:1344391])

HSP 1 Score: 115.931 bits (289), Expect = 6.417e-28
Identity = 79/238 (33.19%), Postives = 126/238 (52.94%), Query Frame = 3
Query:  141 LNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEA--LAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSE 848
            ++P +Q ELEKLN ++  IN  E +L++ R  +   L + T  L EL  KIG   +   +PY   +R   + Q E+Q A   ++ A   L  +   +S  E   L  +  + D +  E+LN A  +V  ++  K  +   H+    +Y     R+RQLEKK K  I K+KPYF        +L++ K  +D  + K+ + K  Y  +L+ LE IS++IH +R R++ +GPRG GVG+E
Sbjct:   44 VDPRIQGELEKLNQSTDDINRRETELEDARQKFRSVLVEATVKLDELAKKIGK-AVEDSKPYWEARRVARQAQLEAQKATQDFQRATEVLRAAKETISLAEQRLLEDDKRQFDSAWQEMLNHATQRVMEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKPYFELKAKYYVQLEQLKKTVDDLQAKLALAKGEYKAALKSLERISDEIH-ERRRSNAMGPRGCGVGAE 279          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Mouse
Match: Sh3bp5 (SH3-domain binding protein 5 (BTK-associated) [Source:MGI Symbol;Acc:MGI:1344391])

HSP 1 Score: 115.931 bits (289), Expect = 7.151e-28
Identity = 79/238 (33.19%), Postives = 126/238 (52.94%), Query Frame = 3
Query:  141 LNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEA--LAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSE 848
            ++P +Q ELEKLN ++  IN  E +L++ R  +   L + T  L EL  KIG   +   +PY   +R   + Q E+Q A   ++ A   L  +   +S  E   L  +  + D +  E+LN A  +V  ++  K  +   H+    +Y     R+RQLEKK K  I K+KPYF        +L++ K  +D  + K+ + K  Y  +L+ LE IS++IH +R R++ +GPRG GVG+E
Sbjct:   44 VDPRIQGELEKLNQSTDDINRRETELEDARQKFRSVLVEATVKLDELAKKIGK-AVEDSKPYWEARRVARQAQLEAQKATQDFQRATEVLRAAKETISLAEQRLLEDDKRQFDSAWQEMLNHATQRVMEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKPYFELKAKYYVQLEQLKKTVDDLQAKLALAKGEYKAALKSLERISDEIH-ERRRSNAMGPRGCGVGAE 279          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Mouse
Match: Sh3bp5l (SH3 binding domain protein 5 like [Source:MGI Symbol;Acc:MGI:1933124])

HSP 1 Score: 114.005 bits (284), Expect = 1.539e-27
Identity = 82/241 (34.02%), Postives = 125/241 (51.87%), Query Frame = 3
Query:  138 DLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYE-AACVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRE--RNHLLGP-RGEGVGSE 848
            +L+P +Q ELE LN AS +IN++E +L E R +Y   L +    L   G+ +G+  I K RPY   +R   E Q+E+Q AA RYE A  +  +  + V    + +  +  +LD +  E+LN A  KVN ++ ++     EHQ      +  E R++ L+K  +  I K++PYF       + L+E K  +   E +V   K  Y+ +L+ LE IS  IH  R     H LGP R   VG+E
Sbjct:   55 ELDPRIQEELEHLNQASEEINQVELQLDEARTTYRRILQESARKLNTQGSHLGS-CIEKARPYYEARRLAKEAQQETQKAALRYERAVSMHNAAREMVFVAEQGVMADKNRLDPTWQEMLNHATCKVNEAEEERLRGEREHQRVTRLCQQAEARVQALQKTLRRAIGKSRPYFELKAQFSQILEEHKAKVTELEQQVAQAKTRYSVALRNLEQISEQIHARRRGLPPHPLGPRRSSPVGAE 294          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Mouse
Match: Sh3bp5l (SH3 binding domain protein 5 like [Source:MGI Symbol;Acc:MGI:1933124])

HSP 1 Score: 114.005 bits (284), Expect = 1.539e-27
Identity = 82/241 (34.02%), Postives = 125/241 (51.87%), Query Frame = 3
Query:  138 DLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYE-AACVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRE--RNHLLGP-RGEGVGSE 848
            +L+P +Q ELE LN AS +IN++E +L E R +Y   L +    L   G+ +G+  I K RPY   +R   E Q+E+Q AA RYE A  +  +  + V    + +  +  +LD +  E+LN A  KVN ++ ++     EHQ      +  E R++ L+K  +  I K++PYF       + L+E K  +   E +V   K  Y+ +L+ LE IS  IH  R     H LGP R   VG+E
Sbjct:   55 ELDPRIQEELEHLNQASEEINQVELQLDEARTTYRRILQESARKLNTQGSHLGS-CIEKARPYYEARRLAKEAQQETQKAALRYERAVSMHNAAREMVFVAEQGVMADKNRLDPTWQEMLNHATCKVNEAEEERLRGEREHQRVTRLCQQAEARVQALQKTLRRAIGKSRPYFELKAQFSQILEEHKAKVTELEQQVAQAKTRYSVALRNLEQISEQIHARRRGLPPHPLGPRRSSPVGAE 294          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Mouse
Match: Sh3bp5 (SH3-domain binding protein 5 (BTK-associated) [Source:MGI Symbol;Acc:MGI:1344391])

HSP 1 Score: 93.9745 bits (232), Expect = 2.411e-20
Identity = 67/213 (31.46%), Postives = 109/213 (51.17%), Query Frame = 3
Query:  216 LQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEA--LAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSE 848
            +++ R  +   L + T  L EL  KIG   +   +PY   +R   + Q E+Q A   ++ A   L  +   +S  E   L  +  + D +  E+LN A  +V  ++  K  +   H+    +Y     R+RQLEKK K  I K+KPYF        +L++ K  +D  + K+ + K  Y  +L+ LE IS++IH +R R++ +GPRG GVG+E
Sbjct:   67 VKDARQKFRSVLVEATVKLDELAKKIGK-AVEDSKPYWEARRVARQAQLEAQKATQDFQRATEVLRAAKETISLAEQRLLEDDKRQFDSAWQEMLNHATQRVMEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKPYFELKAKYYVQLEQLKKTVDDLQAKLALAKGEYKAALKSLERISDEIH-ERRRSNAMGPRGCGVGAE 277          
BLAST of SH3 domain-binding protein 5-like vs. UniProt/SwissProt
Match: sp|A4IH82|3BP5L_XENTR (SH3 domain-binding protein 5-like OS=Xenopus tropicalis OX=8364 GN=sh3bp5l PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 7.182e-30
Identity = 88/268 (32.84%), Postives = 141/268 (52.61%), Query Frame = 3
Query:  102 VKMQEYNNINDG-------DLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYE-AACVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSEL-VSVAHCNTG 878
            +K+ E +N  DG       +L+P +Q ELE+LN AS +IN LE +L E R +Y   L++    L  L  ++G   I K RPY   +R   E Q+++  AA RYE A  +  +  + V    + +  +  +LD +  E+LN A  KVN ++ ++  +  EHQ    +  + E +++ L+K  K  I K++PYF     ++  L+E K  +   E+ V   KL Y+ +L+ LE IS +IH  R ++ LL  R   +G+E   SV    TG
Sbjct:   39 IKLSESSN--DGKKEEIEEELDPRIQEELERLNQASEEINLLELQLDEARTAYRRILTESARRLNGLATQLGA-CIDKARPYYEARRLAKEAQQDTHSAALRYERAVSMHAAAREMVFVAEQGVTADKNRLDPTWQEMLNHATCKVNEAEEERLRSEFEHQRVTRQCHEAEAKVQTLQKSLKRFIIKSRPYFELKSQLNTILEEHKSRVTSLENSVAQAKLRYSGTLRNLEQISEEIHARRTQSSLLSQRAPPLGAEAPPSVKDGETG 303          
BLAST of SH3 domain-binding protein 5-like vs. UniProt/SwissProt
Match: sp|Q9V785|3BP5H_DROME (SH3 domain-binding protein 5 homolog OS=Drosophila melanogaster OX=7227 GN=pcs PE=1 SV=4)

HSP 1 Score: 124.02 bits (310), Expect = 8.177e-30
Identity = 85/255 (33.33%), Postives = 140/255 (54.90%), Query Frame = 3
Query:  117 YNNINDGDLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEALAKE-------SPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDR-ERNHLLGPRGEGVGSELVS 857
             ++  DG+L+P++Q+ELE LN+A+ +IN+LE +L+E  +++   L++ T  L     K+GN  I K RPY     +  E Q E Q AA +++ A    +   A   +  ALA++         + D++  E+LN A  KV  ++ +K + H EHQ     +   E++++QLE + +  I K++PYF   +   ++L+  K  I   + +V   K  Y+ +L+ LE IS DIHR R +     GPR  GVG+EL S
Sbjct:    1 MSSAEDGELDPQIQIELENLNSATDEINKLEIELEEANSTFRILLNESTRRLKVSSKKLGN-CIEKARPYYEALDKAREAQIECQKAAVKFQRA----NEIHAAAKETVALAEQRFMSNSHEWQFDNAWQEMLNHATQKVMDAETQKADCHAEHQRLTKLFNAAEQKLQQLEDRFRRSINKSRPYFEEKQVCQDQLQTQKNRIQELQQQVAGAKSTYSTALRNLERISEDIHRQRGDFPTPPGPREPGVGAELNS 250          
BLAST of SH3 domain-binding protein 5-like vs. UniProt/SwissProt
Match: sp|Q5U584|3BP5L_XENLA (SH3 domain-binding protein 5-like OS=Xenopus laevis OX=8355 GN=sh3bp5l PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.365e-28
Identity = 82/249 (32.93%), Postives = 132/249 (53.01%), Query Frame = 3
Query:  138 DLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYE-AACVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSEL-VSVAHCNTG 878
            +L+P +Q ELE+LN AS +IN LE +L E R +Y   L++    L  L  ++G   I K RPY   +R   E Q+++  AA RYE A  +  +  + V    + +  +  +LD +  E+LN A  KVN ++ ++  +  EHQ       + E +++ L+K  K  I K++PYF     ++  L+E K  + + E+ V   KL Y+ +L  LE IS +IH  R ++ +L  R   +G+E   SV    TG
Sbjct:   56 ELDPRIQEELERLNQASEEINLLELQLDEARTAYRRILTESARRLNGLATQLGA-CIDKARPYYEARRLAKEAQQDTHSAALRYERAVSMHAAAREMVFVAEQGVTADKNRLDPTWQEMLNHATCKVNEAEEERLRSEFEHQRVTRLCHEAEAKVQTLQKSLKRLIIKSRPYFELKAQLNTILEEHKSRVTLLENSVAQAKLRYSGTLHNLEKISEEIHARRTQSSVLSQRAPPLGAEAPPSVKDGETG 303          
BLAST of SH3 domain-binding protein 5-like vs. UniProt/SwissProt
Match: sp|Q5R9X9|3BP5L_PONAB (SH3 domain-binding protein 5-like OS=Pongo abelii OX=9601 GN=SH3BP5L PE=2 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 3.007e-27
Identity = 85/254 (33.46%), Postives = 131/254 (51.57%), Query Frame = 3
Query:  138 DLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYE-AACVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERN---HLLGP-RGEGVGSELVSVAHCNTGDN 884
            +L+P +Q ELE LN AS +IN++E +L E R +Y   L +    L   G+ +G+  I K RPY   +R   E Q+E+Q AA RYE A  +  +  + V+   + +  +  +LD +  E+LN A  KVN ++ ++     EHQ      +  E R++ L+K  +  I K++PYF       + L+E K  +   E +V   K  Y+ +L+ LE IS  IH  R  +   H LGP R   VG+E       +TGD 
Sbjct:   55 ELDPRIQEELEHLNQASEEINQVELQLDEARTTYRRILQESARKLNTQGSHLGS-CIEKARPYYEARRLAKEAQQETQKAALRYERAVSMHNAAREMVLVAEQGVMADKNRLDPTWQEMLNHATCKVNEAEEERLRGEREHQRVTRLCQQAEARVQALQKTLRRAIGKSRPYFELKAQFSQILEEHKAKVTELEQQVAQAKTRYSVALRNLEQISEQIHARRRGDLPPHPLGPRRSSPVGAE---AGPEDTGDG 304          
BLAST of SH3 domain-binding protein 5-like vs. UniProt/SwissProt
Match: sp|Q91Y80|3BP5_RAT (SH3 domain-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Sh3bp5 PE=1 SV=2)

HSP 1 Score: 116.316 bits (290), Expect = 3.164e-27
Identity = 79/238 (33.19%), Postives = 126/238 (52.94%), Query Frame = 3
Query:  141 LNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEA--LAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSE 848
            ++P +Q ELEKLN ++  IN  E +L++ R  +   L + T  L EL  KIG   +   +PY   +R   + Q E+Q A   ++ A   L  +   +S  E   L  +  + D +  E+LN A  +V  ++  K  +   H+    +Y     R+RQLEKK K  I K+KPYF        +L++ K  +D  + K+ + K  Y  +L+ LE IS++IH +R R++ +GPRG GVG+E
Sbjct:   43 VDPRIQGELEKLNQSTDDINRRETELEDARQKFRSVLVEATVKLDELAKKIGK-AVEDSKPYWEARRVARQAQLEAQKATQDFQRATEVLRAAKETISLAEQRLLEDDKRQFDSAWQEMLNHATQRVMEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKPYFELKAKYYVQLEQLKKTVDDLQAKLALAKGEYKAALKSLERISDEIH-ERRRSNAMGPRGCGVGAE 278          
BLAST of SH3 domain-binding protein 5-like vs. TrEMBL
Match: K1QRI4 (SH3 domain-binding protein 5-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10016675 PE=4 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.516e-37
Identity = 93/251 (37.05%), Postives = 147/251 (58.57%), Query Frame = 3
Query:  120 NNINDGDLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEAL--AKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDR---ERNHLLGPRGEGVGSELVS 857
            +++ D  L+P +Q ELE+LN AS +IN+LE +L + R S+ + L+  T  L  L  K+G+ V+ K RPY   + +  E   E+Q AA R+E AC     +  +V   E     +E P  D +  E+LN A  KVN ++ ++NE+  +H++ + K++D EE +  L+++ K  I K+KPYF      ++ ++E K  I + E+ V   K +Y+E+L+ LE IS++IH+ R    RN  LG RG GVGSE  S
Sbjct:   14 DDLEDESLDPRIQGELERLNKASEEINKLELELDDARASFRQALTDSTHQLNSLAKKLGS-VVEKARPYYDARMKAKEAHIETQKAALRFERACSMHEAAKEMVQLAEQGYNCREEPS-DPAWQEMLNHATMKVNEAEKERNESEQDHRHIMIKFQDCEEVVHHLQRELKRAIAKSKPYFEMKAKFNQTMEEQKRGIKILEEDVSSAKTMYSEALRNLETISDEIHQQRIEKRRNDELGERGAGVGSETPS 262          
BLAST of SH3 domain-binding protein 5-like vs. TrEMBL
Match: A0A1I8JK45 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 8.301e-35
Identity = 89/265 (33.58%), Postives = 142/265 (53.58%), Query Frame = 3
Query:  132 DGDLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEALAKESPK---LDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIH-RDRERNHL----------------------LGPRGEGVGSE 848
            D +++P V+ ELEK+N  + Q+NE+E  LQ+ RN +   L++  T L  + + IG   + K RP+   KRQ   +Q E+Q AA RYE +C  L  +  +V   EA    + +   +D++   +LN A  KV  ++ ++     EH      +   + R+R +E   ++ I K++PYF  +    + L E K +++VYE+KVRICK +Y+E+L+ LE IS  IH R RE N++                      LG RG+GVG+E
Sbjct:   39 DAEVDPRVEDELEKMNMVALQLNEVETTLQQARNHFRSLLAETATKLEAVQSGIGVACVEKARPFYEAKRQCRLLQMETQSAALRYERSCEMLGAAKDLVRTAEASCPATGRGGQVDETWAMMLNQATEKVAKAEDERRHHAAEHARLTEMFAGAQTRVRLMESSLRSAIKKSRPYFEANARYQQALIEQKQHVEVYEEKVRICKRLYDEALRTLETISESIHTRRREENNVKKQKLKLGKQQQSTDEDSALQALGERGQGVGAE 303          
BLAST of SH3 domain-binding protein 5-like vs. TrEMBL
Match: A0A267G088 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029240g1 PE=4 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 4.601e-34
Identity = 88/265 (33.21%), Postives = 141/265 (53.21%), Query Frame = 3
Query:  132 DGDLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEALAKESPK---LDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIH-RDRERNHL----------------------LGPRGEGVGSE 848
            D +++P V+ ELEK+N  + Q+NE+E  LQ+ RN +   L++    L  + + IG   + K RP+   KRQ   +Q E+Q AA RYE +C  L  +  +V   EA    + +   +D++   +LN A  KV  ++ ++     EH      +   + R+R +E   ++ I K++PYF  +    + L E K +++VYE+KVRICK +Y+E+L+ LE IS  IH R RE N++                      LG RG+GVG+E
Sbjct:   40 DAEVDPRVEDELEKMNMVALQLNEVETTLQQARNHFRSLLAETAAKLEAVQSGIGVACVEKARPFYEAKRQCRLLQMETQSAALRYERSCEMLGAAKDLVRTAEASCPATGRGGQVDETWAMMLNQATEKVAKAEDERRHHAAEHARLTEMFAGAQTRVRLMESSLRSAIKKSRPYFEANARYQQALIEQKQHVEVYEEKVRICKRLYDEALRTLEAISESIHTRRREENNVKKQKLKLGKQQQSTDEDSALQALGERGQGVGAE 304          
BLAST of SH3 domain-binding protein 5-like vs. TrEMBL
Match: A0A3S1B4K5 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_016348 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 2.760e-33
Identity = 96/275 (34.91%), Postives = 152/275 (55.27%), Query Frame = 3
Query:  120 NNINDGDLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVS-KNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHR---DRERNHLLGPRGEGVGSELVS-VAHCNTGDNKEQSDKTPAVESTTE 929
            + + + +L+P +Q+ELE+LN AS +IN+LE +L + R  + + LS  T  L  L  K+GN  + K RPY   + +  E   ESQ AA R+E AC     +  +V    E   +    LD +  E+LN A  KVN ++ ++ E+ + HQ     ++  EE +++L+K  K  ITK++PYF      ++ ++E K  +   E+ V   K +Y+++L+ LE IS+DIHR   +R +N  LG RG GVG+E  S     + G N E S  + A +S  E
Sbjct:   11 DEVEEEELDPRIQVELERLNKASEEINKLELELDDARAGFRQVLSDSTQCLNGLAKKLGN-CVDKARPYYDSRMKLKEAHVESQKAALRFERACSMHEAAKEMVQLAEEGYKRREKDLDPTWQEMLNHATMKVNEAEKERMESESHHQQTTISFKRKEEDVQKLQKDLKRSITKSRPYFEMKAKFNQVMEEQKSMVSRLEESVAQAKALYSQALRNLEAISDDIHRARLERRQNRELGERGAGVGAEAPSPPPSWDKGINIEGSASSCAFDSDGE 284          
BLAST of SH3 domain-binding protein 5-like vs. TrEMBL
Match: A0A1I8IHS8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012706g2 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 3.077e-33
Identity = 87/265 (32.83%), Postives = 140/265 (52.83%), Query Frame = 3
Query:  132 DGDLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEALAKESPK---LDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIH-RDRERNHL----------------------LGPRGEGVGSE 848
            D +++P V+ ELEK+N  + Q+NE+E  LQ+ RN +   L++    L  + + IG   + K RP+   KRQ   +Q E+Q AA RYE +C  L  +  +V   EA    + +   +D++   +LN A  KV  ++ ++     EH      +   + R+R +E   ++ I K++PYF  +    + L E K +++VYE+KVRICK +Y+E+L+ LE IS  IH R RE  ++                      LG RG+GVG+E
Sbjct:   41 DAEVDPRVEDELEKMNMVALQLNEVETTLQQARNHFRSLLAETAAKLEAVQSGIGVACVEKARPFYEAKRQCRLLQMETQSAALRYERSCEMLGTAKDLVRTAEASCPATGRGGQVDETWAMMLNQATEKVAKAEDERRHHAAEHARLTEMFAGAQTRVRLMESSLRSAIKKSRPYFEANARYQQALIEQKQHVEVYEEKVRICKRLYDEALRTLETISESIHTRRREEKNVKKQKLKLGKQQQSTDEDSALQALGERGQGVGAE 305          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Cavefish
Match: sh3bp5la (SH3 domain-binding protein 5-like [Source:NCBI gene;Acc:103037673])

HSP 1 Score: 112.079 bits (279), Expect = 1.075e-26
Identity = 89/254 (35.04%), Postives = 133/254 (52.36%), Query Frame = 3
Query:  132 DGDLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLS----KCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYE-AACVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNH-------LLGPRGEGVGSELVS 857
            D +L+P +Q ELE LN AS +IN+LE +L E R+SY + L+    K  TH ++LG  I      K RPY   +R   E Q+E+Q AA  YE A  +  +  + V    + LA +   LD +  E+LN A +KVN ++ ++  +  EH       +  E R++ L+K  K  I K+KPYF      +  L+E KL +   E++V   K  Y+ +L+RLE IS +IH  R  ++           R   VG+E VS
Sbjct:   83 DEELDPRIQEELEHLNEASEEINQLELQLDEARSSYRKILTDSARKLNTHSSQLGTSIE-----KARPYYEARRLAKEAQQETQKAALSYERAVSMHTAAREMVYVAEQGLAADKT-LDQTWQEMLNHATAKVNEAEEERLRSEREHMRVTQLCQAAEARVQTLQKSLKRAIIKSKPYFELKAQFNCILEEHKLKVTELENRVTEVKKSYSITLRRLEKISEEIHAQRGVDYSEEGSRKAFDARSPPVGAEAVS 330          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Cavefish
Match: sh3bp5b (SH3 domain binding protein 5 [Source:NCBI gene;Acc:103047550])

HSP 1 Score: 110.923 bits (276), Expect = 2.712e-26
Identity = 77/238 (32.35%), Postives = 125/238 (52.52%), Query Frame = 3
Query:  141 LNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEA--LAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSE 848
            ++P +Q ELEKLN ++  IN  E +L++ R  +   L + T  L EL  KIG   +   +PY   +R   + Q E+Q A   ++ A   L  +   ++  E   L  +  + D +  E+LN A  +V  ++  K  +   H+    +Y     R++QLEKK K  I+K+KPYF        +L++ K N+D  + K+   K  Y  +L+ LE IS++IH +R R+  +GPR  GVG+E
Sbjct:   22 VDPRIQGELEKLNQSTDDINRCETELEDARQRFRSVLVEATVKLDELVKKIGK-AVEDSKPYWEARRMARQAQLEAQKATQDFQRATEVLRAAKETIALAEQRLLEDDKRQFDSAWQEMLNHATQRVMEAEQTKTRSELLHKETAARYTAAMSRMKQLEKKLKRTISKSKPYFELKAKYYLQLEQLKKNVDDLQAKLTQAKGEYKTALKNLEMISDEIH-ERRRSSTIGPRERGVGAE 257          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Cavefish
Match: gtf2h4 (SH3 domain-binding protein 5-like [Source:NCBI gene;Acc:103042605])

HSP 1 Score: 110.538 bits (275), Expect = 5.302e-26
Identity = 78/219 (35.62%), Postives = 116/219 (52.97%), Query Frame = 3
Query:  147 PEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYE-AACVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDR 800
            P +Q ELE LN AS +IN LE +L E R+SY   L+     L   G+++G   I K RPY   +R   E Q+E+Q AA RYE A  +  +  + V    + L  +   +D +  E+LN A SKVN ++ ++  +  EHQ      ++ E R++ L+K  K  I K+KPYF      +  L+E K  +   E++V   K  Y+ +L+ LE IS  IH  R
Sbjct:  117 PRIQEELEHLNQASDEINRLELQLDEARSSYRRILTDSARKLNAQGSQLGA-CIEKARPYYEARRLAKEAQQETQKAALRYERAVSMHTAAREMVYVAEQGLLADRNTMDPTWQEMLNHATSKVNEAEEERLRSEREHQRVTQLCQEAEARVQTLQKALKRVILKSKPYFELKAQFNHILEEHKSKVVQLEERVAKVKTRYSVALRNLEQISEQIHAQR 334          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Cavefish
Match: sh3bp5a (SH3 domain-binding protein 5-like [Source:NCBI gene;Acc:103037459])

HSP 1 Score: 102.449 bits (254), Expect = 2.387e-23
Identity = 82/267 (30.71%), Postives = 131/267 (49.06%), Query Frame = 3
Query:  138 DLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEALAKE--SPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSELVSVAHCNTGDNKEQSDKTPAVESTTEK 932
            +++P +Q ELEKLN ++  IN  E +L++ R  +   L + T  L E   KIG   +   +PY   +R   + Q E+Q A   ++ A   L  +   ++  E    E  S + D +  E+LN A  +V  ++  +  +  EH+    KY      +RQLEKK K  I+K++PYF        +L++ K  +D  +  +   K  Y  +L  LE IS++IH  R R   +GPRG GVG+E    A     + K +SD    +  T E+
Sbjct:   21 EVDPRIQGELEKLNQSTDDINRWETELEDSRQRFRAVLVEATIKLDEQVKKIGK-AVEDSKPYWEARRVARQAQVEAQRATQEFQRAIEILRAAKETIALAEERLLEEESRQFDSAWQEMLNHATQRVMEAEQSRTSSELEHRETAAKYNAAISHMRQLEKKLKRTISKSRPYFELKAKYYLQLEQLKRRVDERQANLAKAKAEYRTALGNLEAISDEIH-ARRRLSAMGPRGCGVGAERDGGAGDEISNFKMESDGISMMSETFEE 285          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Cavefish
Match: sh3bp5la (SH3 domain-binding protein 5-like [Source:NCBI gene;Acc:103037673])

HSP 1 Score: 90.5077 bits (223), Expect = 2.167e-19
Identity = 76/231 (32.90%), Postives = 117/231 (50.65%), Query Frame = 3
Query:  201 ELENKLQELRNSYYETLS----KCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYE-AACVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNH-------LLGPRGEGVGSELVS 857
            EL+ ++QE R+SY + L+    K  TH ++LG  I      K RPY   +R   E Q+E+Q AA  YE A  +  +  + V    + LA +   LD +  E+LN A +KVN ++ ++  +  EH       +  E R++ L+K  K  I K+KPYF      +  L+E KL +   E++V   K  Y+ +L+RLE IS +IH  R  ++           R   VG+E VS
Sbjct:   85 ELDPRIQEARSSYRKILTDSARKLNTHSSQLGTSIE-----KARPYYEARRLAKEAQQETQKAALSYERAVSMHTAAREMVYVAEQGLAADKT-LDQTWQEMLNHATAKVNEAEEERLRSEREHMRVTQLCQAAEARVQTLQKSLKRAIIKSKPYFELKAQFNCILEEHKLKVTELENRVTEVKKSYSITLRRLEKISEEIHAQRGVDYSEEGSRKAFDARSPPVGAEAVS 309          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Sea Lamprey
Match: sh3bp5b (SH3-domain binding protein 5b (BTK-associated) [Source:ZFIN;Acc:ZDB-GENE-040426-2813])

HSP 1 Score: 94.7449 bits (234), Expect = 1.323e-21
Identity = 85/298 (28.52%), Postives = 138/298 (46.31%), Query Frame = 3
Query:  132 DGDLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEA--LAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEE--RIRQLEKKHKNDITKAKPYFSY-SKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSELVSVAHCNTGDNKEQSDKTPAVESTTEKSTKLPIHSGKRKAHLSTSTPIVDGLL 1010
            D  ++P VQ+ELEKLN ++  IN LE +L+E R+ +   L++ T  L E   K+G +V  + +PY   +R   + Q  +Q A   ++ A   L  +   ++  E   L +E    D +  E+LN A  KV  + ++K  A  +     N  +      R RQ        +TK  PY+   +KY  E L+  K  ++  ++ V   K  Y  +L  LE IS++IH  R+ + +  PRG GVG+E         G      D   AV S   +S    + + K   +L + +P   G +
Sbjct:   42 DEGVDPRVQIELEKLNQSTDAINRLETELEEARSRFRVVLAEATAKLDEFLKKLGKSVE-ESKPYWEARRAARQAQVLAQKATQDFQRASEVLRAAKETIALAEERLLEQEDRHFDSAWQEMLNHATLKV-AAGVEKETAEQDSTRKRNARKQTAAVNRRRQTYDSLSRGVTKNLPYYELKAKYYLE-LEHQKQRVEGLQEAVAATKGQYRAALDSLERISDEIHARRKASAVEEPRGRGVGAETTGAFSMELGFFSMDGDSFSAVASDACESDACSLMASKDDNYLESCSPCAGGAV 336          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Nematostella
Match: EDO45811 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR8])

HSP 1 Score: 61.2326 bits (147), Expect = 1.626e-11
Identity = 43/130 (33.08%), Postives = 70/130 (53.85%), Query Frame = 3
Query:  138 DLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNE----ALAKESPKLDDSTMEILNIAISKV 515
             L+P V+ ELE+LN+A+ +IN LE  L+E+   + +TL++    L    N+ G   I + RPY     +  + Q  +Q AA +YE AC     +   V++ E    + +KE   LD +  ++LN A+ KV
Sbjct:    3 SLDPRVKGELERLNSATTEINCLEKALEEMHALFRQTLTESAFVLKSHANRYG-KFINQSRPYYEALERSKKAQIATQKAALKYERACCTHQAAKETVARAEEKLVSTSKEHKVLDPTWQDMLNKAVMKV 131          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Nematostella
Match: EDO49513 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGF2])

HSP 1 Score: 50.0618 bits (118), Expect = 1.023e-7
Identity = 28/69 (40.58%), Postives = 40/69 (57.97%), Query Frame = 3
Query:  138 DLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQ 344
            +L+P +Q ELEKLN A+  IN LE +L E R  + +TL+  T  L  +  K+G   + K RP+    RQ
Sbjct:    3 ELDPRIQDELEKLNAATNSINHLEAELDEARAVFRQTLAGATYQLNAVAAKLG-KCVEKSRPFYESYRQ 70          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Medaka
Match: gtf2h4 (SH3 domain-binding protein 5-like [Source:NCBI gene;Acc:101172093])

HSP 1 Score: 120.553 bits (301), Expect = 5.498e-30
Identity = 83/238 (34.87%), Postives = 125/238 (52.52%), Query Frame = 3
Query:  138 DLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYE-AACVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSE 848
            +L+P +Q ELE+LN AS +IN LE +L E R+SY + LS     L  L +++G     + RPY   +R   E Q+E+Q AA RYE A  +  +  + V    + L  +   +D +  E+LN A +KVN ++ ++  + +EHQ      +D E R+  L+K  K  I K+KPYF      +  L+E K  +   E +V   K  Y+ +L+ LE IS  IH  R R      R   VG+E
Sbjct:   28 ELDPRIQEELEQLNQASEEINRLELQLDEARSSYRKILSDSARRLKALSSQLGA-CTERARPYYEARRLAKEAQQETQKAALRYERAVSMHAAAREMVHVAEQGLLADKNTMDPTWQEMLNHATAKVNEAEEERLRSEHEHQRVTQLCQDAEARVLTLQKALKKVILKSKPYFELKAQFNHILEEHKAEVVQLEKQVTAVKTRYSVALRNLEQISEQIHAQRGRTATCDGRSSPVGAE 264          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Medaka
Match: sh3bp5b (SH3 domain binding protein 5 [Source:NCBI gene;Acc:101173891])

HSP 1 Score: 114.005 bits (284), Expect = 2.096e-27
Identity = 84/253 (33.20%), Postives = 131/253 (51.78%), Query Frame = 3
Query:  147 PEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEA--LAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSELVSVAHCNTGDNKEQSD 899
            P +Q ELEKLN +S  IN  E +L++ R  +   L + T  L EL  KIG   + + +PY   +R   + Q E+Q A+  Y+ A   L  +   +S  E   L  ++ + D +  E+LN A  +V  ++  K  +   H+   +KY      ++QLEKK K  I+K+KPYF        +L+  K  +D  + K+   K  Y  +L+ LE IS++IH  R  +  +GPRG GVG+E  SV+  +    K +SD
Sbjct:   23 PRIQGELEKLNQSSDDINRCETELEDARQKFRSVLVEATVKLDELVKKIGK-AVEESKPYWEARRLARQAQLEAQKASQGYQKATEVLRAAKETISLAEQRLLEDDNRQFDSAWQEMLNHATQRVMEAEHTKTRSELLHKETASKYTAATSCMKQLEKKLKRTISKSKPYFEMKAKYYLQLENLKKIVDERQAKLSQAKGEYKAALKNLETISDEIHERRRSSCAMGPRGSGVGAERDSVSGDDMSSFKMESD 274          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Medaka
Match: sh3bp5b (SH3 domain binding protein 5 [Source:NCBI gene;Acc:101173891])

HSP 1 Score: 113.62 bits (283), Expect = 3.702e-27
Identity = 84/253 (33.20%), Postives = 131/253 (51.78%), Query Frame = 3
Query:  147 PEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEA--LAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSELVSVAHCNTGDNKEQSD 899
            P +Q ELEKLN +S  IN  E +L++ R  +   L + T  L EL  KIG   + + +PY   +R   + Q E+Q A+  Y+ A   L  +   +S  E   L  ++ + D +  E+LN A  +V  ++  K  +   H+   +KY      ++QLEKK K  I+K+KPYF        +L+  K  +D  + K+   K  Y  +L+ LE IS++IH  R  +  +GPRG GVG+E  SV+  +    K +SD
Sbjct:   23 PRIQGELEKLNQSSDDINRCETELEDARQKFRSVLVEATVKLDELVKKIGK-AVEESKPYWEARRLARQAQLEAQKASQGYQKATEVLRAAKETISLAEQRLLEDDNRQFDSAWQEMLNHATQRVMEAEHTKTRSELLHKETASKYTAATSCMKQLEKKLKRTISKSKPYFEMKAKYYLQLENLKKIVDERQAKLSQAKGEYKAALKNLETISDEIHERRRSSCAMGPRGSGVGAERDSVSGDDMSSFKMESD 274          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Medaka
Match: sh3bp5la (SH3 domain-binding protein 5-like [Source:NCBI gene;Acc:101159043])

HSP 1 Score: 109.768 bits (273), Expect = 6.352e-26
Identity = 86/252 (34.13%), Postives = 136/252 (53.97%), Query Frame = 3
Query:  120 NNINDGDLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYE-AACVQLSHSDAV-VSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDR-------ERNHLLGPRGEGVGSE 848
            N+ ++ +L+P +Q ELE+LN ASA+IN LE  L + R+SY + L++    L    +++G+  I K RPY   +R   E Q+E+Q AA  YE A  +  +  + V V++   LA  +  LD +  E+LN A +KVN ++ ++  +  EH    +  ++ E R++ L+K  K  I K+KPYF      +  L+E K  +   E +V   K  Y+ +L+ LE IS  IH  R       E + L G R   VG+E
Sbjct:   65 NSPHEEELDPRIQQELEQLNEASAEINRLELLLDDARSSYRKILTESARKLNAHSSQLGS-CIDKARPYYEARRLAKEAQQETQKAALSYERAVSMHAAAREMVYVAEQGLLADGTNTLDPTWQEMLNHATAKVNEAEEERVRSEREHMRVTHACQEAEARVQMLQKSLKRLIVKSKPYFELKAQFNHILEEHKTKVLQLEQQVSKVKNHYSIALRNLEQISEQIHAQRGTDPAEGELSSLCGGRSPPVGAE 315          
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Medaka
Match: ENSORLT00000007170.2 (SH3 domain-binding protein 5 [Source:NCBI gene;Acc:101157228])

HSP 1 Score: 102.064 bits (253), Expect = 2.829e-23
Identity = 70/238 (29.41%), Postives = 127/238 (53.36%), Query Frame = 3
Query:  141 LNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEA--LAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSE 848
            ++P +Q ELEKLN ++  IN  E++L++ R  +   L++ T  L ++  KIG   + + +PY   ++   + Q E+Q A   ++ A   L  +   ++  E   L +++ + D +  E+LN A  +V  ++  +  +  EH+     Y      ++QLEKK K  I K++PYF        +L++ K ++D  + K+ + K  Y  +L+ LE IS +IH  R R+  +G R +GVG+E
Sbjct:   21 VDPRIQGELEKLNQSTDDINRWESELEDFRQRFRLVLAEATLKLDDVMKKIGR-AVEESKPYWEARKVARQAQIEAQQATQEFQRAVEILRAAKETIALAEERLLEEDTRQFDSAWQEMLNHATQRVMEAEQARTRSEAEHRKTAANYNACIGHMKQLEKKLKRSINKSRPYFELKAKYYLQLEQLKRHVDERQAKLVVAKAEYRMALRNLESISEEIHAQR-RSLAMGTREQGVGAE 256          
BLAST of SH3 domain-binding protein 5-like vs. Planmine SMEST
Match: SMESG000061052.1 (SMESG000061052.1)

HSP 1 Score: 741.88 bits (1914), Expect = 0.000e+0
Identity = 361/365 (98.90%), Postives = 363/365 (99.45%), Query Frame = 3
Query:  108 MQEYNNINDGDLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSELVSVAHCNTGDNKEQSDKTPAVESTTEKSTKLPIHSGKRKAHLSTSTPIVDGLLQAISLNYSNYHPHFHTNGGALEISQCNSHNDGYNKMKSEILHFDNFDFLTDYIDESDENGSAEN 1202
            MQEYNNINDGDLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEALAKESPKLDDS MEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVG+ELVSVAHCNTGDNKEQSDKTPAVESTTEKS KLPIHSGKRKAHLSTSTPIVDGLLQAISLNYSN+HPHFHTNGGALEISQCNSHNDGYNKMKSEILHFDNFDFLTDYIDESDENGSAEN
Sbjct:    1 MQEYNNINDGDLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSKCTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQLSHSDAVVSKNEALAKESPKLDDSAMEILNIAISKVNLSKLKKNEAHNEHQYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNIDVYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGAELVSVAHCNTGDNKEQSDKTPAVESTTEKSAKLPIHSGKRKAHLSTSTPIVDGLLQAISLNYSNHHPHFHTNGGALEISQCNSHNDGYNKMKSEILHFDNFDFLTDYIDESDENGSAEN 365          
The following BLAST results are available for this feature:
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SH3BP5L2.483e-2733.88SH3 binding domain protein 5 like [Source:HGNC Sym... [more]
SH3BP59.160e-2732.16SH3 domain binding protein 5 [Source:HGNC Symbol;A... [more]
SH3BP57.496e-1436.67SH3 domain binding protein 5 [Source:HGNC Symbol;A... [more]
SH3BP57.397e-1334.31SH3 domain binding protein 5 [Source:HGNC Symbol;A... [more]
SH3BP57.397e-1334.31SH3 domain binding protein 5 [Source:HGNC Symbol;A... [more]
back to top
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rei-21.710e-1631.96Guanine nucleotide exchange factor rei-2 [Source:... [more]
back to top
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcs8.158e-3133.33gene:FBgn0033988 transcript:FBtr0301507[more]
CG144081.298e-2432.89gene:FBgn0030581 transcript:FBtr0073990[more]
CG144082.266e-2030.04gene:FBgn0030581 transcript:FBtr0339447[more]
CG144083.795e-2030.04gene:FBgn0030581 transcript:FBtr0340466[more]
CG144083.795e-2030.04gene:FBgn0030581 transcript:FBtr0305580[more]
back to top
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3bp5la4.724e-2831.42SH3-binding domain protein 5-like, a [Source:ZFIN;... [more]
sh3bp5la4.724e-2831.42SH3-binding domain protein 5-like, a [Source:ZFIN;... [more]
sh3bp5a4.299e-2733.05SH3-domain binding protein 5a (BTK-associated) [So... [more]
gtf2h43.680e-2635.62general transcription factor IIH, polypeptide 4 [S... [more]
sh3bp5b1.636e-2331.51SH3-domain binding protein 5b (BTK-associated) [So... [more]
back to top
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
sh3bp5l1.356e-3032.84SH3-binding domain protein 5 like [Source:NCBI gen... [more]
prr14l4.965e-2733.05proline rich 14-like [Source:Xenbase;Acc:XB-GENE-9... [more]
prr14l5.669e-1528.03proline rich 14-like [Source:Xenbase;Acc:XB-GENE-9... [more]
back to top
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sh3bp56.417e-2833.19SH3-domain binding protein 5 (BTK-associated) [Sou... [more]
Sh3bp57.151e-2833.19SH3-domain binding protein 5 (BTK-associated) [Sou... [more]
Sh3bp5l1.539e-2734.02SH3 binding domain protein 5 like [Source:MGI Symb... [more]
Sh3bp5l1.539e-2734.02SH3 binding domain protein 5 like [Source:MGI Symb... [more]
Sh3bp52.411e-2031.46SH3-domain binding protein 5 (BTK-associated) [Sou... [more]
back to top
BLAST of SH3 domain-binding protein 5-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4IH82|3BP5L_XENTR7.182e-3032.84SH3 domain-binding protein 5-like OS=Xenopus tropi... [more]
sp|Q9V785|3BP5H_DROME8.177e-3033.33SH3 domain-binding protein 5 homolog OS=Drosophila... [more]
sp|Q5U584|3BP5L_XENLA1.365e-2832.93SH3 domain-binding protein 5-like OS=Xenopus laevi... [more]
sp|Q5R9X9|3BP5L_PONAB3.007e-2733.46SH3 domain-binding protein 5-like OS=Pongo abelii ... [more]
sp|Q91Y80|3BP5_RAT3.164e-2733.19SH3 domain-binding protein 5 OS=Rattus norvegicus ... [more]
back to top
BLAST of SH3 domain-binding protein 5-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QRI43.516e-3737.05SH3 domain-binding protein 5-like protein OS=Crass... [more]
A0A1I8JK458.301e-3533.58Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267G0884.601e-3433.21Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A3S1B4K52.760e-3334.91Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A1I8IHS83.077e-3332.83Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sh3bp5la1.075e-2635.04SH3 domain-binding protein 5-like [Source:NCBI gen... [more]
sh3bp5b2.712e-2632.35SH3 domain binding protein 5 [Source:NCBI gene;Acc... [more]
gtf2h45.302e-2635.62SH3 domain-binding protein 5-like [Source:NCBI gen... [more]
sh3bp5a2.387e-2330.71SH3 domain-binding protein 5-like [Source:NCBI gen... [more]
sh3bp5la2.167e-1932.90SH3 domain-binding protein 5-like [Source:NCBI gen... [more]
back to top
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sh3bp5b1.323e-2128.52SH3-domain binding protein 5b (BTK-associated) [So... [more]
back to top
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO458111.626e-1133.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495131.023e-740.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SH3 domain-binding protein 5-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gtf2h45.498e-3034.87SH3 domain-binding protein 5-like [Source:NCBI gen... [more]
sh3bp5b2.096e-2733.20SH3 domain binding protein 5 [Source:NCBI gene;Acc... [more]
sh3bp5b3.702e-2733.20SH3 domain binding protein 5 [Source:NCBI gene;Acc... [more]
sh3bp5la6.352e-2634.13SH3 domain-binding protein 5-like [Source:NCBI gen... [more]
ENSORLT00000007170.22.829e-2329.41SH3 domain-binding protein 5 [Source:NCBI gene;Acc... [more]
back to top
BLAST of SH3 domain-binding protein 5-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000061052.10.000e+098.90SMESG000061052.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016832 ID=SMED30016832|Name=SH3 domain-binding protein 5-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1274bp
TTAAAATAATAAATACTTTATTTATAAATTTAAATAATATTTATTTTATT
CCAAAAATATTTCTGTAGTTGTTTTATATTAAAATGACCTATATATAAAT
TGTAAAAATGCAGGAGTATAACAACATCAACGATGGTGATTTAAATCCTG
AAGTTCAATTAGAATTAGAAAAATTAAATACAGCATCAGCTCAAATAAAT
GAACTTGAAAATAAGTTACAGGAATTAAGAAATTCCTATTATGAAACCCT
ATCCAAATGCACAACTCATTTAACCGAATTAGGTAACAAAATTGGTAATA
ATGTAATCTTAAAAGTCAGACCATATGTTTACTTAAAGCGCCAGCAAATT
GAAATTCAAAAAGAAAGTCAAATTGCGGCCACGAGATATGAAGCAGCGTG
TGTTCAGTTGAGTCACTCTGATGCTGTAGTTTCAAAAAATGAAGCATTAG
CCAAAGAGTCACCGAAATTAGATGATAGCACGATGGAAATATTAAACATT
GCAATATCAAAAGTGAATTTGTCAAAATTGAAAAAAAATGAAGCCCACAA
TGAGCATCAGTATTATTTGAATAAATACAGAGACATGGAAGAGAGAATTC
GCCAATTAGAAAAAAAGCACAAAAATGACATAACAAAAGCCAAGCCGTAT
TTTAGTTACTCAAAGTATATGGACGAGAGATTGAAGGAAAGCAAACTCAA
TATCGACGTGTACGAAGATAAAGTGCGCATCTGCAAATTGATATACAACG
AATCCTTACAGCGACTGGAAGATATATCCAATGATATTCACAGGGACCGA
GAAAGGAATCATTTGCTGGGCCCGCGTGGCGAAGGCGTTGGCTCGGAATT
GGTGTCGGTGGCCCATTGCAATACCGGGGATAACAAGGAGCAATCCGACA
AAACTCCTGCTGTAGAGAGCACAACAGAGAAATCGACAAAGCTTCCAATT
CATAGTGGAAAGAGAAAAGCCCATCTCAGTACATCTACTCCTATTGTCGA
CGGATTACTTCAAGCAATCTCATTGAATTATTCCAATTATCATCCTCATT
TCCACACAAACGGTGGTGCCCTTGAGATTTCACAGTGCAACTCCCACAAT
GACGGCTATAATAAAATGAAATCGGAAATTCTTCATTTCGATAATTTCGA
TTTTTTAACTGATTATATCGATGAAAGTGATGAGAATGGTTCGGCTGAAA
ATTGAATTTTTTAATCTCATTTAATTATGCTTTGTATTTTGTATTCAAAT
AACAATTTTGTCAGTTTTGAAAAA
back to top

protein sequence of SMED30016832-orf-1

>SMED30016832-orf-1 ID=SMED30016832-orf-1|Name=SMED30016832-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=366bp
MQEYNNINDGDLNPEVQLELEKLNTASAQINELENKLQELRNSYYETLSK
CTTHLTELGNKIGNNVILKVRPYVYLKRQQIEIQKESQIAATRYEAACVQ
LSHSDAVVSKNEALAKESPKLDDSTMEILNIAISKVNLSKLKKNEAHNEH
QYYLNKYRDMEERIRQLEKKHKNDITKAKPYFSYSKYMDERLKESKLNID
VYEDKVRICKLIYNESLQRLEDISNDIHRDRERNHLLGPRGEGVGSELVS
VAHCNTGDNKEQSDKTPAVESTTEKSTKLPIHSGKRKAHLSTSTPIVDGL
LQAISLNYSNYHPHFHTNGGALEISQCNSHNDGYNKMKSEILHFDNFDFL
TDYIDESDENGSAEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR007940SH3BP5
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 150..177
NoneNo IPR availableCOILSCoilCoilcoord: 16..50
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 255..290
IPR007940SH3-binding 5PFAMPF05276SH3BP5coord: 12..236
e-value: 6.1E-51
score: 173.4
IPR007940SH3-binding 5PANTHERPTHR19423SH3 DOMAIN-BINDING PROTEIN 5coord: 9..297